From b4859cda6bdc452ab2557c7934c649b7f3e52459 Mon Sep 17 00:00:00 2001 From: "dependabot[bot]" <49699333+dependabot[bot]@users.noreply.github.com> Date: Sun, 18 Dec 2022 17:14:23 +0000 Subject: [PATCH] Bump github.com/hashicorp/terraform-plugin-docs from 0.7.0 to 0.13.0 Bumps [github.com/hashicorp/terraform-plugin-docs](https://github.com/hashicorp/terraform-plugin-docs) from 0.7.0 to 0.13.0. - [Release notes](https://github.com/hashicorp/terraform-plugin-docs/releases) - [Changelog](https://github.com/hashicorp/terraform-plugin-docs/blob/main/CHANGELOG.md) - [Commits](https://github.com/hashicorp/terraform-plugin-docs/compare/v0.7.0...v0.13.0) --- updated-dependencies: - dependency-name: github.com/hashicorp/terraform-plugin-docs dependency-type: direct:production update-type: version-update:semver-minor ... Signed-off-by: dependabot[bot] --- go.mod | 26 +- go.sum | 57 +- .../goutils/cryptorandomstringutils.go | 25 +- .../Masterminds/goutils/randomstringutils.go | 24 +- .../Masterminds/goutils/stringutils.go | 16 + .../github.com/Masterminds/semver/.travis.yml | 29 - .../Masterminds/semver/CHANGELOG.md | 109 - vendor/github.com/Masterminds/semver/Makefile | 36 - .../github.com/Masterminds/semver/README.md | 194 - .../Masterminds/semver/appveyor.yml | 44 - .../Masterminds/semver/constraints.go | 423 -- vendor/github.com/Masterminds/semver/doc.go | 115 - .../Masterminds/semver/v3/.gitignore | 1 + .../Masterminds/semver/v3/.golangci.yml | 26 + .../Masterminds/semver/v3/CHANGELOG.md | 194 + .../Masterminds/semver/{ => v3}/LICENSE.txt | 0 .../github.com/Masterminds/semver/v3/Makefile | 37 + .../Masterminds/semver/v3/README.md | 244 ++ .../Masterminds/semver/{ => v3}/collection.go | 0 .../Masterminds/semver/v3/constraints.go | 568 +++ .../github.com/Masterminds/semver/v3/doc.go | 184 + .../github.com/Masterminds/semver/v3/fuzz.go | 22 + .../Masterminds/semver/{ => v3}/version.go | 251 +- .../Masterminds/semver/version_fuzz.go | 10 - .../github.com/Masterminds/sprig/.travis.yml | 26 - vendor/github.com/Masterminds/sprig/Makefile | 13 - .../github.com/Masterminds/sprig/appveyor.yml | 26 - .../github.com/Masterminds/sprig/glide.yaml | 19 - .../github.com/Masterminds/sprig/numeric.go | 169 - vendor/github.com/Masterminds/sprig/regex.go | 35 - .../Masterminds/sprig/{ => v3}/.gitignore | 0 .../Masterminds/sprig/{ => v3}/CHANGELOG.md | 88 + .../Masterminds/sprig/{ => v3}/LICENSE.txt | 3 +- .../github.com/Masterminds/sprig/v3/Makefile | 9 + .../Masterminds/sprig/{ => v3}/README.md | 25 +- .../Masterminds/sprig/{ => v3}/crypto.go | 261 +- .../Masterminds/sprig/{ => v3}/date.go | 69 + .../Masterminds/sprig/{ => v3}/defaults.go | 82 +- .../Masterminds/sprig/{ => v3}/dict.go | 57 +- .../Masterminds/sprig/{ => v3}/doc.go | 2 +- .../Masterminds/sprig/{ => v3}/functions.go | 184 +- .../Masterminds/sprig/{ => v3}/list.go | 215 +- .../Masterminds/sprig/{ => v3}/network.go | 2 +- .../Masterminds/sprig/v3/numeric.go | 186 + .../Masterminds/sprig/{ => v3}/reflect.go | 0 .../github.com/Masterminds/sprig/v3/regex.go | 83 + .../Masterminds/sprig/{ => v3}/semver.go | 2 +- .../Masterminds/sprig/{ => v3}/strings.go | 13 +- .../Masterminds/sprig/{ => v3}/url.go | 36 +- vendor/github.com/google/uuid/hash.go | 4 +- vendor/github.com/google/uuid/null.go | 118 + vendor/github.com/google/uuid/sql.go | 2 +- vendor/github.com/google/uuid/uuid.go | 55 +- vendor/github.com/google/uuid/version4.go | 35 +- .../github.com/hashicorp/errwrap/errwrap.go | 9 + .../internal/cmd/generate.go | 70 +- .../internal/cmd/validate.go | 37 +- .../internal/provider/generate.go | 129 +- .../internal/provider/template.go | 48 +- .../internal/provider/util.go | 19 + .../schemamd/behaviors.go | 7 +- .../terraform-plugin-docs/schemamd/render.go | 70 +- vendor/github.com/imdario/mergo/README.md | 32 +- vendor/github.com/imdario/mergo/merge.go | 2 +- vendor/github.com/imdario/mergo/mergo.go | 4 +- vendor/github.com/mitchellh/cli/.travis.yml | 16 - vendor/github.com/mitchellh/cli/README.md | 11 +- vendor/github.com/mitchellh/cli/cli.go | 11 +- vendor/github.com/posener/complete/.gitignore | 2 + .../github.com/posener/complete/.travis.yml | 19 +- .../posener/complete/{readme.md => README.md} | 42 +- vendor/github.com/posener/complete/args.go | 24 +- vendor/github.com/posener/complete/cmd/cmd.go | 2 +- .../posener/complete/cmd/install/bash.go | 13 +- .../posener/complete/cmd/install/fish.go | 47 +- .../posener/complete/cmd/install/install.go | 33 +- .../posener/complete/cmd/install/utils.go | 5 +- .../posener/complete/cmd/install/zsh.go | 13 +- .../github.com/posener/complete/complete.go | 39 +- vendor/github.com/posener/complete/doc.go | 110 + .../github.com/posener/complete/goreadme.json | 9 + vendor/github.com/posener/complete/log.go | 3 +- .../github.com/posener/complete/match/file.go | 19 - .../posener/complete/match/match.go | 6 - .../posener/complete/match/prefix.go | 9 - .../posener/complete/metalinter.json | 21 - .../posener/complete/predict_files.go | 74 +- vendor/github.com/posener/complete/test.sh | 12 - vendor/github.com/posener/complete/utils.go | 46 - .../github.com/shopspring/decimal/.gitignore | 9 + .../github.com/shopspring/decimal/.travis.yml | 19 + .../shopspring/decimal/CHANGELOG.md | 49 + vendor/github.com/shopspring/decimal/LICENSE | 45 + .../github.com/shopspring/decimal/README.md | 130 + .../shopspring/decimal/decimal-go.go | 415 ++ .../github.com/shopspring/decimal/decimal.go | 1904 +++++++++ .../github.com/shopspring/decimal/rounding.go | 160 + vendor/github.com/spf13/cast/.gitignore | 25 + vendor/github.com/spf13/cast/LICENSE | 21 + vendor/github.com/spf13/cast/Makefile | 40 + vendor/github.com/spf13/cast/README.md | 75 + vendor/github.com/spf13/cast/cast.go | 176 + vendor/github.com/spf13/cast/caste.go | 1476 +++++++ .../spf13/cast/timeformattype_string.go | 27 + vendor/golang.org/x/crypto/bcrypt/base64.go | 35 + vendor/golang.org/x/crypto/bcrypt/bcrypt.go | 295 ++ vendor/golang.org/x/crypto/blowfish/block.go | 159 + vendor/golang.org/x/crypto/blowfish/cipher.go | 99 + vendor/golang.org/x/crypto/blowfish/const.go | 199 + .../golang.org/x/sys/unix/asm_linux_loong64.s | 4 +- vendor/golang.org/x/sys/unix/ifreq_linux.go | 9 +- vendor/golang.org/x/sys/unix/syscall_aix.go | 4 +- vendor/golang.org/x/sys/unix/syscall_bsd.go | 46 +- .../golang.org/x/sys/unix/syscall_darwin.go | 9 +- .../golang.org/x/sys/unix/syscall_illumos.go | 5 +- vendor/golang.org/x/sys/unix/syscall_linux.go | 45 +- .../x/sys/unix/syscall_linux_loong64.go | 39 +- .../x/sys/unix/syscall_linux_riscv64.go | 1 + .../x/sys/unix/syscall_openbsd_mips64.go | 4 + .../golang.org/x/sys/unix/syscall_solaris.go | 51 +- vendor/golang.org/x/sys/unix/syscall_unix.go | 74 +- vendor/golang.org/x/sys/unix/zerrors_linux.go | 39 +- .../x/sys/unix/zerrors_linux_386.go | 4 +- .../x/sys/unix/zerrors_linux_amd64.go | 4 +- .../x/sys/unix/zerrors_linux_arm.go | 4 +- .../x/sys/unix/zerrors_linux_arm64.go | 5 +- .../x/sys/unix/zerrors_linux_loong64.go | 6 +- .../x/sys/unix/zerrors_linux_mips.go | 4 +- .../x/sys/unix/zerrors_linux_mips64.go | 4 +- .../x/sys/unix/zerrors_linux_mips64le.go | 4 +- .../x/sys/unix/zerrors_linux_mipsle.go | 4 +- .../x/sys/unix/zerrors_linux_ppc.go | 4 +- .../x/sys/unix/zerrors_linux_ppc64.go | 4 +- .../x/sys/unix/zerrors_linux_ppc64le.go | 4 +- .../x/sys/unix/zerrors_linux_riscv64.go | 4 +- .../x/sys/unix/zerrors_linux_s390x.go | 4 +- .../x/sys/unix/zerrors_linux_sparc64.go | 4 +- .../x/sys/unix/zsyscall_darwin_amd64.go | 24 + .../x/sys/unix/zsyscall_darwin_amd64.s | 6 + .../x/sys/unix/zsyscall_darwin_arm64.go | 24 + .../x/sys/unix/zsyscall_darwin_arm64.s | 6 + .../x/sys/unix/zsyscall_linux_loong64.go | 25 - .../x/sys/unix/zsyscall_linux_riscv64.go | 11 + .../x/sys/unix/zsyscall_solaris_amd64.go | 14 + .../x/sys/unix/zsysnum_linux_loong64.go | 2 - .../x/sys/unix/zsysnum_linux_riscv64.go | 1 + .../x/sys/unix/ztypes_darwin_amd64.go | 73 +- .../x/sys/unix/ztypes_darwin_arm64.go | 73 +- vendor/golang.org/x/sys/unix/ztypes_linux.go | 22 +- .../golang.org/x/sys/unix/ztypes_linux_386.go | 9 +- .../x/sys/unix/ztypes_linux_amd64.go | 8 +- .../golang.org/x/sys/unix/ztypes_linux_arm.go | 9 +- .../x/sys/unix/ztypes_linux_arm64.go | 8 +- .../x/sys/unix/ztypes_linux_loong64.go | 8 +- .../x/sys/unix/ztypes_linux_mips.go | 9 +- .../x/sys/unix/ztypes_linux_mips64.go | 8 +- .../x/sys/unix/ztypes_linux_mips64le.go | 8 +- .../x/sys/unix/ztypes_linux_mipsle.go | 9 +- .../golang.org/x/sys/unix/ztypes_linux_ppc.go | 9 +- .../x/sys/unix/ztypes_linux_ppc64.go | 8 +- .../x/sys/unix/ztypes_linux_ppc64le.go | 8 +- .../x/sys/unix/ztypes_linux_riscv64.go | 8 +- .../x/sys/unix/ztypes_linux_s390x.go | 8 +- .../x/sys/unix/ztypes_linux_sparc64.go | 8 +- .../x/sys/unix/ztypes_openbsd_386.go | 8 +- .../x/sys/unix/ztypes_openbsd_amd64.go | 8 +- .../x/sys/unix/ztypes_openbsd_arm.go | 8 +- .../x/sys/unix/ztypes_openbsd_arm64.go | 8 +- .../x/sys/unix/ztypes_openbsd_mips64.go | 8 +- .../x/sys/unix/ztypes_solaris_amd64.go | 2 +- vendor/golang.org/x/text/cases/cases.go | 162 + vendor/golang.org/x/text/cases/context.go | 376 ++ vendor/golang.org/x/text/cases/fold.go | 34 + vendor/golang.org/x/text/cases/icu.go | 62 + vendor/golang.org/x/text/cases/info.go | 82 + vendor/golang.org/x/text/cases/map.go | 816 ++++ .../golang.org/x/text/cases/tables10.0.0.go | 2256 +++++++++++ .../golang.org/x/text/cases/tables11.0.0.go | 2317 +++++++++++ .../golang.org/x/text/cases/tables12.0.0.go | 2360 +++++++++++ .../golang.org/x/text/cases/tables13.0.0.go | 2400 ++++++++++++ vendor/golang.org/x/text/cases/tables9.0.0.go | 2216 +++++++++++ vendor/golang.org/x/text/cases/trieval.go | 214 + vendor/golang.org/x/text/internal/internal.go | 49 + .../x/text/internal/language/common.go | 16 + .../x/text/internal/language/compact.go | 29 + .../text/internal/language/compact/compact.go | 61 + .../internal/language/compact/language.go | 260 ++ .../text/internal/language/compact/parents.go | 120 + .../text/internal/language/compact/tables.go | 1015 +++++ .../x/text/internal/language/compact/tags.go | 91 + .../x/text/internal/language/compose.go | 167 + .../x/text/internal/language/coverage.go | 28 + .../x/text/internal/language/language.go | 627 +++ .../x/text/internal/language/lookup.go | 412 ++ .../x/text/internal/language/match.go | 226 ++ .../x/text/internal/language/parse.go | 604 +++ .../x/text/internal/language/tables.go | 3464 +++++++++++++++++ .../x/text/internal/language/tags.go | 48 + vendor/golang.org/x/text/internal/match.go | 67 + vendor/golang.org/x/text/internal/tag/tag.go | 100 + vendor/golang.org/x/text/language/coverage.go | 187 + vendor/golang.org/x/text/language/doc.go | 102 + vendor/golang.org/x/text/language/go1_1.go | 39 + vendor/golang.org/x/text/language/go1_2.go | 12 + vendor/golang.org/x/text/language/language.go | 605 +++ vendor/golang.org/x/text/language/match.go | 735 ++++ vendor/golang.org/x/text/language/parse.go | 250 ++ vendor/golang.org/x/text/language/tables.go | 298 ++ vendor/golang.org/x/text/language/tags.go | 145 + vendor/modules.txt | 49 +- 210 files changed, 32639 insertions(+), 2128 deletions(-) delete mode 100644 vendor/github.com/Masterminds/semver/.travis.yml delete mode 100644 vendor/github.com/Masterminds/semver/CHANGELOG.md delete mode 100644 vendor/github.com/Masterminds/semver/Makefile delete mode 100644 vendor/github.com/Masterminds/semver/README.md delete mode 100644 vendor/github.com/Masterminds/semver/appveyor.yml delete mode 100644 vendor/github.com/Masterminds/semver/constraints.go delete mode 100644 vendor/github.com/Masterminds/semver/doc.go create mode 100644 vendor/github.com/Masterminds/semver/v3/.gitignore create mode 100644 vendor/github.com/Masterminds/semver/v3/.golangci.yml create mode 100644 vendor/github.com/Masterminds/semver/v3/CHANGELOG.md rename vendor/github.com/Masterminds/semver/{ => v3}/LICENSE.txt (100%) create mode 100644 vendor/github.com/Masterminds/semver/v3/Makefile create mode 100644 vendor/github.com/Masterminds/semver/v3/README.md rename vendor/github.com/Masterminds/semver/{ => v3}/collection.go (100%) create mode 100644 vendor/github.com/Masterminds/semver/v3/constraints.go create mode 100644 vendor/github.com/Masterminds/semver/v3/doc.go create mode 100644 vendor/github.com/Masterminds/semver/v3/fuzz.go rename vendor/github.com/Masterminds/semver/{ => v3}/version.go (58%) delete mode 100644 vendor/github.com/Masterminds/semver/version_fuzz.go delete mode 100644 vendor/github.com/Masterminds/sprig/.travis.yml delete mode 100644 vendor/github.com/Masterminds/sprig/Makefile delete mode 100644 vendor/github.com/Masterminds/sprig/appveyor.yml delete mode 100644 vendor/github.com/Masterminds/sprig/glide.yaml delete mode 100644 vendor/github.com/Masterminds/sprig/numeric.go delete mode 100644 vendor/github.com/Masterminds/sprig/regex.go rename vendor/github.com/Masterminds/sprig/{ => v3}/.gitignore (100%) rename vendor/github.com/Masterminds/sprig/{ => v3}/CHANGELOG.md (76%) rename vendor/github.com/Masterminds/sprig/{ => v3}/LICENSE.txt (96%) create mode 100644 vendor/github.com/Masterminds/sprig/v3/Makefile rename vendor/github.com/Masterminds/sprig/{ => v3}/README.md (65%) rename vendor/github.com/Masterminds/sprig/{ => v3}/crypto.go (65%) rename vendor/github.com/Masterminds/sprig/{ => v3}/date.go (52%) rename vendor/github.com/Masterminds/sprig/{ => v3}/defaults.go (53%) rename vendor/github.com/Masterminds/sprig/{ => v3}/dict.go (63%) rename vendor/github.com/Masterminds/sprig/{ => v3}/doc.go (92%) rename vendor/github.com/Masterminds/sprig/{ => v3}/functions.go (58%) rename vendor/github.com/Masterminds/sprig/{ => v3}/list.go (58%) rename vendor/github.com/Masterminds/sprig/{ => v3}/network.go (75%) create mode 100644 vendor/github.com/Masterminds/sprig/v3/numeric.go rename vendor/github.com/Masterminds/sprig/{ => v3}/reflect.go (100%) create mode 100644 vendor/github.com/Masterminds/sprig/v3/regex.go rename vendor/github.com/Masterminds/sprig/{ => v3}/semver.go (90%) rename vendor/github.com/Masterminds/sprig/{ => v3}/strings.go (97%) rename vendor/github.com/Masterminds/sprig/{ => v3}/url.go (64%) create mode 100644 vendor/github.com/google/uuid/null.go delete mode 100644 vendor/github.com/mitchellh/cli/.travis.yml rename vendor/github.com/posener/complete/{readme.md => README.md} (74%) create mode 100644 vendor/github.com/posener/complete/doc.go create mode 100644 vendor/github.com/posener/complete/goreadme.json delete mode 100644 vendor/github.com/posener/complete/match/file.go delete mode 100644 vendor/github.com/posener/complete/match/match.go delete mode 100644 vendor/github.com/posener/complete/match/prefix.go delete mode 100644 vendor/github.com/posener/complete/metalinter.json delete mode 100644 vendor/github.com/posener/complete/test.sh delete mode 100644 vendor/github.com/posener/complete/utils.go create mode 100644 vendor/github.com/shopspring/decimal/.gitignore create mode 100644 vendor/github.com/shopspring/decimal/.travis.yml create mode 100644 vendor/github.com/shopspring/decimal/CHANGELOG.md create mode 100644 vendor/github.com/shopspring/decimal/LICENSE create mode 100644 vendor/github.com/shopspring/decimal/README.md create mode 100644 vendor/github.com/shopspring/decimal/decimal-go.go create mode 100644 vendor/github.com/shopspring/decimal/decimal.go create mode 100644 vendor/github.com/shopspring/decimal/rounding.go create mode 100644 vendor/github.com/spf13/cast/.gitignore create mode 100644 vendor/github.com/spf13/cast/LICENSE create mode 100644 vendor/github.com/spf13/cast/Makefile create mode 100644 vendor/github.com/spf13/cast/README.md create mode 100644 vendor/github.com/spf13/cast/cast.go create mode 100644 vendor/github.com/spf13/cast/caste.go create mode 100644 vendor/github.com/spf13/cast/timeformattype_string.go create mode 100644 vendor/golang.org/x/crypto/bcrypt/base64.go create mode 100644 vendor/golang.org/x/crypto/bcrypt/bcrypt.go create mode 100644 vendor/golang.org/x/crypto/blowfish/block.go create mode 100644 vendor/golang.org/x/crypto/blowfish/cipher.go create mode 100644 vendor/golang.org/x/crypto/blowfish/const.go create mode 100644 vendor/golang.org/x/text/cases/cases.go create mode 100644 vendor/golang.org/x/text/cases/context.go create mode 100644 vendor/golang.org/x/text/cases/fold.go create mode 100644 vendor/golang.org/x/text/cases/icu.go create mode 100644 vendor/golang.org/x/text/cases/info.go create mode 100644 vendor/golang.org/x/text/cases/map.go create mode 100644 vendor/golang.org/x/text/cases/tables10.0.0.go create mode 100644 vendor/golang.org/x/text/cases/tables11.0.0.go create mode 100644 vendor/golang.org/x/text/cases/tables12.0.0.go create mode 100644 vendor/golang.org/x/text/cases/tables13.0.0.go create mode 100644 vendor/golang.org/x/text/cases/tables9.0.0.go create mode 100644 vendor/golang.org/x/text/cases/trieval.go create mode 100644 vendor/golang.org/x/text/internal/internal.go create mode 100644 vendor/golang.org/x/text/internal/language/common.go create mode 100644 vendor/golang.org/x/text/internal/language/compact.go create mode 100644 vendor/golang.org/x/text/internal/language/compact/compact.go create mode 100644 vendor/golang.org/x/text/internal/language/compact/language.go create mode 100644 vendor/golang.org/x/text/internal/language/compact/parents.go create mode 100644 vendor/golang.org/x/text/internal/language/compact/tables.go create mode 100644 vendor/golang.org/x/text/internal/language/compact/tags.go create mode 100644 vendor/golang.org/x/text/internal/language/compose.go create mode 100644 vendor/golang.org/x/text/internal/language/coverage.go create mode 100644 vendor/golang.org/x/text/internal/language/language.go create mode 100644 vendor/golang.org/x/text/internal/language/lookup.go create mode 100644 vendor/golang.org/x/text/internal/language/match.go create mode 100644 vendor/golang.org/x/text/internal/language/parse.go create mode 100644 vendor/golang.org/x/text/internal/language/tables.go create mode 100644 vendor/golang.org/x/text/internal/language/tags.go create mode 100644 vendor/golang.org/x/text/internal/match.go create mode 100644 vendor/golang.org/x/text/internal/tag/tag.go create mode 100644 vendor/golang.org/x/text/language/coverage.go create mode 100644 vendor/golang.org/x/text/language/doc.go create mode 100644 vendor/golang.org/x/text/language/go1_1.go create mode 100644 vendor/golang.org/x/text/language/go1_2.go create mode 100644 vendor/golang.org/x/text/language/language.go create mode 100644 vendor/golang.org/x/text/language/match.go create mode 100644 vendor/golang.org/x/text/language/parse.go create mode 100644 vendor/golang.org/x/text/language/tables.go create mode 100644 vendor/golang.org/x/text/language/tags.go diff --git a/go.mod b/go.mod index 160327a..ce77187 100644 --- a/go.mod +++ b/go.mod @@ -4,24 +4,24 @@ go 1.18 require ( code.gitea.io/sdk/gitea v0.15.1 - github.com/hashicorp/terraform-plugin-docs v0.7.0 + github.com/hashicorp/terraform-plugin-docs v0.13.0 github.com/hashicorp/terraform-plugin-sdk/v2 v2.20.0 ) require ( - github.com/Masterminds/goutils v1.1.0 // indirect - github.com/Masterminds/semver v1.5.0 // indirect - github.com/Masterminds/sprig v2.22.0+incompatible // indirect + github.com/Masterminds/goutils v1.1.1 // indirect + github.com/Masterminds/semver/v3 v3.1.1 // indirect + github.com/Masterminds/sprig/v3 v3.2.2 // indirect github.com/agext/levenshtein v1.2.2 // indirect github.com/apparentlymart/go-textseg/v13 v13.0.0 // indirect - github.com/armon/go-radix v0.0.0-20180808171621-7fddfc383310 // indirect + github.com/armon/go-radix v1.0.0 // indirect github.com/bgentry/speakeasy v0.1.0 // indirect github.com/davecgh/go-spew v1.1.1 // indirect github.com/fatih/color v1.13.0 // indirect github.com/golang/protobuf v1.5.2 // indirect github.com/google/go-cmp v0.5.8 // indirect - github.com/google/uuid v1.1.2 // indirect - github.com/hashicorp/errwrap v1.0.0 // indirect + github.com/google/uuid v1.3.0 // indirect + github.com/hashicorp/errwrap v1.1.0 // indirect github.com/hashicorp/go-checkpoint v0.5.0 // indirect github.com/hashicorp/go-cleanhttp v0.5.2 // indirect github.com/hashicorp/go-cty v1.4.1-0.20200414143053-d3edf31b6320 // indirect @@ -41,25 +41,27 @@ require ( github.com/hashicorp/terraform-svchost v0.0.0-20200729002733-f050f53b9734 // indirect github.com/hashicorp/yamux v0.0.0-20181012175058-2f1d1f20f75d // indirect github.com/huandu/xstrings v1.3.2 // indirect - github.com/imdario/mergo v0.3.12 // indirect + github.com/imdario/mergo v0.3.13 // indirect github.com/mattn/go-colorable v0.1.12 // indirect github.com/mattn/go-isatty v0.0.14 // indirect - github.com/mitchellh/cli v1.1.2 // indirect + github.com/mitchellh/cli v1.1.4 // indirect github.com/mitchellh/copystructure v1.2.0 // indirect github.com/mitchellh/go-testing-interface v1.14.1 // indirect github.com/mitchellh/go-wordwrap v1.0.0 // indirect github.com/mitchellh/mapstructure v1.5.0 // indirect github.com/mitchellh/reflectwalk v1.0.2 // indirect github.com/oklog/run v1.0.0 // indirect - github.com/posener/complete v1.1.1 // indirect + github.com/posener/complete v1.2.3 // indirect github.com/russross/blackfriday v1.6.0 // indirect + github.com/shopspring/decimal v1.3.1 // indirect + github.com/spf13/cast v1.5.0 // indirect github.com/vmihailenco/msgpack v4.0.4+incompatible // indirect github.com/vmihailenco/msgpack/v4 v4.3.12 // indirect github.com/vmihailenco/tagparser v0.1.1 // indirect github.com/zclconf/go-cty v1.10.0 // indirect - golang.org/x/crypto v0.0.0-20220517005047-85d78b3ac167 // indirect + golang.org/x/crypto v0.0.0-20220622213112-05595931fe9d // indirect golang.org/x/net v0.0.0-20211112202133-69e39bad7dc2 // indirect - golang.org/x/sys v0.0.0-20220503163025-988cb79eb6c6 // indirect + golang.org/x/sys v0.0.0-20220627191245-f75cf1eec38b // indirect golang.org/x/text v0.3.7 // indirect google.golang.org/appengine v1.6.6 // indirect google.golang.org/genproto v0.0.0-20200711021454-869866162049 // indirect diff --git a/go.sum b/go.sum index e928b27..7ebe58b 100644 --- a/go.sum +++ b/go.sum @@ -4,12 +4,14 @@ code.gitea.io/gitea-vet v0.2.1/go.mod h1:zcNbT/aJEmivCAhfmkHOlT645KNOf9W2KnkLgFj code.gitea.io/sdk/gitea v0.15.1 h1:WJreC7YYuxbn0UDaPuWIe/mtiNKTvLN8MLkaw71yx/M= code.gitea.io/sdk/gitea v0.15.1/go.mod h1:klY2LVI3s3NChzIk/MzMn7G1FHrfU7qd63iSMVoHRBA= github.com/BurntSushi/toml v0.3.1/go.mod h1:xHWCNGjB5oqiDr8zfno3MHue2Ht5sIBksp03qcyfWMU= -github.com/Masterminds/goutils v1.1.0 h1:zukEsf/1JZwCMgHiK3GZftabmxiCw4apj3a28RPBiVg= github.com/Masterminds/goutils v1.1.0/go.mod h1:8cTjp+g8YejhMuvIA5y2vz3BpJxksy863GQaJW2MFNU= -github.com/Masterminds/semver v1.5.0 h1:H65muMkzWKEuNDnfl9d70GUjFniHKHRbFPGBuZ3QEww= -github.com/Masterminds/semver v1.5.0/go.mod h1:MB6lktGJrhw8PrUyiEoblNEGEQ+RzHPF078ddwwvV3Y= -github.com/Masterminds/sprig v2.22.0+incompatible h1:z4yfnGrZ7netVz+0EDJ0Wi+5VZCSYp4Z0m2dk6cEM60= -github.com/Masterminds/sprig v2.22.0+incompatible/go.mod h1:y6hNFY5UBTIWBxnzTeuNhlNS5hqE0NB0E6fgfo2Br3o= +github.com/Masterminds/goutils v1.1.1 h1:5nUrii3FMTL5diU80unEVvNevw1nH4+ZV4DSLVJLSYI= +github.com/Masterminds/goutils v1.1.1/go.mod h1:8cTjp+g8YejhMuvIA5y2vz3BpJxksy863GQaJW2MFNU= +github.com/Masterminds/semver/v3 v3.1.1 h1:hLg3sBzpNErnxhQtUy/mmLR2I9foDujNK030IGemrRc= +github.com/Masterminds/semver/v3 v3.1.1/go.mod h1:VPu/7SZ7ePZ3QOrcuXROw5FAcLl4a0cBrbBpGY/8hQs= +github.com/Masterminds/sprig/v3 v3.2.0/go.mod h1:tWhwTbUTndesPNeF0C900vKoq283u6zp4APT9vaF3SI= +github.com/Masterminds/sprig/v3 v3.2.2 h1:17jRggJu518dr3QaafizSXOjKYp94wKfABxUmyxvxX8= +github.com/Masterminds/sprig/v3 v3.2.2/go.mod h1:UoaO7Yp8KlPnJIYWTFkMaqPUYKTfGFPhxNuwnnxkKlk= github.com/Microsoft/go-winio v0.4.14/go.mod h1:qXqCSQ3Xa7+6tgxaGTIe4Kpcdsi+P8jBhyzoq1bpyYA= github.com/Microsoft/go-winio v0.4.16 h1:FtSW/jqD+l4ba5iPBj9CODVtgfYAD8w2wS923g/cFDk= github.com/Microsoft/go-winio v0.4.16/go.mod h1:XB6nPKklQyQ7GC9LdcBEcBl8PF76WugXOPRXwdLnMv0= @@ -26,8 +28,9 @@ github.com/apparentlymart/go-textseg v1.0.0/go.mod h1:z96Txxhf3xSFMPmb5X/1W05FF/ github.com/apparentlymart/go-textseg/v12 v12.0.0/go.mod h1:S/4uRK2UtaQttw1GenVJEynmyUenKwP++x/+DdGV/Ec= github.com/apparentlymart/go-textseg/v13 v13.0.0 h1:Y+KvPE1NYz0xl601PVImeQfFyEy6iT90AvPUL1NNfNw= github.com/apparentlymart/go-textseg/v13 v13.0.0/go.mod h1:ZK2fH7c4NqDTLtiYLvIkEghdlcqw7yxLeM89kiTRPUo= -github.com/armon/go-radix v0.0.0-20180808171621-7fddfc383310 h1:BUAU3CGlLvorLI26FmByPp2eC2qla6E1Tw+scpcg/to= github.com/armon/go-radix v0.0.0-20180808171621-7fddfc383310/go.mod h1:ufUuZ+zHj4x4TnLV4JWEpy2hxWSpsRywHrMgIH9cCH8= +github.com/armon/go-radix v1.0.0 h1:F4z6KzEeeQIMeLFa97iZU6vupzoecKdU5TX24SNppXI= +github.com/armon/go-radix v1.0.0/go.mod h1:ufUuZ+zHj4x4TnLV4JWEpy2hxWSpsRywHrMgIH9cCH8= github.com/armon/go-socks5 v0.0.0-20160902184237-e75332964ef5/go.mod h1:wHh0iHkYZB8zMSxRWpUBQtwG5a7fFgvEO+odwuTv2gs= github.com/bgentry/speakeasy v0.1.0 h1:ByYyxL9InA1OWqxJqqp2A5pYHUrCiAL6K3J+LKSsQkY= github.com/bgentry/speakeasy v0.1.0/go.mod h1:+zsyZBPWlz7T6j88CTgSN5bM796AkVf0kBD4zp0CCIs= @@ -56,6 +59,7 @@ github.com/fatih/color v1.7.0/go.mod h1:Zm6kSWBoL9eyXnKyktHP6abPY2pDugNf5Kwzbycv github.com/fatih/color v1.13.0 h1:8LOYc1KYPPmyKMuN8QV2DNRWNbLo6LZ0iLs8+mlH53w= github.com/fatih/color v1.13.0/go.mod h1:kLAiJbzzSOZDVNGyDpeOxJ47H46qBXwg5ILebYFFOfk= github.com/flynn/go-shlex v0.0.0-20150515145356-3f9db97f8568/go.mod h1:xEzjJPgXI435gkrCt3MPfRiAkVrwSbHsst4LCFVfpJc= +github.com/frankban/quicktest v1.14.3 h1:FJKSZTDHjyhriyC81FLQ0LY93eSai0ZyR/ZIkd3ZUKE= github.com/ghodss/yaml v1.0.0/go.mod h1:4dBDuWmgqj2HViK6kFavaiC9ZROes6MMH2rRYeMEF04= github.com/gliderlabs/ssh v0.2.2/go.mod h1:U7qILu1NlMHj9FlMhZLlkCdDnU1DBEAqr0aevW3Awn0= github.com/go-git/gcfg v1.5.0 h1:Q5ViNfGF8zFgyJWPqYwA7qGFoMTEiBmdlkcfRmpIMa4= @@ -95,11 +99,14 @@ github.com/google/go-cmp v0.5.5/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/ github.com/google/go-cmp v0.5.6/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/gNBxE= github.com/google/go-cmp v0.5.8 h1:e6P7q2lk1O+qJJb4BtCQXlK8vWEO8V1ZeuEdJNOqZyg= github.com/google/go-cmp v0.5.8/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY= -github.com/google/uuid v1.1.2 h1:EVhdT+1Kseyi1/pUmXKaFxYsDNy9RQYkMWRH68J/W7Y= +github.com/google/uuid v1.1.1/go.mod h1:TIyPZe4MgqvfeYDBFedMoGGpEw/LqOeaOT+nhxU+yHo= github.com/google/uuid v1.1.2/go.mod h1:TIyPZe4MgqvfeYDBFedMoGGpEw/LqOeaOT+nhxU+yHo= +github.com/google/uuid v1.3.0 h1:t6JiXgmwXMjEs8VusXIJk2BXHsn+wx8BZdTaoZ5fu7I= +github.com/google/uuid v1.3.0/go.mod h1:TIyPZe4MgqvfeYDBFedMoGGpEw/LqOeaOT+nhxU+yHo= github.com/grpc-ecosystem/grpc-gateway v1.16.0/go.mod h1:BDjrQk3hbvj6Nolgz8mAMFbcEtjT1g+wF4CSlocrBnw= -github.com/hashicorp/errwrap v1.0.0 h1:hLrqtEDnRye3+sgx6z4qVLNuviH3MR5aQ0ykNJa/UYA= github.com/hashicorp/errwrap v1.0.0/go.mod h1:YH+1FKiLXxHSkmPseP+kNlulaMuP3n2brvKWEqk/Jc4= +github.com/hashicorp/errwrap v1.1.0 h1:OxrOeh75EUXMY8TBjag2fzXGZ40LB6IKw45YeGUDY2I= +github.com/hashicorp/errwrap v1.1.0/go.mod h1:YH+1FKiLXxHSkmPseP+kNlulaMuP3n2brvKWEqk/Jc4= github.com/hashicorp/go-checkpoint v0.5.0 h1:MFYpPZCnQqQTE18jFwSII6eUQrD/oxMFp3mlgcqk5mU= github.com/hashicorp/go-checkpoint v0.5.0/go.mod h1:7nfLNL10NsxqO4iWuW6tWW0HjZuDrwkBuEQsVcpCOgg= github.com/hashicorp/go-cleanhttp v0.5.0/go.mod h1:JpRdi6/HCYpAwUzNwuwqhbovhLtngrth3wmdIIUrZ80= @@ -133,8 +140,8 @@ github.com/hashicorp/terraform-exec v0.17.2 h1:EU7i3Fh7vDUI9nNRdMATCEfnm9axzTnad github.com/hashicorp/terraform-exec v0.17.2/go.mod h1:tuIbsL2l4MlwwIZx9HPM+LOV9vVyEfBYu2GsO1uH3/8= github.com/hashicorp/terraform-json v0.14.0 h1:sh9iZ1Y8IFJLx+xQiKHGud6/TSUCM0N8e17dKDpqV7s= github.com/hashicorp/terraform-json v0.14.0/go.mod h1:5A9HIWPkk4e5aeeXIBbkcOvaZbIYnAIkEyqP2pNSckM= -github.com/hashicorp/terraform-plugin-docs v0.7.0 h1:7XKAOYHAxghe7q4/vx468X43X9GikdQ2dxtmcu2gQv0= -github.com/hashicorp/terraform-plugin-docs v0.7.0/go.mod h1:57CICKfW7/KbW4lPhKOledyT6vu1LeAOzuvWXsVaxUE= +github.com/hashicorp/terraform-plugin-docs v0.13.0 h1:6e+VIWsVGb6jYJewfzq2ok2smPzZrt1Wlm9koLeKazY= +github.com/hashicorp/terraform-plugin-docs v0.13.0/go.mod h1:W0oCmHAjIlTHBbvtppWHe8fLfZ2BznQbuv8+UD8OucQ= github.com/hashicorp/terraform-plugin-go v0.12.0 h1:6wW9mT1dSs0Xq4LR6HXj1heQ5ovr5GxXNJwkErZzpJw= github.com/hashicorp/terraform-plugin-go v0.12.0/go.mod h1:kwhmaWHNDvT1B3QiSJdAtrB/D4RaKSY/v3r2BuoWK4M= github.com/hashicorp/terraform-plugin-log v0.7.0 h1:SDxJUyT8TwN4l5b5/VkiTIaQgY6R+Y2BQ0sRZftGKQs= @@ -147,11 +154,13 @@ github.com/hashicorp/terraform-svchost v0.0.0-20200729002733-f050f53b9734 h1:HKL github.com/hashicorp/terraform-svchost v0.0.0-20200729002733-f050f53b9734/go.mod h1:kNDNcF7sN4DocDLBkQYz73HGKwN1ANB1blq4lIYLYvg= github.com/hashicorp/yamux v0.0.0-20181012175058-2f1d1f20f75d h1:kJCB4vdITiW1eC1vq2e6IsrXKrZit1bv/TDYFGMp4BQ= github.com/hashicorp/yamux v0.0.0-20181012175058-2f1d1f20f75d/go.mod h1:+NfK9FKeTrX5uv1uIXGdwYDTeHna2qgaIlx54MXqjAM= +github.com/huandu/xstrings v1.3.1/go.mod h1:y5/lhBue+AyNmUVz9RLU9xbLR0o4KIIExikq4ovT0aE= github.com/huandu/xstrings v1.3.2 h1:L18LIDzqlW6xN2rEkpdV8+oL/IXWJ1APd+vsdYy4Wdw= github.com/huandu/xstrings v1.3.2/go.mod h1:y5/lhBue+AyNmUVz9RLU9xbLR0o4KIIExikq4ovT0aE= github.com/imdario/mergo v0.3.11/go.mod h1:jmQim1M+e3UYxmgPu/WyfjB3N3VflVyUjjjwH0dnCYA= -github.com/imdario/mergo v0.3.12 h1:b6R2BslTbIEToALKP7LxUvijTsNI9TAe80pLWN2g/HU= github.com/imdario/mergo v0.3.12/go.mod h1:jmQim1M+e3UYxmgPu/WyfjB3N3VflVyUjjjwH0dnCYA= +github.com/imdario/mergo v0.3.13 h1:lFzP57bqS/wsqKssCGmtLAb8A0wKjLGrve2q3PPVcBk= +github.com/imdario/mergo v0.3.13/go.mod h1:4lJ1jqUDcsbIECGy0RUJAXNIhg+6ocWgb1ALK2O4oXg= github.com/jbenet/go-context v0.0.0-20150711004518-d14ea06fba99 h1:BQSFePA1RWJOlocH6Fxy8MmwDt+yVQYULKfN0RoTN8A= github.com/jbenet/go-context v0.0.0-20150711004518-d14ea06fba99/go.mod h1:1lJo3i6rXxKeerYnT8Nvf0QmHCRC1n8sfWVwXF2Frvo= github.com/jessevdk/go-flags v1.5.0/go.mod h1:Fw0T6WPc1dYxT4mKEZRfG5kJhaTDP9pj1c2EWnYs/m4= @@ -160,8 +169,8 @@ github.com/kevinburke/ssh_config v0.0.0-20201106050909-4977a11b4351 h1:DowS9hvgy github.com/kevinburke/ssh_config v0.0.0-20201106050909-4977a11b4351/go.mod h1:CT57kijsi8u/K/BOFA39wgDQJ9CxiF4nAY/ojJ6r6mM= github.com/konsorten/go-windows-terminal-sequences v1.0.1/go.mod h1:T0+1ngSBFLxvqU3pZ+m/2kptfBszLMUkC4ZK/EgS/cQ= github.com/kr/pretty v0.1.0/go.mod h1:dAy3ld7l9f0ibDNOQOHHMYYIIbhfbHSm3C4ZsoJORNo= -github.com/kr/pretty v0.2.1 h1:Fmg33tUaq4/8ym9TJN1x7sLJnHVwhP33CNkpYV/7rwI= github.com/kr/pretty v0.2.1/go.mod h1:ipq/a2n7PKx3OHsz4KJII5eveXtPO4qwEXGdVfWzfnI= +github.com/kr/pretty v0.3.0 h1:WgNl7dwNpEZ6jJ9k1snq4pZsg7DOEN8hP9Xw0Tsjwk0= github.com/kr/pty v1.1.1/go.mod h1:pFQYn66WHrOpPYNljwOMqo10TkYh1fy3cYio2l3bCsQ= github.com/kr/text v0.1.0/go.mod h1:4Jbv+DJW3UT/LiOwJeYQe1efqtUx/iVham/4vfdArNI= github.com/kr/text v0.2.0 h1:5Nx0Ya0ZqY2ygV366QzturHI13Jq95ApcVaJBhpS+AY= @@ -177,8 +186,8 @@ github.com/mattn/go-isatty v0.0.3/go.mod h1:M+lRXTBqGeGNdLjl/ufCoiOlB5xdOkqRJdNx github.com/mattn/go-isatty v0.0.12/go.mod h1:cbi8OIDigv2wuxKPP5vlRcQ1OAZbq2CE4Kysco4FUpU= github.com/mattn/go-isatty v0.0.14 h1:yVuAays6BHfxijgZPzw+3Zlu5yQgKGP2/hcQbHb7S9Y= github.com/mattn/go-isatty v0.0.14/go.mod h1:7GGIvUiUoEMVVmxf/4nioHXj79iQHKdU27kJ6hsGG94= -github.com/mitchellh/cli v1.1.2 h1:PvH+lL2B7IQ101xQL63Of8yFS2y+aDlsFcsqNc+u/Kw= -github.com/mitchellh/cli v1.1.2/go.mod h1:6iaV0fGdElS6dPBx0EApTxHrcWvmJphyh2n8YBLPPZ4= +github.com/mitchellh/cli v1.1.4 h1:qj8czE26AU4PbiaPXK5uVmMSM+V5BYsFBiM9HhGRLUA= +github.com/mitchellh/cli v1.1.4/go.mod h1:vTLESy5mRhKOs9KDp0/RATawxP1UqBmdrpVRMnpcvKQ= github.com/mitchellh/copystructure v1.0.0/go.mod h1:SNtv71yrdKgLRyLFxmLdkAbkKEFWgYaq1OVrnRcwhnw= github.com/mitchellh/copystructure v1.2.0 h1:vpKXTN4ewci03Vljg/q9QvCGUDttBOGBIa15WveJJGw= github.com/mitchellh/copystructure v1.2.0/go.mod h1:qLl+cE2AmVv+CoeAwDPye/v+N2HKCj9FbZEVFJRxO9s= @@ -201,16 +210,24 @@ github.com/pkg/errors v0.8.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINE github.com/pkg/errors v0.9.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0= github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM= github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4= -github.com/posener/complete v1.1.1 h1:ccV59UEOTzVDnDUEFdT95ZzHVZ+5+158q8+SJb2QV5w= github.com/posener/complete v1.1.1/go.mod h1:em0nMJCgc9GFtwrmVmEMR/ZL6WyhyjMBndrE9hABlRI= +github.com/posener/complete v1.2.3 h1:NP0eAhjcjImqslEwo/1hq7gpajME0fTLTezBKDqfXqo= +github.com/posener/complete v1.2.3/go.mod h1:WZIdtGGp+qx0sLrYKtIRAruyNpv6hFCicSgv7Sy7s/s= github.com/prometheus/client_model v0.0.0-20190812154241-14fe0d1b01d4/go.mod h1:xMI15A0UPsDsEKsMN9yxemIoYk6Tm2C1GtYGdfGttqA= github.com/rogpeppe/fastuuid v1.2.0/go.mod h1:jVj6XXZzXRy/MSR5jhDC/2q6DgLz+nrA6LYCDYWNEvQ= +github.com/rogpeppe/go-internal v1.6.1 h1:/FiVV8dS/e+YqF2JvO3yXRFbBLTIuSDkuC7aBOAvL+k= github.com/russross/blackfriday v1.6.0 h1:KqfZb0pUVN2lYqZUYRddxF4OR8ZMURnJIG5Y3VRLtww= github.com/russross/blackfriday v1.6.0/go.mod h1:ti0ldHuxg49ri4ksnFxlkCfN+hvslNlmVHqNRXXJNAY= github.com/sebdah/goldie v1.0.0/go.mod h1:jXP4hmWywNEwZzhMuv2ccnqTSFpuq8iyQhtQdkkZBH4= github.com/sergi/go-diff v1.1.0/go.mod h1:STckp+ISIX8hZLjrqAeVduY0gWCT9IjLuqbuNXdaHfM= github.com/sergi/go-diff v1.2.0 h1:XU+rvMAioB0UC3q1MFrIQy4Vo5/4VsRDQQXHsEya6xQ= +github.com/shopspring/decimal v1.2.0/go.mod h1:DKyhrW/HYNuLGql+MJL6WCR6knT2jwCFRcu2hWCYk4o= +github.com/shopspring/decimal v1.3.1 h1:2Usl1nmF/WZucqkFZhnfFYxxxu8LG21F6nPQBE5gKV8= +github.com/shopspring/decimal v1.3.1/go.mod h1:DKyhrW/HYNuLGql+MJL6WCR6knT2jwCFRcu2hWCYk4o= github.com/sirupsen/logrus v1.4.1/go.mod h1:ni0Sbl8bgC9z8RoU9G6nDWqqs/fq4eDPysMBDgk/93Q= +github.com/spf13/cast v1.3.1/go.mod h1:Qx5cxh0v+4UWYiBimWS+eyWzqEqokIECu5etghLkUJE= +github.com/spf13/cast v1.5.0 h1:rj3WzYc11XZaIZMPKmwP96zkFEnnAmV8s6XbB2aY32w= +github.com/spf13/cast v1.5.0/go.mod h1:SpXXQ5YoyJw6s3/6cMTQuxvgRl3PCJiyaX9p6b155UU= github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME= github.com/stretchr/objx v0.1.1/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME= github.com/stretchr/testify v1.2.2/go.mod h1:a8OnRcib4nhh0OaRAV+Yts87kKdq0PP7pXfy6kDkUVs= @@ -240,13 +257,14 @@ go.opentelemetry.io/proto/otlp v0.7.0/go.mod h1:PqfVotwruBrMGOCsRd/89rSnXhoiJIqe golang.org/x/crypto v0.0.0-20190219172222-a4c6cb3142f2/go.mod h1:6SG95UA2DQfeDnfUPMdvaQW0Q7yPrPDi9nlGo2tz2b4= golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w= golang.org/x/crypto v0.0.0-20191011191535-87dc89f01550/go.mod h1:yigFU9vqHzYiE8UmvKecakEJjdnWj3jj499lnFckfCI= +golang.org/x/crypto v0.0.0-20200414173820-0848c9571904/go.mod h1:LzIPMQfyMNhhGPhUkYOs5KpL4U8rLKemX1yGLhDgUto= golang.org/x/crypto v0.0.0-20200622213623-75b288015ac9/go.mod h1:LzIPMQfyMNhhGPhUkYOs5KpL4U8rLKemX1yGLhDgUto= golang.org/x/crypto v0.0.0-20200820211705-5c72a883971a/go.mod h1:LzIPMQfyMNhhGPhUkYOs5KpL4U8rLKemX1yGLhDgUto= golang.org/x/crypto v0.0.0-20210322153248-0c34fe9e7dc2/go.mod h1:T9bdIzuCu7OtxOm1hfPfRQxPLYneinmdGuTeoZ9dtd4= golang.org/x/crypto v0.0.0-20210421170649-83a5a9bb288b/go.mod h1:T9bdIzuCu7OtxOm1hfPfRQxPLYneinmdGuTeoZ9dtd4= golang.org/x/crypto v0.0.0-20210616213533-5ff15b29337e/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc= -golang.org/x/crypto v0.0.0-20220517005047-85d78b3ac167 h1:O8uGbHCqlTp2P6QJSLmCojM4mN6UemYv8K+dCnmHmu0= -golang.org/x/crypto v0.0.0-20220517005047-85d78b3ac167/go.mod h1:IxCIyHEi3zRg3s0A5j5BB6A9Jmi73HwBIUl50j+osU4= +golang.org/x/crypto v0.0.0-20220622213112-05595931fe9d h1:sK3txAijHtOK88l68nt020reeT1ZdKLIYetKl95FzVY= +golang.org/x/crypto v0.0.0-20220622213112-05595931fe9d/go.mod h1:IxCIyHEi3zRg3s0A5j5BB6A9Jmi73HwBIUl50j+osU4= golang.org/x/exp v0.0.0-20190121172915-509febef88a4/go.mod h1:CJ0aWSM057203Lf6IL+f9T1iT9GByDxfZKAQTCR3kQA= golang.org/x/lint v0.0.0-20181026193005-c67002cb31c3/go.mod h1:UVdnD1Gm6xHRNCYTkRU2/jEulfH38KcIWyp/GAMgvoE= golang.org/x/lint v0.0.0-20190227174305-5b3e6a55c961/go.mod h1:wehouNa3lNwaWXcvxsM5YxQ5yQlVC4a0KAMCusXpPoU= @@ -298,8 +316,9 @@ golang.org/x/sys v0.0.0-20210502180810-71e4cd670f79/go.mod h1:h1NjWce9XRLGQEsW7w golang.org/x/sys v0.0.0-20210615035016-665e8c7367d1/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20210630005230-0f9fa26af87c/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20210927094055-39ccf1dd6fa6/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= -golang.org/x/sys v0.0.0-20220503163025-988cb79eb6c6 h1:nonptSpoQ4vQjyraW20DXPAglgQfVnM9ZC6MmNLMR60= golang.org/x/sys v0.0.0-20220503163025-988cb79eb6c6/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.0.0-20220627191245-f75cf1eec38b h1:2n253B2r0pYSmEV+UNCQoPfU/FiaizQEK5Gu4Bq4JE8= +golang.org/x/sys v0.0.0-20220627191245-f75cf1eec38b/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo= golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= golang.org/x/text v0.3.2/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk= @@ -363,9 +382,9 @@ gopkg.in/warnings.v0 v0.1.2/go.mod h1:jksf8JmL6Qr/oQM2OXTHunEvvTAsrWBLb6OOjuVWRN gopkg.in/yaml.v2 v2.2.2/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= gopkg.in/yaml.v2 v2.2.3/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= gopkg.in/yaml.v2 v2.2.4/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= -gopkg.in/yaml.v2 v2.3.0 h1:clyUAQHOM3G0M3f5vQj7LuJrETvjVot3Z5el9nffUtU= gopkg.in/yaml.v2 v2.3.0/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= gopkg.in/yaml.v3 v3.0.0-20200313102051-9f266ea9e77c/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM= +gopkg.in/yaml.v3 v3.0.0/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM= gopkg.in/yaml.v3 v3.0.1 h1:fxVm/GzAzEWqLHuvctI91KS9hhNmmWOoWu0XTYJS7CA= gopkg.in/yaml.v3 v3.0.1/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM= honnef.co/go/tools v0.0.0-20190102054323-c2f93a96b099/go.mod h1:rf3lG4BRIbNafJWhAfAdb/ePZxsR/4RtNHQocxwk9r4= diff --git a/vendor/github.com/Masterminds/goutils/cryptorandomstringutils.go b/vendor/github.com/Masterminds/goutils/cryptorandomstringutils.go index 177dd86..8dbd924 100644 --- a/vendor/github.com/Masterminds/goutils/cryptorandomstringutils.go +++ b/vendor/github.com/Masterminds/goutils/cryptorandomstringutils.go @@ -21,7 +21,6 @@ import ( "fmt" "math" "math/big" - "regexp" "unicode" ) @@ -99,27 +98,7 @@ Returns: error - an error stemming from an invalid parameter within underlying function, CryptoRandom(...) */ func CryptoRandomAlphaNumeric(count int) (string, error) { - if count == 0 { - return "", nil - } - RandomString, err := CryptoRandom(count, 0, 0, true, true) - if err != nil { - return "", fmt.Errorf("Error: %s", err) - } - match, err := regexp.MatchString("([0-9]+)", RandomString) - if err != nil { - panic(err) - } - - if !match { - //Get the position between 0 and the length of the string-1 to insert a random number - position := getCryptoRandomInt(count) - //Insert a random number between [0-9] in the position - RandomString = RandomString[:position] + string('0' + getCryptoRandomInt(10)) + RandomString[position + 1:] - return RandomString, err - } - return RandomString, err - + return CryptoRandom(count, 0, 0, true, true) } /* @@ -204,7 +183,7 @@ func CryptoRandom(count int, start int, end int, letters bool, numbers bool, cha if chars == nil { ch = rune(getCryptoRandomInt(gap) + int64(start)) } else { - ch = chars[getCryptoRandomInt(gap) + int64(start)] + ch = chars[getCryptoRandomInt(gap)+int64(start)] } if letters && unicode.IsLetter(ch) || numbers && unicode.IsDigit(ch) || !letters && !numbers { diff --git a/vendor/github.com/Masterminds/goutils/randomstringutils.go b/vendor/github.com/Masterminds/goutils/randomstringutils.go index 1364e0c..2726702 100644 --- a/vendor/github.com/Masterminds/goutils/randomstringutils.go +++ b/vendor/github.com/Masterminds/goutils/randomstringutils.go @@ -20,7 +20,6 @@ import ( "fmt" "math" "math/rand" - "regexp" "time" "unicode" ) @@ -75,12 +74,10 @@ func RandomNumeric(count int) (string, error) { /* RandomAlphabetic creates a random string whose length is the number of characters specified. -Characters will be chosen from the set of alpha-numeric characters as indicated by the arguments. +Characters will be chosen from the set of alphabetic characters. Parameters: count - the length of random string to create - letters - if true, generated string may include alphabetic characters - numbers - if true, generated string may include numeric characters Returns: string - the random string @@ -102,24 +99,7 @@ Returns: error - an error stemming from an invalid parameter within underlying function, RandomSeed(...) */ func RandomAlphaNumeric(count int) (string, error) { - RandomString, err := Random(count, 0, 0, true, true) - if err != nil { - return "", fmt.Errorf("Error: %s", err) - } - match, err := regexp.MatchString("([0-9]+)", RandomString) - if err != nil { - panic(err) - } - - if !match { - //Get the position between 0 and the length of the string-1 to insert a random number - position := rand.Intn(count) - //Insert a random number between [0-9] in the position - RandomString = RandomString[:position] + string('0'+rand.Intn(10)) + RandomString[position+1:] - return RandomString, err - } - return RandomString, err - + return Random(count, 0, 0, true, true) } /* diff --git a/vendor/github.com/Masterminds/goutils/stringutils.go b/vendor/github.com/Masterminds/goutils/stringutils.go index 5037c45..741bb53 100644 --- a/vendor/github.com/Masterminds/goutils/stringutils.go +++ b/vendor/github.com/Masterminds/goutils/stringutils.go @@ -222,3 +222,19 @@ func IndexOf(str string, sub string, start int) int { func IsEmpty(str string) bool { return len(str) == 0 } + +// Returns either the passed in string, or if the string is empty, the value of defaultStr. +func DefaultString(str string, defaultStr string) string { + if IsEmpty(str) { + return defaultStr + } + return str +} + +// Returns either the passed in string, or if the string is whitespace, empty (""), the value of defaultStr. +func DefaultIfBlank(str string, defaultStr string) string { + if IsBlank(str) { + return defaultStr + } + return str +} diff --git a/vendor/github.com/Masterminds/semver/.travis.yml b/vendor/github.com/Masterminds/semver/.travis.yml deleted file mode 100644 index 096369d..0000000 --- a/vendor/github.com/Masterminds/semver/.travis.yml +++ /dev/null @@ -1,29 +0,0 @@ -language: go - -go: - - 1.6.x - - 1.7.x - - 1.8.x - - 1.9.x - - 1.10.x - - 1.11.x - - 1.12.x - - tip - -# Setting sudo access to false will let Travis CI use containers rather than -# VMs to run the tests. For more details see: -# - http://docs.travis-ci.com/user/workers/container-based-infrastructure/ -# - http://docs.travis-ci.com/user/workers/standard-infrastructure/ -sudo: false - -script: - - make setup - - make test - -notifications: - webhooks: - urls: - - https://webhooks.gitter.im/e/06e3328629952dabe3e0 - on_success: change # options: [always|never|change] default: always - on_failure: always # options: [always|never|change] default: always - on_start: never # options: [always|never|change] default: always diff --git a/vendor/github.com/Masterminds/semver/CHANGELOG.md b/vendor/github.com/Masterminds/semver/CHANGELOG.md deleted file mode 100644 index e405c9a..0000000 --- a/vendor/github.com/Masterminds/semver/CHANGELOG.md +++ /dev/null @@ -1,109 +0,0 @@ -# 1.5.0 (2019-09-11) - -## Added - -- #103: Add basic fuzzing for `NewVersion()` (thanks @jesse-c) - -## Changed - -- #82: Clarify wildcard meaning in range constraints and update tests for it (thanks @greysteil) -- #83: Clarify caret operator range for pre-1.0.0 dependencies (thanks @greysteil) -- #72: Adding docs comment pointing to vert for a cli -- #71: Update the docs on pre-release comparator handling -- #89: Test with new go versions (thanks @thedevsaddam) -- #87: Added $ to ValidPrerelease for better validation (thanks @jeremycarroll) - -## Fixed - -- #78: Fix unchecked error in example code (thanks @ravron) -- #70: Fix the handling of pre-releases and the 0.0.0 release edge case -- #97: Fixed copyright file for proper display on GitHub -- #107: Fix handling prerelease when sorting alphanum and num -- #109: Fixed where Validate sometimes returns wrong message on error - -# 1.4.2 (2018-04-10) - -## Changed -- #72: Updated the docs to point to vert for a console appliaction -- #71: Update the docs on pre-release comparator handling - -## Fixed -- #70: Fix the handling of pre-releases and the 0.0.0 release edge case - -# 1.4.1 (2018-04-02) - -## Fixed -- Fixed #64: Fix pre-release precedence issue (thanks @uudashr) - -# 1.4.0 (2017-10-04) - -## Changed -- #61: Update NewVersion to parse ints with a 64bit int size (thanks @zknill) - -# 1.3.1 (2017-07-10) - -## Fixed -- Fixed #57: number comparisons in prerelease sometimes inaccurate - -# 1.3.0 (2017-05-02) - -## Added -- #45: Added json (un)marshaling support (thanks @mh-cbon) -- Stability marker. See https://masterminds.github.io/stability/ - -## Fixed -- #51: Fix handling of single digit tilde constraint (thanks @dgodd) - -## Changed -- #55: The godoc icon moved from png to svg - -# 1.2.3 (2017-04-03) - -## Fixed -- #46: Fixed 0.x.x and 0.0.x in constraints being treated as * - -# Release 1.2.2 (2016-12-13) - -## Fixed -- #34: Fixed issue where hyphen range was not working with pre-release parsing. - -# Release 1.2.1 (2016-11-28) - -## Fixed -- #24: Fixed edge case issue where constraint "> 0" does not handle "0.0.1-alpha" - properly. - -# Release 1.2.0 (2016-11-04) - -## Added -- #20: Added MustParse function for versions (thanks @adamreese) -- #15: Added increment methods on versions (thanks @mh-cbon) - -## Fixed -- Issue #21: Per the SemVer spec (section 9) a pre-release is unstable and - might not satisfy the intended compatibility. The change here ignores pre-releases - on constraint checks (e.g., ~ or ^) when a pre-release is not part of the - constraint. For example, `^1.2.3` will ignore pre-releases while - `^1.2.3-alpha` will include them. - -# Release 1.1.1 (2016-06-30) - -## Changed -- Issue #9: Speed up version comparison performance (thanks @sdboyer) -- Issue #8: Added benchmarks (thanks @sdboyer) -- Updated Go Report Card URL to new location -- Updated Readme to add code snippet formatting (thanks @mh-cbon) -- Updating tagging to v[SemVer] structure for compatibility with other tools. - -# Release 1.1.0 (2016-03-11) - -- Issue #2: Implemented validation to provide reasons a versions failed a - constraint. - -# Release 1.0.1 (2015-12-31) - -- Fixed #1: * constraint failing on valid versions. - -# Release 1.0.0 (2015-10-20) - -- Initial release diff --git a/vendor/github.com/Masterminds/semver/Makefile b/vendor/github.com/Masterminds/semver/Makefile deleted file mode 100644 index a7a1b4e..0000000 --- a/vendor/github.com/Masterminds/semver/Makefile +++ /dev/null @@ -1,36 +0,0 @@ -.PHONY: setup -setup: - go get -u gopkg.in/alecthomas/gometalinter.v1 - gometalinter.v1 --install - -.PHONY: test -test: validate lint - @echo "==> Running tests" - go test -v - -.PHONY: validate -validate: - @echo "==> Running static validations" - @gometalinter.v1 \ - --disable-all \ - --enable deadcode \ - --severity deadcode:error \ - --enable gofmt \ - --enable gosimple \ - --enable ineffassign \ - --enable misspell \ - --enable vet \ - --tests \ - --vendor \ - --deadline 60s \ - ./... || exit_code=1 - -.PHONY: lint -lint: - @echo "==> Running linters" - @gometalinter.v1 \ - --disable-all \ - --enable golint \ - --vendor \ - --deadline 60s \ - ./... || : diff --git a/vendor/github.com/Masterminds/semver/README.md b/vendor/github.com/Masterminds/semver/README.md deleted file mode 100644 index 1b52d2f..0000000 --- a/vendor/github.com/Masterminds/semver/README.md +++ /dev/null @@ -1,194 +0,0 @@ -# SemVer - -The `semver` package provides the ability to work with [Semantic Versions](http://semver.org) in Go. Specifically it provides the ability to: - -* Parse semantic versions -* Sort semantic versions -* Check if a semantic version fits within a set of constraints -* Optionally work with a `v` prefix - -[![Stability: -Active](https://masterminds.github.io/stability/active.svg)](https://masterminds.github.io/stability/active.html) -[![Build Status](https://travis-ci.org/Masterminds/semver.svg)](https://travis-ci.org/Masterminds/semver) [![Build status](https://ci.appveyor.com/api/projects/status/jfk66lib7hb985k8/branch/master?svg=true&passingText=windows%20build%20passing&failingText=windows%20build%20failing)](https://ci.appveyor.com/project/mattfarina/semver/branch/master) [![GoDoc](https://godoc.org/github.com/Masterminds/semver?status.svg)](https://godoc.org/github.com/Masterminds/semver) [![Go Report Card](https://goreportcard.com/badge/github.com/Masterminds/semver)](https://goreportcard.com/report/github.com/Masterminds/semver) - -If you are looking for a command line tool for version comparisons please see -[vert](https://github.com/Masterminds/vert) which uses this library. - -## Parsing Semantic Versions - -To parse a semantic version use the `NewVersion` function. For example, - -```go - v, err := semver.NewVersion("1.2.3-beta.1+build345") -``` - -If there is an error the version wasn't parseable. The version object has methods -to get the parts of the version, compare it to other versions, convert the -version back into a string, and get the original string. For more details -please see the [documentation](https://godoc.org/github.com/Masterminds/semver). - -## Sorting Semantic Versions - -A set of versions can be sorted using the [`sort`](https://golang.org/pkg/sort/) -package from the standard library. For example, - -```go - raw := []string{"1.2.3", "1.0", "1.3", "2", "0.4.2",} - vs := make([]*semver.Version, len(raw)) - for i, r := range raw { - v, err := semver.NewVersion(r) - if err != nil { - t.Errorf("Error parsing version: %s", err) - } - - vs[i] = v - } - - sort.Sort(semver.Collection(vs)) -``` - -## Checking Version Constraints - -Checking a version against version constraints is one of the most featureful -parts of the package. - -```go - c, err := semver.NewConstraint(">= 1.2.3") - if err != nil { - // Handle constraint not being parseable. - } - - v, _ := semver.NewVersion("1.3") - if err != nil { - // Handle version not being parseable. - } - // Check if the version meets the constraints. The a variable will be true. - a := c.Check(v) -``` - -## Basic Comparisons - -There are two elements to the comparisons. First, a comparison string is a list -of comma separated and comparisons. These are then separated by || separated or -comparisons. For example, `">= 1.2, < 3.0.0 || >= 4.2.3"` is looking for a -comparison that's greater than or equal to 1.2 and less than 3.0.0 or is -greater than or equal to 4.2.3. - -The basic comparisons are: - -* `=`: equal (aliased to no operator) -* `!=`: not equal -* `>`: greater than -* `<`: less than -* `>=`: greater than or equal to -* `<=`: less than or equal to - -## Working With Pre-release Versions - -Pre-releases, for those not familiar with them, are used for software releases -prior to stable or generally available releases. Examples of pre-releases include -development, alpha, beta, and release candidate releases. A pre-release may be -a version such as `1.2.3-beta.1` while the stable release would be `1.2.3`. In the -order of precidence, pre-releases come before their associated releases. In this -example `1.2.3-beta.1 < 1.2.3`. - -According to the Semantic Version specification pre-releases may not be -API compliant with their release counterpart. It says, - -> A pre-release version indicates that the version is unstable and might not satisfy the intended compatibility requirements as denoted by its associated normal version. - -SemVer comparisons without a pre-release comparator will skip pre-release versions. -For example, `>=1.2.3` will skip pre-releases when looking at a list of releases -while `>=1.2.3-0` will evaluate and find pre-releases. - -The reason for the `0` as a pre-release version in the example comparison is -because pre-releases can only contain ASCII alphanumerics and hyphens (along with -`.` separators), per the spec. Sorting happens in ASCII sort order, again per the spec. The lowest character is a `0` in ASCII sort order (see an [ASCII Table](http://www.asciitable.com/)) - -Understanding ASCII sort ordering is important because A-Z comes before a-z. That -means `>=1.2.3-BETA` will return `1.2.3-alpha`. What you might expect from case -sensitivity doesn't apply here. This is due to ASCII sort ordering which is what -the spec specifies. - -## Hyphen Range Comparisons - -There are multiple methods to handle ranges and the first is hyphens ranges. -These look like: - -* `1.2 - 1.4.5` which is equivalent to `>= 1.2, <= 1.4.5` -* `2.3.4 - 4.5` which is equivalent to `>= 2.3.4, <= 4.5` - -## Wildcards In Comparisons - -The `x`, `X`, and `*` characters can be used as a wildcard character. This works -for all comparison operators. When used on the `=` operator it falls -back to the pack level comparison (see tilde below). For example, - -* `1.2.x` is equivalent to `>= 1.2.0, < 1.3.0` -* `>= 1.2.x` is equivalent to `>= 1.2.0` -* `<= 2.x` is equivalent to `< 3` -* `*` is equivalent to `>= 0.0.0` - -## Tilde Range Comparisons (Patch) - -The tilde (`~`) comparison operator is for patch level ranges when a minor -version is specified and major level changes when the minor number is missing. -For example, - -* `~1.2.3` is equivalent to `>= 1.2.3, < 1.3.0` -* `~1` is equivalent to `>= 1, < 2` -* `~2.3` is equivalent to `>= 2.3, < 2.4` -* `~1.2.x` is equivalent to `>= 1.2.0, < 1.3.0` -* `~1.x` is equivalent to `>= 1, < 2` - -## Caret Range Comparisons (Major) - -The caret (`^`) comparison operator is for major level changes. This is useful -when comparisons of API versions as a major change is API breaking. For example, - -* `^1.2.3` is equivalent to `>= 1.2.3, < 2.0.0` -* `^0.0.1` is equivalent to `>= 0.0.1, < 1.0.0` -* `^1.2.x` is equivalent to `>= 1.2.0, < 2.0.0` -* `^2.3` is equivalent to `>= 2.3, < 3` -* `^2.x` is equivalent to `>= 2.0.0, < 3` - -# Validation - -In addition to testing a version against a constraint, a version can be validated -against a constraint. When validation fails a slice of errors containing why a -version didn't meet the constraint is returned. For example, - -```go - c, err := semver.NewConstraint("<= 1.2.3, >= 1.4") - if err != nil { - // Handle constraint not being parseable. - } - - v, _ := semver.NewVersion("1.3") - if err != nil { - // Handle version not being parseable. - } - - // Validate a version against a constraint. - a, msgs := c.Validate(v) - // a is false - for _, m := range msgs { - fmt.Println(m) - - // Loops over the errors which would read - // "1.3 is greater than 1.2.3" - // "1.3 is less than 1.4" - } -``` - -# Fuzzing - - [dvyukov/go-fuzz](https://github.com/dvyukov/go-fuzz) is used for fuzzing. - -1. `go-fuzz-build` -2. `go-fuzz -workdir=fuzz` - -# Contribute - -If you find an issue or want to contribute please file an [issue](https://github.com/Masterminds/semver/issues) -or [create a pull request](https://github.com/Masterminds/semver/pulls). diff --git a/vendor/github.com/Masterminds/semver/appveyor.yml b/vendor/github.com/Masterminds/semver/appveyor.yml deleted file mode 100644 index b2778df..0000000 --- a/vendor/github.com/Masterminds/semver/appveyor.yml +++ /dev/null @@ -1,44 +0,0 @@ -version: build-{build}.{branch} - -clone_folder: C:\gopath\src\github.com\Masterminds\semver -shallow_clone: true - -environment: - GOPATH: C:\gopath - -platform: - - x64 - -install: - - go version - - go env - - go get -u gopkg.in/alecthomas/gometalinter.v1 - - set PATH=%PATH%;%GOPATH%\bin - - gometalinter.v1.exe --install - -build_script: - - go install -v ./... - -test_script: - - "gometalinter.v1 \ - --disable-all \ - --enable deadcode \ - --severity deadcode:error \ - --enable gofmt \ - --enable gosimple \ - --enable ineffassign \ - --enable misspell \ - --enable vet \ - --tests \ - --vendor \ - --deadline 60s \ - ./... || exit_code=1" - - "gometalinter.v1 \ - --disable-all \ - --enable golint \ - --vendor \ - --deadline 60s \ - ./... || :" - - go test -v - -deploy: off diff --git a/vendor/github.com/Masterminds/semver/constraints.go b/vendor/github.com/Masterminds/semver/constraints.go deleted file mode 100644 index b94b934..0000000 --- a/vendor/github.com/Masterminds/semver/constraints.go +++ /dev/null @@ -1,423 +0,0 @@ -package semver - -import ( - "errors" - "fmt" - "regexp" - "strings" -) - -// Constraints is one or more constraint that a semantic version can be -// checked against. -type Constraints struct { - constraints [][]*constraint -} - -// NewConstraint returns a Constraints instance that a Version instance can -// be checked against. If there is a parse error it will be returned. -func NewConstraint(c string) (*Constraints, error) { - - // Rewrite - ranges into a comparison operation. - c = rewriteRange(c) - - ors := strings.Split(c, "||") - or := make([][]*constraint, len(ors)) - for k, v := range ors { - cs := strings.Split(v, ",") - result := make([]*constraint, len(cs)) - for i, s := range cs { - pc, err := parseConstraint(s) - if err != nil { - return nil, err - } - - result[i] = pc - } - or[k] = result - } - - o := &Constraints{constraints: or} - return o, nil -} - -// Check tests if a version satisfies the constraints. -func (cs Constraints) Check(v *Version) bool { - // loop over the ORs and check the inner ANDs - for _, o := range cs.constraints { - joy := true - for _, c := range o { - if !c.check(v) { - joy = false - break - } - } - - if joy { - return true - } - } - - return false -} - -// Validate checks if a version satisfies a constraint. If not a slice of -// reasons for the failure are returned in addition to a bool. -func (cs Constraints) Validate(v *Version) (bool, []error) { - // loop over the ORs and check the inner ANDs - var e []error - - // Capture the prerelease message only once. When it happens the first time - // this var is marked - var prerelesase bool - for _, o := range cs.constraints { - joy := true - for _, c := range o { - // Before running the check handle the case there the version is - // a prerelease and the check is not searching for prereleases. - if c.con.pre == "" && v.pre != "" { - if !prerelesase { - em := fmt.Errorf("%s is a prerelease version and the constraint is only looking for release versions", v) - e = append(e, em) - prerelesase = true - } - joy = false - - } else { - - if !c.check(v) { - em := fmt.Errorf(c.msg, v, c.orig) - e = append(e, em) - joy = false - } - } - } - - if joy { - return true, []error{} - } - } - - return false, e -} - -var constraintOps map[string]cfunc -var constraintMsg map[string]string -var constraintRegex *regexp.Regexp - -func init() { - constraintOps = map[string]cfunc{ - "": constraintTildeOrEqual, - "=": constraintTildeOrEqual, - "!=": constraintNotEqual, - ">": constraintGreaterThan, - "<": constraintLessThan, - ">=": constraintGreaterThanEqual, - "=>": constraintGreaterThanEqual, - "<=": constraintLessThanEqual, - "=<": constraintLessThanEqual, - "~": constraintTilde, - "~>": constraintTilde, - "^": constraintCaret, - } - - constraintMsg = map[string]string{ - "": "%s is not equal to %s", - "=": "%s is not equal to %s", - "!=": "%s is equal to %s", - ">": "%s is less than or equal to %s", - "<": "%s is greater than or equal to %s", - ">=": "%s is less than %s", - "=>": "%s is less than %s", - "<=": "%s is greater than %s", - "=<": "%s is greater than %s", - "~": "%s does not have same major and minor version as %s", - "~>": "%s does not have same major and minor version as %s", - "^": "%s does not have same major version as %s", - } - - ops := make([]string, 0, len(constraintOps)) - for k := range constraintOps { - ops = append(ops, regexp.QuoteMeta(k)) - } - - constraintRegex = regexp.MustCompile(fmt.Sprintf( - `^\s*(%s)\s*(%s)\s*$`, - strings.Join(ops, "|"), - cvRegex)) - - constraintRangeRegex = regexp.MustCompile(fmt.Sprintf( - `\s*(%s)\s+-\s+(%s)\s*`, - cvRegex, cvRegex)) -} - -// An individual constraint -type constraint struct { - // The callback function for the restraint. It performs the logic for - // the constraint. - function cfunc - - msg string - - // The version used in the constraint check. For example, if a constraint - // is '<= 2.0.0' the con a version instance representing 2.0.0. - con *Version - - // The original parsed version (e.g., 4.x from != 4.x) - orig string - - // When an x is used as part of the version (e.g., 1.x) - minorDirty bool - dirty bool - patchDirty bool -} - -// Check if a version meets the constraint -func (c *constraint) check(v *Version) bool { - return c.function(v, c) -} - -type cfunc func(v *Version, c *constraint) bool - -func parseConstraint(c string) (*constraint, error) { - m := constraintRegex.FindStringSubmatch(c) - if m == nil { - return nil, fmt.Errorf("improper constraint: %s", c) - } - - ver := m[2] - orig := ver - minorDirty := false - patchDirty := false - dirty := false - if isX(m[3]) { - ver = "0.0.0" - dirty = true - } else if isX(strings.TrimPrefix(m[4], ".")) || m[4] == "" { - minorDirty = true - dirty = true - ver = fmt.Sprintf("%s.0.0%s", m[3], m[6]) - } else if isX(strings.TrimPrefix(m[5], ".")) { - dirty = true - patchDirty = true - ver = fmt.Sprintf("%s%s.0%s", m[3], m[4], m[6]) - } - - con, err := NewVersion(ver) - if err != nil { - - // The constraintRegex should catch any regex parsing errors. So, - // we should never get here. - return nil, errors.New("constraint Parser Error") - } - - cs := &constraint{ - function: constraintOps[m[1]], - msg: constraintMsg[m[1]], - con: con, - orig: orig, - minorDirty: minorDirty, - patchDirty: patchDirty, - dirty: dirty, - } - return cs, nil -} - -// Constraint functions -func constraintNotEqual(v *Version, c *constraint) bool { - if c.dirty { - - // If there is a pre-release on the version but the constraint isn't looking - // for them assume that pre-releases are not compatible. See issue 21 for - // more details. - if v.Prerelease() != "" && c.con.Prerelease() == "" { - return false - } - - if c.con.Major() != v.Major() { - return true - } - if c.con.Minor() != v.Minor() && !c.minorDirty { - return true - } else if c.minorDirty { - return false - } - - return false - } - - return !v.Equal(c.con) -} - -func constraintGreaterThan(v *Version, c *constraint) bool { - - // If there is a pre-release on the version but the constraint isn't looking - // for them assume that pre-releases are not compatible. See issue 21 for - // more details. - if v.Prerelease() != "" && c.con.Prerelease() == "" { - return false - } - - return v.Compare(c.con) == 1 -} - -func constraintLessThan(v *Version, c *constraint) bool { - // If there is a pre-release on the version but the constraint isn't looking - // for them assume that pre-releases are not compatible. See issue 21 for - // more details. - if v.Prerelease() != "" && c.con.Prerelease() == "" { - return false - } - - if !c.dirty { - return v.Compare(c.con) < 0 - } - - if v.Major() > c.con.Major() { - return false - } else if v.Minor() > c.con.Minor() && !c.minorDirty { - return false - } - - return true -} - -func constraintGreaterThanEqual(v *Version, c *constraint) bool { - - // If there is a pre-release on the version but the constraint isn't looking - // for them assume that pre-releases are not compatible. See issue 21 for - // more details. - if v.Prerelease() != "" && c.con.Prerelease() == "" { - return false - } - - return v.Compare(c.con) >= 0 -} - -func constraintLessThanEqual(v *Version, c *constraint) bool { - // If there is a pre-release on the version but the constraint isn't looking - // for them assume that pre-releases are not compatible. See issue 21 for - // more details. - if v.Prerelease() != "" && c.con.Prerelease() == "" { - return false - } - - if !c.dirty { - return v.Compare(c.con) <= 0 - } - - if v.Major() > c.con.Major() { - return false - } else if v.Minor() > c.con.Minor() && !c.minorDirty { - return false - } - - return true -} - -// ~*, ~>* --> >= 0.0.0 (any) -// ~2, ~2.x, ~2.x.x, ~>2, ~>2.x ~>2.x.x --> >=2.0.0, <3.0.0 -// ~2.0, ~2.0.x, ~>2.0, ~>2.0.x --> >=2.0.0, <2.1.0 -// ~1.2, ~1.2.x, ~>1.2, ~>1.2.x --> >=1.2.0, <1.3.0 -// ~1.2.3, ~>1.2.3 --> >=1.2.3, <1.3.0 -// ~1.2.0, ~>1.2.0 --> >=1.2.0, <1.3.0 -func constraintTilde(v *Version, c *constraint) bool { - // If there is a pre-release on the version but the constraint isn't looking - // for them assume that pre-releases are not compatible. See issue 21 for - // more details. - if v.Prerelease() != "" && c.con.Prerelease() == "" { - return false - } - - if v.LessThan(c.con) { - return false - } - - // ~0.0.0 is a special case where all constraints are accepted. It's - // equivalent to >= 0.0.0. - if c.con.Major() == 0 && c.con.Minor() == 0 && c.con.Patch() == 0 && - !c.minorDirty && !c.patchDirty { - return true - } - - if v.Major() != c.con.Major() { - return false - } - - if v.Minor() != c.con.Minor() && !c.minorDirty { - return false - } - - return true -} - -// When there is a .x (dirty) status it automatically opts in to ~. Otherwise -// it's a straight = -func constraintTildeOrEqual(v *Version, c *constraint) bool { - // If there is a pre-release on the version but the constraint isn't looking - // for them assume that pre-releases are not compatible. See issue 21 for - // more details. - if v.Prerelease() != "" && c.con.Prerelease() == "" { - return false - } - - if c.dirty { - c.msg = constraintMsg["~"] - return constraintTilde(v, c) - } - - return v.Equal(c.con) -} - -// ^* --> (any) -// ^2, ^2.x, ^2.x.x --> >=2.0.0, <3.0.0 -// ^2.0, ^2.0.x --> >=2.0.0, <3.0.0 -// ^1.2, ^1.2.x --> >=1.2.0, <2.0.0 -// ^1.2.3 --> >=1.2.3, <2.0.0 -// ^1.2.0 --> >=1.2.0, <2.0.0 -func constraintCaret(v *Version, c *constraint) bool { - // If there is a pre-release on the version but the constraint isn't looking - // for them assume that pre-releases are not compatible. See issue 21 for - // more details. - if v.Prerelease() != "" && c.con.Prerelease() == "" { - return false - } - - if v.LessThan(c.con) { - return false - } - - if v.Major() != c.con.Major() { - return false - } - - return true -} - -var constraintRangeRegex *regexp.Regexp - -const cvRegex string = `v?([0-9|x|X|\*]+)(\.[0-9|x|X|\*]+)?(\.[0-9|x|X|\*]+)?` + - `(-([0-9A-Za-z\-]+(\.[0-9A-Za-z\-]+)*))?` + - `(\+([0-9A-Za-z\-]+(\.[0-9A-Za-z\-]+)*))?` - -func isX(x string) bool { - switch x { - case "x", "*", "X": - return true - default: - return false - } -} - -func rewriteRange(i string) string { - m := constraintRangeRegex.FindAllStringSubmatch(i, -1) - if m == nil { - return i - } - o := i - for _, v := range m { - t := fmt.Sprintf(">= %s, <= %s", v[1], v[11]) - o = strings.Replace(o, v[0], t, 1) - } - - return o -} diff --git a/vendor/github.com/Masterminds/semver/doc.go b/vendor/github.com/Masterminds/semver/doc.go deleted file mode 100644 index 6a6c24c..0000000 --- a/vendor/github.com/Masterminds/semver/doc.go +++ /dev/null @@ -1,115 +0,0 @@ -/* -Package semver provides the ability to work with Semantic Versions (http://semver.org) in Go. - -Specifically it provides the ability to: - - * Parse semantic versions - * Sort semantic versions - * Check if a semantic version fits within a set of constraints - * Optionally work with a `v` prefix - -Parsing Semantic Versions - -To parse a semantic version use the `NewVersion` function. For example, - - v, err := semver.NewVersion("1.2.3-beta.1+build345") - -If there is an error the version wasn't parseable. The version object has methods -to get the parts of the version, compare it to other versions, convert the -version back into a string, and get the original string. For more details -please see the documentation at https://godoc.org/github.com/Masterminds/semver. - -Sorting Semantic Versions - -A set of versions can be sorted using the `sort` package from the standard library. -For example, - - raw := []string{"1.2.3", "1.0", "1.3", "2", "0.4.2",} - vs := make([]*semver.Version, len(raw)) - for i, r := range raw { - v, err := semver.NewVersion(r) - if err != nil { - t.Errorf("Error parsing version: %s", err) - } - - vs[i] = v - } - - sort.Sort(semver.Collection(vs)) - -Checking Version Constraints - -Checking a version against version constraints is one of the most featureful -parts of the package. - - c, err := semver.NewConstraint(">= 1.2.3") - if err != nil { - // Handle constraint not being parseable. - } - - v, err := semver.NewVersion("1.3") - if err != nil { - // Handle version not being parseable. - } - // Check if the version meets the constraints. The a variable will be true. - a := c.Check(v) - -Basic Comparisons - -There are two elements to the comparisons. First, a comparison string is a list -of comma separated and comparisons. These are then separated by || separated or -comparisons. For example, `">= 1.2, < 3.0.0 || >= 4.2.3"` is looking for a -comparison that's greater than or equal to 1.2 and less than 3.0.0 or is -greater than or equal to 4.2.3. - -The basic comparisons are: - - * `=`: equal (aliased to no operator) - * `!=`: not equal - * `>`: greater than - * `<`: less than - * `>=`: greater than or equal to - * `<=`: less than or equal to - -Hyphen Range Comparisons - -There are multiple methods to handle ranges and the first is hyphens ranges. -These look like: - - * `1.2 - 1.4.5` which is equivalent to `>= 1.2, <= 1.4.5` - * `2.3.4 - 4.5` which is equivalent to `>= 2.3.4, <= 4.5` - -Wildcards In Comparisons - -The `x`, `X`, and `*` characters can be used as a wildcard character. This works -for all comparison operators. When used on the `=` operator it falls -back to the pack level comparison (see tilde below). For example, - - * `1.2.x` is equivalent to `>= 1.2.0, < 1.3.0` - * `>= 1.2.x` is equivalent to `>= 1.2.0` - * `<= 2.x` is equivalent to `<= 3` - * `*` is equivalent to `>= 0.0.0` - -Tilde Range Comparisons (Patch) - -The tilde (`~`) comparison operator is for patch level ranges when a minor -version is specified and major level changes when the minor number is missing. -For example, - - * `~1.2.3` is equivalent to `>= 1.2.3, < 1.3.0` - * `~1` is equivalent to `>= 1, < 2` - * `~2.3` is equivalent to `>= 2.3, < 2.4` - * `~1.2.x` is equivalent to `>= 1.2.0, < 1.3.0` - * `~1.x` is equivalent to `>= 1, < 2` - -Caret Range Comparisons (Major) - -The caret (`^`) comparison operator is for major level changes. This is useful -when comparisons of API versions as a major change is API breaking. For example, - - * `^1.2.3` is equivalent to `>= 1.2.3, < 2.0.0` - * `^1.2.x` is equivalent to `>= 1.2.0, < 2.0.0` - * `^2.3` is equivalent to `>= 2.3, < 3` - * `^2.x` is equivalent to `>= 2.0.0, < 3` -*/ -package semver diff --git a/vendor/github.com/Masterminds/semver/v3/.gitignore b/vendor/github.com/Masterminds/semver/v3/.gitignore new file mode 100644 index 0000000..6b061e6 --- /dev/null +++ b/vendor/github.com/Masterminds/semver/v3/.gitignore @@ -0,0 +1 @@ +_fuzz/ \ No newline at end of file diff --git a/vendor/github.com/Masterminds/semver/v3/.golangci.yml b/vendor/github.com/Masterminds/semver/v3/.golangci.yml new file mode 100644 index 0000000..fdbdf14 --- /dev/null +++ b/vendor/github.com/Masterminds/semver/v3/.golangci.yml @@ -0,0 +1,26 @@ +run: + deadline: 2m + +linters: + disable-all: true + enable: + - deadcode + - dupl + - errcheck + - gofmt + - goimports + - golint + - gosimple + - govet + - ineffassign + - misspell + - nakedret + - structcheck + - unused + - varcheck + +linters-settings: + gofmt: + simplify: true + dupl: + threshold: 400 diff --git a/vendor/github.com/Masterminds/semver/v3/CHANGELOG.md b/vendor/github.com/Masterminds/semver/v3/CHANGELOG.md new file mode 100644 index 0000000..1f90c38 --- /dev/null +++ b/vendor/github.com/Masterminds/semver/v3/CHANGELOG.md @@ -0,0 +1,194 @@ +# Changelog + +## 3.1.1 (2020-11-23) + +### Fixed + +- #158: Fixed issue with generated regex operation order that could cause problem + +## 3.1.0 (2020-04-15) + +### Added + +- #131: Add support for serializing/deserializing SQL (thanks @ryancurrah) + +### Changed + +- #148: More accurate validation messages on constraints + +## 3.0.3 (2019-12-13) + +### Fixed + +- #141: Fixed issue with <= comparison + +## 3.0.2 (2019-11-14) + +### Fixed + +- #134: Fixed broken constraint checking with ^0.0 (thanks @krmichelos) + +## 3.0.1 (2019-09-13) + +### Fixed + +- #125: Fixes issue with module path for v3 + +## 3.0.0 (2019-09-12) + +This is a major release of the semver package which includes API changes. The Go +API is compatible with ^1. The Go API was not changed because many people are using +`go get` without Go modules for their applications and API breaking changes cause +errors which we have or would need to support. + +The changes in this release are the handling based on the data passed into the +functions. These are described in the added and changed sections below. + +### Added + +- StrictNewVersion function. This is similar to NewVersion but will return an + error if the version passed in is not a strict semantic version. For example, + 1.2.3 would pass but v1.2.3 or 1.2 would fail because they are not strictly + speaking semantic versions. This function is faster, performs fewer operations, + and uses fewer allocations than NewVersion. +- Fuzzing has been performed on NewVersion, StrictNewVersion, and NewConstraint. + The Makefile contains the operations used. For more information on you can start + on Wikipedia at https://en.wikipedia.org/wiki/Fuzzing +- Now using Go modules + +### Changed + +- NewVersion has proper prerelease and metadata validation with error messages + to signal an issue with either of them +- ^ now operates using a similar set of rules to npm/js and Rust/Cargo. If the + version is >=1 the ^ ranges works the same as v1. For major versions of 0 the + rules have changed. The minor version is treated as the stable version unless + a patch is specified and then it is equivalent to =. One difference from npm/js + is that prereleases there are only to a specific version (e.g. 1.2.3). + Prereleases here look over multiple versions and follow semantic version + ordering rules. This pattern now follows along with the expected and requested + handling of this packaged by numerous users. + +## 1.5.0 (2019-09-11) + +### Added + +- #103: Add basic fuzzing for `NewVersion()` (thanks @jesse-c) + +### Changed + +- #82: Clarify wildcard meaning in range constraints and update tests for it (thanks @greysteil) +- #83: Clarify caret operator range for pre-1.0.0 dependencies (thanks @greysteil) +- #72: Adding docs comment pointing to vert for a cli +- #71: Update the docs on pre-release comparator handling +- #89: Test with new go versions (thanks @thedevsaddam) +- #87: Added $ to ValidPrerelease for better validation (thanks @jeremycarroll) + +### Fixed + +- #78: Fix unchecked error in example code (thanks @ravron) +- #70: Fix the handling of pre-releases and the 0.0.0 release edge case +- #97: Fixed copyright file for proper display on GitHub +- #107: Fix handling prerelease when sorting alphanum and num +- #109: Fixed where Validate sometimes returns wrong message on error + +## 1.4.2 (2018-04-10) + +### Changed + +- #72: Updated the docs to point to vert for a console appliaction +- #71: Update the docs on pre-release comparator handling + +### Fixed + +- #70: Fix the handling of pre-releases and the 0.0.0 release edge case + +## 1.4.1 (2018-04-02) + +### Fixed + +- Fixed #64: Fix pre-release precedence issue (thanks @uudashr) + +## 1.4.0 (2017-10-04) + +### Changed + +- #61: Update NewVersion to parse ints with a 64bit int size (thanks @zknill) + +## 1.3.1 (2017-07-10) + +### Fixed + +- Fixed #57: number comparisons in prerelease sometimes inaccurate + +## 1.3.0 (2017-05-02) + +### Added + +- #45: Added json (un)marshaling support (thanks @mh-cbon) +- Stability marker. See https://masterminds.github.io/stability/ + +### Fixed + +- #51: Fix handling of single digit tilde constraint (thanks @dgodd) + +### Changed + +- #55: The godoc icon moved from png to svg + +## 1.2.3 (2017-04-03) + +### Fixed + +- #46: Fixed 0.x.x and 0.0.x in constraints being treated as * + +## Release 1.2.2 (2016-12-13) + +### Fixed + +- #34: Fixed issue where hyphen range was not working with pre-release parsing. + +## Release 1.2.1 (2016-11-28) + +### Fixed + +- #24: Fixed edge case issue where constraint "> 0" does not handle "0.0.1-alpha" + properly. + +## Release 1.2.0 (2016-11-04) + +### Added + +- #20: Added MustParse function for versions (thanks @adamreese) +- #15: Added increment methods on versions (thanks @mh-cbon) + +### Fixed + +- Issue #21: Per the SemVer spec (section 9) a pre-release is unstable and + might not satisfy the intended compatibility. The change here ignores pre-releases + on constraint checks (e.g., ~ or ^) when a pre-release is not part of the + constraint. For example, `^1.2.3` will ignore pre-releases while + `^1.2.3-alpha` will include them. + +## Release 1.1.1 (2016-06-30) + +### Changed + +- Issue #9: Speed up version comparison performance (thanks @sdboyer) +- Issue #8: Added benchmarks (thanks @sdboyer) +- Updated Go Report Card URL to new location +- Updated Readme to add code snippet formatting (thanks @mh-cbon) +- Updating tagging to v[SemVer] structure for compatibility with other tools. + +## Release 1.1.0 (2016-03-11) + +- Issue #2: Implemented validation to provide reasons a versions failed a + constraint. + +## Release 1.0.1 (2015-12-31) + +- Fixed #1: * constraint failing on valid versions. + +## Release 1.0.0 (2015-10-20) + +- Initial release diff --git a/vendor/github.com/Masterminds/semver/LICENSE.txt b/vendor/github.com/Masterminds/semver/v3/LICENSE.txt similarity index 100% rename from vendor/github.com/Masterminds/semver/LICENSE.txt rename to vendor/github.com/Masterminds/semver/v3/LICENSE.txt diff --git a/vendor/github.com/Masterminds/semver/v3/Makefile b/vendor/github.com/Masterminds/semver/v3/Makefile new file mode 100644 index 0000000..eac1917 --- /dev/null +++ b/vendor/github.com/Masterminds/semver/v3/Makefile @@ -0,0 +1,37 @@ +GOPATH=$(shell go env GOPATH) +GOLANGCI_LINT=$(GOPATH)/bin/golangci-lint +GOFUZZBUILD = $(GOPATH)/bin/go-fuzz-build +GOFUZZ = $(GOPATH)/bin/go-fuzz + +.PHONY: lint +lint: $(GOLANGCI_LINT) + @echo "==> Linting codebase" + @$(GOLANGCI_LINT) run + +.PHONY: test +test: + @echo "==> Running tests" + GO111MODULE=on go test -v + +.PHONY: test-cover +test-cover: + @echo "==> Running Tests with coverage" + GO111MODULE=on go test -cover . + +.PHONY: fuzz +fuzz: $(GOFUZZBUILD) $(GOFUZZ) + @echo "==> Fuzz testing" + $(GOFUZZBUILD) + $(GOFUZZ) -workdir=_fuzz + +$(GOLANGCI_LINT): + # Install golangci-lint. The configuration for it is in the .golangci.yml + # file in the root of the repository + echo ${GOPATH} + curl -sfL https://install.goreleaser.com/github.com/golangci/golangci-lint.sh | sh -s -- -b $(GOPATH)/bin v1.17.1 + +$(GOFUZZBUILD): + cd / && go get -u github.com/dvyukov/go-fuzz/go-fuzz-build + +$(GOFUZZ): + cd / && go get -u github.com/dvyukov/go-fuzz/go-fuzz github.com/dvyukov/go-fuzz/go-fuzz-dep \ No newline at end of file diff --git a/vendor/github.com/Masterminds/semver/v3/README.md b/vendor/github.com/Masterminds/semver/v3/README.md new file mode 100644 index 0000000..d8f54dc --- /dev/null +++ b/vendor/github.com/Masterminds/semver/v3/README.md @@ -0,0 +1,244 @@ +# SemVer + +The `semver` package provides the ability to work with [Semantic Versions](http://semver.org) in Go. Specifically it provides the ability to: + +* Parse semantic versions +* Sort semantic versions +* Check if a semantic version fits within a set of constraints +* Optionally work with a `v` prefix + +[![Stability: +Active](https://masterminds.github.io/stability/active.svg)](https://masterminds.github.io/stability/active.html) +[![](https://github.com/Masterminds/semver/workflows/Tests/badge.svg)](https://github.com/Masterminds/semver/actions) +[![GoDoc](https://img.shields.io/static/v1?label=godoc&message=reference&color=blue)](https://pkg.go.dev/github.com/Masterminds/semver/v3) +[![Go Report Card](https://goreportcard.com/badge/github.com/Masterminds/semver)](https://goreportcard.com/report/github.com/Masterminds/semver) + +If you are looking for a command line tool for version comparisons please see +[vert](https://github.com/Masterminds/vert) which uses this library. + +## Package Versions + +There are three major versions fo the `semver` package. + +* 3.x.x is the new stable and active version. This version is focused on constraint + compatibility for range handling in other tools from other languages. It has + a similar API to the v1 releases. The development of this version is on the master + branch. The documentation for this version is below. +* 2.x was developed primarily for [dep](https://github.com/golang/dep). There are + no tagged releases and the development was performed by [@sdboyer](https://github.com/sdboyer). + There are API breaking changes from v1. This version lives on the [2.x branch](https://github.com/Masterminds/semver/tree/2.x). +* 1.x.x is the most widely used version with numerous tagged releases. This is the + previous stable and is still maintained for bug fixes. The development, to fix + bugs, occurs on the release-1 branch. You can read the documentation [here](https://github.com/Masterminds/semver/blob/release-1/README.md). + +## Parsing Semantic Versions + +There are two functions that can parse semantic versions. The `StrictNewVersion` +function only parses valid version 2 semantic versions as outlined in the +specification. The `NewVersion` function attempts to coerce a version into a +semantic version and parse it. For example, if there is a leading v or a version +listed without all 3 parts (e.g. `v1.2`) it will attempt to coerce it into a valid +semantic version (e.g., 1.2.0). In both cases a `Version` object is returned +that can be sorted, compared, and used in constraints. + +When parsing a version an error is returned if there is an issue parsing the +version. For example, + + v, err := semver.NewVersion("1.2.3-beta.1+build345") + +The version object has methods to get the parts of the version, compare it to +other versions, convert the version back into a string, and get the original +string. Getting the original string is useful if the semantic version was coerced +into a valid form. + +## Sorting Semantic Versions + +A set of versions can be sorted using the `sort` package from the standard library. +For example, + +```go +raw := []string{"1.2.3", "1.0", "1.3", "2", "0.4.2",} +vs := make([]*semver.Version, len(raw)) +for i, r := range raw { + v, err := semver.NewVersion(r) + if err != nil { + t.Errorf("Error parsing version: %s", err) + } + + vs[i] = v +} + +sort.Sort(semver.Collection(vs)) +``` + +## Checking Version Constraints + +There are two methods for comparing versions. One uses comparison methods on +`Version` instances and the other uses `Constraints`. There are some important +differences to notes between these two methods of comparison. + +1. When two versions are compared using functions such as `Compare`, `LessThan`, + and others it will follow the specification and always include prereleases + within the comparison. It will provide an answer that is valid with the + comparison section of the spec at https://semver.org/#spec-item-11 +2. When constraint checking is used for checks or validation it will follow a + different set of rules that are common for ranges with tools like npm/js + and Rust/Cargo. This includes considering prereleases to be invalid if the + ranges does not include one. If you want to have it include pre-releases a + simple solution is to include `-0` in your range. +3. Constraint ranges can have some complex rules including the shorthand use of + ~ and ^. For more details on those see the options below. + +There are differences between the two methods or checking versions because the +comparison methods on `Version` follow the specification while comparison ranges +are not part of the specification. Different packages and tools have taken it +upon themselves to come up with range rules. This has resulted in differences. +For example, npm/js and Cargo/Rust follow similar patterns while PHP has a +different pattern for ^. The comparison features in this package follow the +npm/js and Cargo/Rust lead because applications using it have followed similar +patters with their versions. + +Checking a version against version constraints is one of the most featureful +parts of the package. + +```go +c, err := semver.NewConstraint(">= 1.2.3") +if err != nil { + // Handle constraint not being parsable. +} + +v, err := semver.NewVersion("1.3") +if err != nil { + // Handle version not being parsable. +} +// Check if the version meets the constraints. The a variable will be true. +a := c.Check(v) +``` + +### Basic Comparisons + +There are two elements to the comparisons. First, a comparison string is a list +of space or comma separated AND comparisons. These are then separated by || (OR) +comparisons. For example, `">= 1.2 < 3.0.0 || >= 4.2.3"` is looking for a +comparison that's greater than or equal to 1.2 and less than 3.0.0 or is +greater than or equal to 4.2.3. + +The basic comparisons are: + +* `=`: equal (aliased to no operator) +* `!=`: not equal +* `>`: greater than +* `<`: less than +* `>=`: greater than or equal to +* `<=`: less than or equal to + +### Working With Prerelease Versions + +Pre-releases, for those not familiar with them, are used for software releases +prior to stable or generally available releases. Examples of prereleases include +development, alpha, beta, and release candidate releases. A prerelease may be +a version such as `1.2.3-beta.1` while the stable release would be `1.2.3`. In the +order of precedence, prereleases come before their associated releases. In this +example `1.2.3-beta.1 < 1.2.3`. + +According to the Semantic Version specification prereleases may not be +API compliant with their release counterpart. It says, + +> A pre-release version indicates that the version is unstable and might not satisfy the intended compatibility requirements as denoted by its associated normal version. + +SemVer comparisons using constraints without a prerelease comparator will skip +prerelease versions. For example, `>=1.2.3` will skip prereleases when looking +at a list of releases while `>=1.2.3-0` will evaluate and find prereleases. + +The reason for the `0` as a pre-release version in the example comparison is +because pre-releases can only contain ASCII alphanumerics and hyphens (along with +`.` separators), per the spec. Sorting happens in ASCII sort order, again per the +spec. The lowest character is a `0` in ASCII sort order +(see an [ASCII Table](http://www.asciitable.com/)) + +Understanding ASCII sort ordering is important because A-Z comes before a-z. That +means `>=1.2.3-BETA` will return `1.2.3-alpha`. What you might expect from case +sensitivity doesn't apply here. This is due to ASCII sort ordering which is what +the spec specifies. + +### Hyphen Range Comparisons + +There are multiple methods to handle ranges and the first is hyphens ranges. +These look like: + +* `1.2 - 1.4.5` which is equivalent to `>= 1.2 <= 1.4.5` +* `2.3.4 - 4.5` which is equivalent to `>= 2.3.4 <= 4.5` + +### Wildcards In Comparisons + +The `x`, `X`, and `*` characters can be used as a wildcard character. This works +for all comparison operators. When used on the `=` operator it falls +back to the patch level comparison (see tilde below). For example, + +* `1.2.x` is equivalent to `>= 1.2.0, < 1.3.0` +* `>= 1.2.x` is equivalent to `>= 1.2.0` +* `<= 2.x` is equivalent to `< 3` +* `*` is equivalent to `>= 0.0.0` + +### Tilde Range Comparisons (Patch) + +The tilde (`~`) comparison operator is for patch level ranges when a minor +version is specified and major level changes when the minor number is missing. +For example, + +* `~1.2.3` is equivalent to `>= 1.2.3, < 1.3.0` +* `~1` is equivalent to `>= 1, < 2` +* `~2.3` is equivalent to `>= 2.3, < 2.4` +* `~1.2.x` is equivalent to `>= 1.2.0, < 1.3.0` +* `~1.x` is equivalent to `>= 1, < 2` + +### Caret Range Comparisons (Major) + +The caret (`^`) comparison operator is for major level changes once a stable +(1.0.0) release has occurred. Prior to a 1.0.0 release the minor versions acts +as the API stability level. This is useful when comparisons of API versions as a +major change is API breaking. For example, + +* `^1.2.3` is equivalent to `>= 1.2.3, < 2.0.0` +* `^1.2.x` is equivalent to `>= 1.2.0, < 2.0.0` +* `^2.3` is equivalent to `>= 2.3, < 3` +* `^2.x` is equivalent to `>= 2.0.0, < 3` +* `^0.2.3` is equivalent to `>=0.2.3 <0.3.0` +* `^0.2` is equivalent to `>=0.2.0 <0.3.0` +* `^0.0.3` is equivalent to `>=0.0.3 <0.0.4` +* `^0.0` is equivalent to `>=0.0.0 <0.1.0` +* `^0` is equivalent to `>=0.0.0 <1.0.0` + +## Validation + +In addition to testing a version against a constraint, a version can be validated +against a constraint. When validation fails a slice of errors containing why a +version didn't meet the constraint is returned. For example, + +```go +c, err := semver.NewConstraint("<= 1.2.3, >= 1.4") +if err != nil { + // Handle constraint not being parseable. +} + +v, err := semver.NewVersion("1.3") +if err != nil { + // Handle version not being parseable. +} + +// Validate a version against a constraint. +a, msgs := c.Validate(v) +// a is false +for _, m := range msgs { + fmt.Println(m) + + // Loops over the errors which would read + // "1.3 is greater than 1.2.3" + // "1.3 is less than 1.4" +} +``` + +## Contribute + +If you find an issue or want to contribute please file an [issue](https://github.com/Masterminds/semver/issues) +or [create a pull request](https://github.com/Masterminds/semver/pulls). diff --git a/vendor/github.com/Masterminds/semver/collection.go b/vendor/github.com/Masterminds/semver/v3/collection.go similarity index 100% rename from vendor/github.com/Masterminds/semver/collection.go rename to vendor/github.com/Masterminds/semver/v3/collection.go diff --git a/vendor/github.com/Masterminds/semver/v3/constraints.go b/vendor/github.com/Masterminds/semver/v3/constraints.go new file mode 100644 index 0000000..547613f --- /dev/null +++ b/vendor/github.com/Masterminds/semver/v3/constraints.go @@ -0,0 +1,568 @@ +package semver + +import ( + "bytes" + "errors" + "fmt" + "regexp" + "strings" +) + +// Constraints is one or more constraint that a semantic version can be +// checked against. +type Constraints struct { + constraints [][]*constraint +} + +// NewConstraint returns a Constraints instance that a Version instance can +// be checked against. If there is a parse error it will be returned. +func NewConstraint(c string) (*Constraints, error) { + + // Rewrite - ranges into a comparison operation. + c = rewriteRange(c) + + ors := strings.Split(c, "||") + or := make([][]*constraint, len(ors)) + for k, v := range ors { + + // TODO: Find a way to validate and fetch all the constraints in a simpler form + + // Validate the segment + if !validConstraintRegex.MatchString(v) { + return nil, fmt.Errorf("improper constraint: %s", v) + } + + cs := findConstraintRegex.FindAllString(v, -1) + if cs == nil { + cs = append(cs, v) + } + result := make([]*constraint, len(cs)) + for i, s := range cs { + pc, err := parseConstraint(s) + if err != nil { + return nil, err + } + + result[i] = pc + } + or[k] = result + } + + o := &Constraints{constraints: or} + return o, nil +} + +// Check tests if a version satisfies the constraints. +func (cs Constraints) Check(v *Version) bool { + // TODO(mattfarina): For v4 of this library consolidate the Check and Validate + // functions as the underlying functions make that possible now. + // loop over the ORs and check the inner ANDs + for _, o := range cs.constraints { + joy := true + for _, c := range o { + if check, _ := c.check(v); !check { + joy = false + break + } + } + + if joy { + return true + } + } + + return false +} + +// Validate checks if a version satisfies a constraint. If not a slice of +// reasons for the failure are returned in addition to a bool. +func (cs Constraints) Validate(v *Version) (bool, []error) { + // loop over the ORs and check the inner ANDs + var e []error + + // Capture the prerelease message only once. When it happens the first time + // this var is marked + var prerelesase bool + for _, o := range cs.constraints { + joy := true + for _, c := range o { + // Before running the check handle the case there the version is + // a prerelease and the check is not searching for prereleases. + if c.con.pre == "" && v.pre != "" { + if !prerelesase { + em := fmt.Errorf("%s is a prerelease version and the constraint is only looking for release versions", v) + e = append(e, em) + prerelesase = true + } + joy = false + + } else { + + if _, err := c.check(v); err != nil { + e = append(e, err) + joy = false + } + } + } + + if joy { + return true, []error{} + } + } + + return false, e +} + +func (cs Constraints) String() string { + buf := make([]string, len(cs.constraints)) + var tmp bytes.Buffer + + for k, v := range cs.constraints { + tmp.Reset() + vlen := len(v) + for kk, c := range v { + tmp.WriteString(c.string()) + + // Space separate the AND conditions + if vlen > 1 && kk < vlen-1 { + tmp.WriteString(" ") + } + } + buf[k] = tmp.String() + } + + return strings.Join(buf, " || ") +} + +var constraintOps map[string]cfunc +var constraintRegex *regexp.Regexp +var constraintRangeRegex *regexp.Regexp + +// Used to find individual constraints within a multi-constraint string +var findConstraintRegex *regexp.Regexp + +// Used to validate an segment of ANDs is valid +var validConstraintRegex *regexp.Regexp + +const cvRegex string = `v?([0-9|x|X|\*]+)(\.[0-9|x|X|\*]+)?(\.[0-9|x|X|\*]+)?` + + `(-([0-9A-Za-z\-]+(\.[0-9A-Za-z\-]+)*))?` + + `(\+([0-9A-Za-z\-]+(\.[0-9A-Za-z\-]+)*))?` + +func init() { + constraintOps = map[string]cfunc{ + "": constraintTildeOrEqual, + "=": constraintTildeOrEqual, + "!=": constraintNotEqual, + ">": constraintGreaterThan, + "<": constraintLessThan, + ">=": constraintGreaterThanEqual, + "=>": constraintGreaterThanEqual, + "<=": constraintLessThanEqual, + "=<": constraintLessThanEqual, + "~": constraintTilde, + "~>": constraintTilde, + "^": constraintCaret, + } + + ops := `=||!=|>|<|>=|=>|<=|=<|~|~>|\^` + + constraintRegex = regexp.MustCompile(fmt.Sprintf( + `^\s*(%s)\s*(%s)\s*$`, + ops, + cvRegex)) + + constraintRangeRegex = regexp.MustCompile(fmt.Sprintf( + `\s*(%s)\s+-\s+(%s)\s*`, + cvRegex, cvRegex)) + + findConstraintRegex = regexp.MustCompile(fmt.Sprintf( + `(%s)\s*(%s)`, + ops, + cvRegex)) + + validConstraintRegex = regexp.MustCompile(fmt.Sprintf( + `^(\s*(%s)\s*(%s)\s*\,?)+$`, + ops, + cvRegex)) +} + +// An individual constraint +type constraint struct { + // The version used in the constraint check. For example, if a constraint + // is '<= 2.0.0' the con a version instance representing 2.0.0. + con *Version + + // The original parsed version (e.g., 4.x from != 4.x) + orig string + + // The original operator for the constraint + origfunc string + + // When an x is used as part of the version (e.g., 1.x) + minorDirty bool + dirty bool + patchDirty bool +} + +// Check if a version meets the constraint +func (c *constraint) check(v *Version) (bool, error) { + return constraintOps[c.origfunc](v, c) +} + +// String prints an individual constraint into a string +func (c *constraint) string() string { + return c.origfunc + c.orig +} + +type cfunc func(v *Version, c *constraint) (bool, error) + +func parseConstraint(c string) (*constraint, error) { + if len(c) > 0 { + m := constraintRegex.FindStringSubmatch(c) + if m == nil { + return nil, fmt.Errorf("improper constraint: %s", c) + } + + cs := &constraint{ + orig: m[2], + origfunc: m[1], + } + + ver := m[2] + minorDirty := false + patchDirty := false + dirty := false + if isX(m[3]) || m[3] == "" { + ver = "0.0.0" + dirty = true + } else if isX(strings.TrimPrefix(m[4], ".")) || m[4] == "" { + minorDirty = true + dirty = true + ver = fmt.Sprintf("%s.0.0%s", m[3], m[6]) + } else if isX(strings.TrimPrefix(m[5], ".")) || m[5] == "" { + dirty = true + patchDirty = true + ver = fmt.Sprintf("%s%s.0%s", m[3], m[4], m[6]) + } + + con, err := NewVersion(ver) + if err != nil { + + // The constraintRegex should catch any regex parsing errors. So, + // we should never get here. + return nil, errors.New("constraint Parser Error") + } + + cs.con = con + cs.minorDirty = minorDirty + cs.patchDirty = patchDirty + cs.dirty = dirty + + return cs, nil + } + + // The rest is the special case where an empty string was passed in which + // is equivalent to * or >=0.0.0 + con, err := StrictNewVersion("0.0.0") + if err != nil { + + // The constraintRegex should catch any regex parsing errors. So, + // we should never get here. + return nil, errors.New("constraint Parser Error") + } + + cs := &constraint{ + con: con, + orig: c, + origfunc: "", + minorDirty: false, + patchDirty: false, + dirty: true, + } + return cs, nil +} + +// Constraint functions +func constraintNotEqual(v *Version, c *constraint) (bool, error) { + if c.dirty { + + // If there is a pre-release on the version but the constraint isn't looking + // for them assume that pre-releases are not compatible. See issue 21 for + // more details. + if v.Prerelease() != "" && c.con.Prerelease() == "" { + return false, fmt.Errorf("%s is a prerelease version and the constraint is only looking for release versions", v) + } + + if c.con.Major() != v.Major() { + return true, nil + } + if c.con.Minor() != v.Minor() && !c.minorDirty { + return true, nil + } else if c.minorDirty { + return false, fmt.Errorf("%s is equal to %s", v, c.orig) + } else if c.con.Patch() != v.Patch() && !c.patchDirty { + return true, nil + } else if c.patchDirty { + // Need to handle prereleases if present + if v.Prerelease() != "" || c.con.Prerelease() != "" { + eq := comparePrerelease(v.Prerelease(), c.con.Prerelease()) != 0 + if eq { + return true, nil + } + return false, fmt.Errorf("%s is equal to %s", v, c.orig) + } + return false, fmt.Errorf("%s is equal to %s", v, c.orig) + } + } + + eq := v.Equal(c.con) + if eq { + return false, fmt.Errorf("%s is equal to %s", v, c.orig) + } + + return true, nil +} + +func constraintGreaterThan(v *Version, c *constraint) (bool, error) { + + // If there is a pre-release on the version but the constraint isn't looking + // for them assume that pre-releases are not compatible. See issue 21 for + // more details. + if v.Prerelease() != "" && c.con.Prerelease() == "" { + return false, fmt.Errorf("%s is a prerelease version and the constraint is only looking for release versions", v) + } + + var eq bool + + if !c.dirty { + eq = v.Compare(c.con) == 1 + if eq { + return true, nil + } + return false, fmt.Errorf("%s is less than or equal to %s", v, c.orig) + } + + if v.Major() > c.con.Major() { + return true, nil + } else if v.Major() < c.con.Major() { + return false, fmt.Errorf("%s is less than or equal to %s", v, c.orig) + } else if c.minorDirty { + // This is a range case such as >11. When the version is something like + // 11.1.0 is it not > 11. For that we would need 12 or higher + return false, fmt.Errorf("%s is less than or equal to %s", v, c.orig) + } else if c.patchDirty { + // This is for ranges such as >11.1. A version of 11.1.1 is not greater + // which one of 11.2.1 is greater + eq = v.Minor() > c.con.Minor() + if eq { + return true, nil + } + return false, fmt.Errorf("%s is less than or equal to %s", v, c.orig) + } + + // If we have gotten here we are not comparing pre-preleases and can use the + // Compare function to accomplish that. + eq = v.Compare(c.con) == 1 + if eq { + return true, nil + } + return false, fmt.Errorf("%s is less than or equal to %s", v, c.orig) +} + +func constraintLessThan(v *Version, c *constraint) (bool, error) { + // If there is a pre-release on the version but the constraint isn't looking + // for them assume that pre-releases are not compatible. See issue 21 for + // more details. + if v.Prerelease() != "" && c.con.Prerelease() == "" { + return false, fmt.Errorf("%s is a prerelease version and the constraint is only looking for release versions", v) + } + + eq := v.Compare(c.con) < 0 + if eq { + return true, nil + } + return false, fmt.Errorf("%s is greater than or equal to %s", v, c.orig) +} + +func constraintGreaterThanEqual(v *Version, c *constraint) (bool, error) { + + // If there is a pre-release on the version but the constraint isn't looking + // for them assume that pre-releases are not compatible. See issue 21 for + // more details. + if v.Prerelease() != "" && c.con.Prerelease() == "" { + return false, fmt.Errorf("%s is a prerelease version and the constraint is only looking for release versions", v) + } + + eq := v.Compare(c.con) >= 0 + if eq { + return true, nil + } + return false, fmt.Errorf("%s is less than %s", v, c.orig) +} + +func constraintLessThanEqual(v *Version, c *constraint) (bool, error) { + // If there is a pre-release on the version but the constraint isn't looking + // for them assume that pre-releases are not compatible. See issue 21 for + // more details. + if v.Prerelease() != "" && c.con.Prerelease() == "" { + return false, fmt.Errorf("%s is a prerelease version and the constraint is only looking for release versions", v) + } + + var eq bool + + if !c.dirty { + eq = v.Compare(c.con) <= 0 + if eq { + return true, nil + } + return false, fmt.Errorf("%s is greater than %s", v, c.orig) + } + + if v.Major() > c.con.Major() { + return false, fmt.Errorf("%s is greater than %s", v, c.orig) + } else if v.Major() == c.con.Major() && v.Minor() > c.con.Minor() && !c.minorDirty { + return false, fmt.Errorf("%s is greater than %s", v, c.orig) + } + + return true, nil +} + +// ~*, ~>* --> >= 0.0.0 (any) +// ~2, ~2.x, ~2.x.x, ~>2, ~>2.x ~>2.x.x --> >=2.0.0, <3.0.0 +// ~2.0, ~2.0.x, ~>2.0, ~>2.0.x --> >=2.0.0, <2.1.0 +// ~1.2, ~1.2.x, ~>1.2, ~>1.2.x --> >=1.2.0, <1.3.0 +// ~1.2.3, ~>1.2.3 --> >=1.2.3, <1.3.0 +// ~1.2.0, ~>1.2.0 --> >=1.2.0, <1.3.0 +func constraintTilde(v *Version, c *constraint) (bool, error) { + // If there is a pre-release on the version but the constraint isn't looking + // for them assume that pre-releases are not compatible. See issue 21 for + // more details. + if v.Prerelease() != "" && c.con.Prerelease() == "" { + return false, fmt.Errorf("%s is a prerelease version and the constraint is only looking for release versions", v) + } + + if v.LessThan(c.con) { + return false, fmt.Errorf("%s is less than %s", v, c.orig) + } + + // ~0.0.0 is a special case where all constraints are accepted. It's + // equivalent to >= 0.0.0. + if c.con.Major() == 0 && c.con.Minor() == 0 && c.con.Patch() == 0 && + !c.minorDirty && !c.patchDirty { + return true, nil + } + + if v.Major() != c.con.Major() { + return false, fmt.Errorf("%s does not have same major version as %s", v, c.orig) + } + + if v.Minor() != c.con.Minor() && !c.minorDirty { + return false, fmt.Errorf("%s does not have same major and minor version as %s", v, c.orig) + } + + return true, nil +} + +// When there is a .x (dirty) status it automatically opts in to ~. Otherwise +// it's a straight = +func constraintTildeOrEqual(v *Version, c *constraint) (bool, error) { + // If there is a pre-release on the version but the constraint isn't looking + // for them assume that pre-releases are not compatible. See issue 21 for + // more details. + if v.Prerelease() != "" && c.con.Prerelease() == "" { + return false, fmt.Errorf("%s is a prerelease version and the constraint is only looking for release versions", v) + } + + if c.dirty { + return constraintTilde(v, c) + } + + eq := v.Equal(c.con) + if eq { + return true, nil + } + + return false, fmt.Errorf("%s is not equal to %s", v, c.orig) +} + +// ^* --> (any) +// ^1.2.3 --> >=1.2.3 <2.0.0 +// ^1.2 --> >=1.2.0 <2.0.0 +// ^1 --> >=1.0.0 <2.0.0 +// ^0.2.3 --> >=0.2.3 <0.3.0 +// ^0.2 --> >=0.2.0 <0.3.0 +// ^0.0.3 --> >=0.0.3 <0.0.4 +// ^0.0 --> >=0.0.0 <0.1.0 +// ^0 --> >=0.0.0 <1.0.0 +func constraintCaret(v *Version, c *constraint) (bool, error) { + // If there is a pre-release on the version but the constraint isn't looking + // for them assume that pre-releases are not compatible. See issue 21 for + // more details. + if v.Prerelease() != "" && c.con.Prerelease() == "" { + return false, fmt.Errorf("%s is a prerelease version and the constraint is only looking for release versions", v) + } + + // This less than handles prereleases + if v.LessThan(c.con) { + return false, fmt.Errorf("%s is less than %s", v, c.orig) + } + + var eq bool + + // ^ when the major > 0 is >=x.y.z < x+1 + if c.con.Major() > 0 || c.minorDirty { + + // ^ has to be within a major range for > 0. Everything less than was + // filtered out with the LessThan call above. This filters out those + // that greater but not within the same major range. + eq = v.Major() == c.con.Major() + if eq { + return true, nil + } + return false, fmt.Errorf("%s does not have same major version as %s", v, c.orig) + } + + // ^ when the major is 0 and minor > 0 is >=0.y.z < 0.y+1 + if c.con.Major() == 0 && v.Major() > 0 { + return false, fmt.Errorf("%s does not have same major version as %s", v, c.orig) + } + // If the con Minor is > 0 it is not dirty + if c.con.Minor() > 0 || c.patchDirty { + eq = v.Minor() == c.con.Minor() + if eq { + return true, nil + } + return false, fmt.Errorf("%s does not have same minor version as %s. Expected minor versions to match when constraint major version is 0", v, c.orig) + } + + // At this point the major is 0 and the minor is 0 and not dirty. The patch + // is not dirty so we need to check if they are equal. If they are not equal + eq = c.con.Patch() == v.Patch() + if eq { + return true, nil + } + return false, fmt.Errorf("%s does not equal %s. Expect version and constraint to equal when major and minor versions are 0", v, c.orig) +} + +func isX(x string) bool { + switch x { + case "x", "*", "X": + return true + default: + return false + } +} + +func rewriteRange(i string) string { + m := constraintRangeRegex.FindAllStringSubmatch(i, -1) + if m == nil { + return i + } + o := i + for _, v := range m { + t := fmt.Sprintf(">= %s, <= %s", v[1], v[11]) + o = strings.Replace(o, v[0], t, 1) + } + + return o +} diff --git a/vendor/github.com/Masterminds/semver/v3/doc.go b/vendor/github.com/Masterminds/semver/v3/doc.go new file mode 100644 index 0000000..391aa46 --- /dev/null +++ b/vendor/github.com/Masterminds/semver/v3/doc.go @@ -0,0 +1,184 @@ +/* +Package semver provides the ability to work with Semantic Versions (http://semver.org) in Go. + +Specifically it provides the ability to: + + * Parse semantic versions + * Sort semantic versions + * Check if a semantic version fits within a set of constraints + * Optionally work with a `v` prefix + +Parsing Semantic Versions + +There are two functions that can parse semantic versions. The `StrictNewVersion` +function only parses valid version 2 semantic versions as outlined in the +specification. The `NewVersion` function attempts to coerce a version into a +semantic version and parse it. For example, if there is a leading v or a version +listed without all 3 parts (e.g. 1.2) it will attempt to coerce it into a valid +semantic version (e.g., 1.2.0). In both cases a `Version` object is returned +that can be sorted, compared, and used in constraints. + +When parsing a version an optional error can be returned if there is an issue +parsing the version. For example, + + v, err := semver.NewVersion("1.2.3-beta.1+b345") + +The version object has methods to get the parts of the version, compare it to +other versions, convert the version back into a string, and get the original +string. For more details please see the documentation +at https://godoc.org/github.com/Masterminds/semver. + +Sorting Semantic Versions + +A set of versions can be sorted using the `sort` package from the standard library. +For example, + + raw := []string{"1.2.3", "1.0", "1.3", "2", "0.4.2",} + vs := make([]*semver.Version, len(raw)) + for i, r := range raw { + v, err := semver.NewVersion(r) + if err != nil { + t.Errorf("Error parsing version: %s", err) + } + + vs[i] = v + } + + sort.Sort(semver.Collection(vs)) + +Checking Version Constraints and Comparing Versions + +There are two methods for comparing versions. One uses comparison methods on +`Version` instances and the other is using Constraints. There are some important +differences to notes between these two methods of comparison. + +1. When two versions are compared using functions such as `Compare`, `LessThan`, + and others it will follow the specification and always include prereleases + within the comparison. It will provide an answer valid with the comparison + spec section at https://semver.org/#spec-item-11 +2. When constraint checking is used for checks or validation it will follow a + different set of rules that are common for ranges with tools like npm/js + and Rust/Cargo. This includes considering prereleases to be invalid if the + ranges does not include on. If you want to have it include pre-releases a + simple solution is to include `-0` in your range. +3. Constraint ranges can have some complex rules including the shorthard use of + ~ and ^. For more details on those see the options below. + +There are differences between the two methods or checking versions because the +comparison methods on `Version` follow the specification while comparison ranges +are not part of the specification. Different packages and tools have taken it +upon themselves to come up with range rules. This has resulted in differences. +For example, npm/js and Cargo/Rust follow similar patterns which PHP has a +different pattern for ^. The comparison features in this package follow the +npm/js and Cargo/Rust lead because applications using it have followed similar +patters with their versions. + +Checking a version against version constraints is one of the most featureful +parts of the package. + + c, err := semver.NewConstraint(">= 1.2.3") + if err != nil { + // Handle constraint not being parsable. + } + + v, err := semver.NewVersion("1.3") + if err != nil { + // Handle version not being parsable. + } + // Check if the version meets the constraints. The a variable will be true. + a := c.Check(v) + +Basic Comparisons + +There are two elements to the comparisons. First, a comparison string is a list +of comma or space separated AND comparisons. These are then separated by || (OR) +comparisons. For example, `">= 1.2 < 3.0.0 || >= 4.2.3"` is looking for a +comparison that's greater than or equal to 1.2 and less than 3.0.0 or is +greater than or equal to 4.2.3. This can also be written as +`">= 1.2, < 3.0.0 || >= 4.2.3"` + +The basic comparisons are: + + * `=`: equal (aliased to no operator) + * `!=`: not equal + * `>`: greater than + * `<`: less than + * `>=`: greater than or equal to + * `<=`: less than or equal to + +Hyphen Range Comparisons + +There are multiple methods to handle ranges and the first is hyphens ranges. +These look like: + + * `1.2 - 1.4.5` which is equivalent to `>= 1.2, <= 1.4.5` + * `2.3.4 - 4.5` which is equivalent to `>= 2.3.4 <= 4.5` + +Wildcards In Comparisons + +The `x`, `X`, and `*` characters can be used as a wildcard character. This works +for all comparison operators. When used on the `=` operator it falls +back to the tilde operation. For example, + + * `1.2.x` is equivalent to `>= 1.2.0 < 1.3.0` + * `>= 1.2.x` is equivalent to `>= 1.2.0` + * `<= 2.x` is equivalent to `<= 3` + * `*` is equivalent to `>= 0.0.0` + +Tilde Range Comparisons (Patch) + +The tilde (`~`) comparison operator is for patch level ranges when a minor +version is specified and major level changes when the minor number is missing. +For example, + + * `~1.2.3` is equivalent to `>= 1.2.3 < 1.3.0` + * `~1` is equivalent to `>= 1, < 2` + * `~2.3` is equivalent to `>= 2.3 < 2.4` + * `~1.2.x` is equivalent to `>= 1.2.0 < 1.3.0` + * `~1.x` is equivalent to `>= 1 < 2` + +Caret Range Comparisons (Major) + +The caret (`^`) comparison operator is for major level changes once a stable +(1.0.0) release has occurred. Prior to a 1.0.0 release the minor versions acts +as the API stability level. This is useful when comparisons of API versions as a +major change is API breaking. For example, + + * `^1.2.3` is equivalent to `>= 1.2.3, < 2.0.0` + * `^1.2.x` is equivalent to `>= 1.2.0, < 2.0.0` + * `^2.3` is equivalent to `>= 2.3, < 3` + * `^2.x` is equivalent to `>= 2.0.0, < 3` + * `^0.2.3` is equivalent to `>=0.2.3 <0.3.0` + * `^0.2` is equivalent to `>=0.2.0 <0.3.0` + * `^0.0.3` is equivalent to `>=0.0.3 <0.0.4` + * `^0.0` is equivalent to `>=0.0.0 <0.1.0` + * `^0` is equivalent to `>=0.0.0 <1.0.0` + +Validation + +In addition to testing a version against a constraint, a version can be validated +against a constraint. When validation fails a slice of errors containing why a +version didn't meet the constraint is returned. For example, + + c, err := semver.NewConstraint("<= 1.2.3, >= 1.4") + if err != nil { + // Handle constraint not being parseable. + } + + v, _ := semver.NewVersion("1.3") + if err != nil { + // Handle version not being parseable. + } + + // Validate a version against a constraint. + a, msgs := c.Validate(v) + // a is false + for _, m := range msgs { + fmt.Println(m) + + // Loops over the errors which would read + // "1.3 is greater than 1.2.3" + // "1.3 is less than 1.4" + } +*/ +package semver diff --git a/vendor/github.com/Masterminds/semver/v3/fuzz.go b/vendor/github.com/Masterminds/semver/v3/fuzz.go new file mode 100644 index 0000000..a242ad7 --- /dev/null +++ b/vendor/github.com/Masterminds/semver/v3/fuzz.go @@ -0,0 +1,22 @@ +// +build gofuzz + +package semver + +func Fuzz(data []byte) int { + d := string(data) + + // Test NewVersion + _, _ = NewVersion(d) + + // Test StrictNewVersion + _, _ = StrictNewVersion(d) + + // Test NewConstraint + _, _ = NewConstraint(d) + + // The return value should be 0 normally, 1 if the priority in future tests + // should be increased, and -1 if future tests should skip passing in that + // data. We do not have a reason to change priority so 0 is always returned. + // There are example tests that do this. + return 0 +} diff --git a/vendor/github.com/Masterminds/semver/version.go b/vendor/github.com/Masterminds/semver/v3/version.go similarity index 58% rename from vendor/github.com/Masterminds/semver/version.go rename to vendor/github.com/Masterminds/semver/v3/version.go index 400d4f9..d6b9cda 100644 --- a/vendor/github.com/Masterminds/semver/version.go +++ b/vendor/github.com/Masterminds/semver/v3/version.go @@ -2,6 +2,7 @@ package semver import ( "bytes" + "database/sql/driver" "encoding/json" "errors" "fmt" @@ -13,13 +14,23 @@ import ( // The compiled version of the regex created at init() is cached here so it // only needs to be created once. var versionRegex *regexp.Regexp -var validPrereleaseRegex *regexp.Regexp var ( // ErrInvalidSemVer is returned a version is found to be invalid when // being parsed. ErrInvalidSemVer = errors.New("Invalid Semantic Version") + // ErrEmptyString is returned when an empty string is passed in for parsing. + ErrEmptyString = errors.New("Version string empty") + + // ErrInvalidCharacters is returned when invalid characters are found as + // part of a version + ErrInvalidCharacters = errors.New("Invalid characters in version") + + // ErrSegmentStartsZero is returned when a version segment starts with 0. + // This is invalid in SemVer. + ErrSegmentStartsZero = errors.New("Version segment starts with 0") + // ErrInvalidMetadata is returned when the metadata is an invalid format ErrInvalidMetadata = errors.New("Invalid Metadata string") @@ -27,30 +38,121 @@ var ( ErrInvalidPrerelease = errors.New("Invalid Prerelease string") ) -// SemVerRegex is the regular expression used to parse a semantic version. -const SemVerRegex string = `v?([0-9]+)(\.[0-9]+)?(\.[0-9]+)?` + +// semVerRegex is the regular expression used to parse a semantic version. +const semVerRegex string = `v?([0-9]+)(\.[0-9]+)?(\.[0-9]+)?` + `(-([0-9A-Za-z\-]+(\.[0-9A-Za-z\-]+)*))?` + `(\+([0-9A-Za-z\-]+(\.[0-9A-Za-z\-]+)*))?` -// ValidPrerelease is the regular expression which validates -// both prerelease and metadata values. -const ValidPrerelease string = `^([0-9A-Za-z\-]+(\.[0-9A-Za-z\-]+)*)$` - // Version represents a single semantic version. type Version struct { - major, minor, patch int64 + major, minor, patch uint64 pre string metadata string original string } func init() { - versionRegex = regexp.MustCompile("^" + SemVerRegex + "$") - validPrereleaseRegex = regexp.MustCompile(ValidPrerelease) + versionRegex = regexp.MustCompile("^" + semVerRegex + "$") +} + +const num string = "0123456789" +const allowed string = "abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ-" + num + +// StrictNewVersion parses a given version and returns an instance of Version or +// an error if unable to parse the version. Only parses valid semantic versions. +// Performs checking that can find errors within the version. +// If you want to coerce a version, such as 1 or 1.2, and perse that as the 1.x +// releases of semver provided use the NewSemver() function. +func StrictNewVersion(v string) (*Version, error) { + // Parsing here does not use RegEx in order to increase performance and reduce + // allocations. + + if len(v) == 0 { + return nil, ErrEmptyString + } + + // Split the parts into [0]major, [1]minor, and [2]patch,prerelease,build + parts := strings.SplitN(v, ".", 3) + if len(parts) != 3 { + return nil, ErrInvalidSemVer + } + + sv := &Version{ + original: v, + } + + // check for prerelease or build metadata + var extra []string + if strings.ContainsAny(parts[2], "-+") { + // Start with the build metadata first as it needs to be on the right + extra = strings.SplitN(parts[2], "+", 2) + if len(extra) > 1 { + // build metadata found + sv.metadata = extra[1] + parts[2] = extra[0] + } + + extra = strings.SplitN(parts[2], "-", 2) + if len(extra) > 1 { + // prerelease found + sv.pre = extra[1] + parts[2] = extra[0] + } + } + + // Validate the number segments are valid. This includes only having positive + // numbers and no leading 0's. + for _, p := range parts { + if !containsOnly(p, num) { + return nil, ErrInvalidCharacters + } + + if len(p) > 1 && p[0] == '0' { + return nil, ErrSegmentStartsZero + } + } + + // Extract the major, minor, and patch elements onto the returned Version + var err error + sv.major, err = strconv.ParseUint(parts[0], 10, 64) + if err != nil { + return nil, err + } + + sv.minor, err = strconv.ParseUint(parts[1], 10, 64) + if err != nil { + return nil, err + } + + sv.patch, err = strconv.ParseUint(parts[2], 10, 64) + if err != nil { + return nil, err + } + + // No prerelease or build metadata found so returning now as a fastpath. + if sv.pre == "" && sv.metadata == "" { + return sv, nil + } + + if sv.pre != "" { + if err = validatePrerelease(sv.pre); err != nil { + return nil, err + } + } + + if sv.metadata != "" { + if err = validateMetadata(sv.metadata); err != nil { + return nil, err + } + } + + return sv, nil } // NewVersion parses a given version and returns an instance of Version or -// an error if unable to parse the version. +// an error if unable to parse the version. If the version is SemVer-ish it +// attempts to convert it to SemVer. If you want to validate it was a strict +// semantic version at parse time see StrictNewVersion(). func NewVersion(v string) (*Version, error) { m := versionRegex.FindStringSubmatch(v) if m == nil { @@ -63,33 +165,45 @@ func NewVersion(v string) (*Version, error) { original: v, } - var temp int64 - temp, err := strconv.ParseInt(m[1], 10, 64) + var err error + sv.major, err = strconv.ParseUint(m[1], 10, 64) if err != nil { return nil, fmt.Errorf("Error parsing version segment: %s", err) } - sv.major = temp if m[2] != "" { - temp, err = strconv.ParseInt(strings.TrimPrefix(m[2], "."), 10, 64) + sv.minor, err = strconv.ParseUint(strings.TrimPrefix(m[2], "."), 10, 64) if err != nil { return nil, fmt.Errorf("Error parsing version segment: %s", err) } - sv.minor = temp } else { sv.minor = 0 } if m[3] != "" { - temp, err = strconv.ParseInt(strings.TrimPrefix(m[3], "."), 10, 64) + sv.patch, err = strconv.ParseUint(strings.TrimPrefix(m[3], "."), 10, 64) if err != nil { return nil, fmt.Errorf("Error parsing version segment: %s", err) } - sv.patch = temp } else { sv.patch = 0 } + // Perform some basic due diligence on the extra parts to ensure they are + // valid. + + if sv.pre != "" { + if err = validatePrerelease(sv.pre); err != nil { + return nil, err + } + } + + if sv.metadata != "" { + if err = validateMetadata(sv.metadata); err != nil { + return nil, err + } + } + return sv, nil } @@ -107,7 +221,7 @@ func MustParse(v string) *Version { // See the Original() method to retrieve the original value. Semantic Versions // don't contain a leading v per the spec. Instead it's optional on // implementation. -func (v *Version) String() string { +func (v Version) String() string { var buf bytes.Buffer fmt.Fprintf(&buf, "%d.%d.%d", v.major, v.minor, v.patch) @@ -127,32 +241,32 @@ func (v *Version) Original() string { } // Major returns the major version. -func (v *Version) Major() int64 { +func (v Version) Major() uint64 { return v.major } // Minor returns the minor version. -func (v *Version) Minor() int64 { +func (v Version) Minor() uint64 { return v.minor } // Patch returns the patch version. -func (v *Version) Patch() int64 { +func (v Version) Patch() uint64 { return v.patch } // Prerelease returns the pre-release version. -func (v *Version) Prerelease() string { +func (v Version) Prerelease() string { return v.pre } // Metadata returns the metadata on the version. -func (v *Version) Metadata() string { +func (v Version) Metadata() string { return v.metadata } // originalVPrefix returns the original 'v' prefix if any. -func (v *Version) originalVPrefix() string { +func (v Version) originalVPrefix() string { // Note, only lowercase v is supported as a prefix by the parser. if v.original != "" && v.original[:1] == "v" { @@ -165,7 +279,7 @@ func (v *Version) originalVPrefix() string { // If the current version does not have prerelease/metadata information, // it unsets metadata and prerelease values, increments patch number. // If the current version has any of prerelease or metadata information, -// it unsets both values and keeps curent patch value +// it unsets both values and keeps current patch value func (v Version) IncPatch() Version { vNext := v // according to http://semver.org/#spec-item-9 @@ -217,11 +331,13 @@ func (v Version) IncMajor() Version { } // SetPrerelease defines the prerelease value. -// Value must not include the required 'hypen' prefix. +// Value must not include the required 'hyphen' prefix. func (v Version) SetPrerelease(prerelease string) (Version, error) { vNext := v - if len(prerelease) > 0 && !validPrereleaseRegex.MatchString(prerelease) { - return vNext, ErrInvalidPrerelease + if len(prerelease) > 0 { + if err := validatePrerelease(prerelease); err != nil { + return vNext, err + } } vNext.pre = prerelease vNext.original = v.originalVPrefix() + "" + vNext.String() @@ -232,8 +348,10 @@ func (v Version) SetPrerelease(prerelease string) (Version, error) { // Value must not include the required 'plus' prefix. func (v Version) SetMetadata(metadata string) (Version, error) { vNext := v - if len(metadata) > 0 && !validPrereleaseRegex.MatchString(metadata) { - return vNext, ErrInvalidMetadata + if len(metadata) > 0 { + if err := validateMetadata(metadata); err != nil { + return vNext, err + } } vNext.metadata = metadata vNext.original = v.originalVPrefix() + "" + vNext.String() @@ -261,7 +379,9 @@ func (v *Version) Equal(o *Version) bool { // the version smaller, equal, or larger than the other version. // // Versions are compared by X.Y.Z. Build metadata is ignored. Prerelease is -// lower than the version without a prerelease. +// lower than the version without a prerelease. Compare always takes into account +// prereleases. If you want to work with ranges using typical range syntaxes that +// skip prereleases if the range is not looking for them use constraints. func (v *Version) Compare(o *Version) int { // Compare the major, minor, and patch version for differences. If a // difference is found return the comparison. @@ -308,16 +428,37 @@ func (v *Version) UnmarshalJSON(b []byte) error { v.pre = temp.pre v.metadata = temp.metadata v.original = temp.original - temp = nil return nil } // MarshalJSON implements JSON.Marshaler interface. -func (v *Version) MarshalJSON() ([]byte, error) { +func (v Version) MarshalJSON() ([]byte, error) { return json.Marshal(v.String()) } -func compareSegment(v, o int64) int { +// Scan implements the SQL.Scanner interface. +func (v *Version) Scan(value interface{}) error { + var s string + s, _ = value.(string) + temp, err := NewVersion(s) + if err != nil { + return err + } + v.major = temp.major + v.minor = temp.minor + v.patch = temp.patch + v.pre = temp.pre + v.metadata = temp.metadata + v.original = temp.original + return nil +} + +// Value implements the Driver.Valuer interface. +func (v Version) Value() (driver.Value, error) { + return v.String(), nil +} + +func compareSegment(v, o uint64) int { if v < o { return -1 } @@ -423,3 +564,43 @@ func comparePrePart(s, o string) int { return -1 } + +// Like strings.ContainsAny but does an only instead of any. +func containsOnly(s string, comp string) bool { + return strings.IndexFunc(s, func(r rune) bool { + return !strings.ContainsRune(comp, r) + }) == -1 +} + +// From the spec, "Identifiers MUST comprise only +// ASCII alphanumerics and hyphen [0-9A-Za-z-]. Identifiers MUST NOT be empty. +// Numeric identifiers MUST NOT include leading zeroes.". These segments can +// be dot separated. +func validatePrerelease(p string) error { + eparts := strings.Split(p, ".") + for _, p := range eparts { + if containsOnly(p, num) { + if len(p) > 1 && p[0] == '0' { + return ErrSegmentStartsZero + } + } else if !containsOnly(p, allowed) { + return ErrInvalidPrerelease + } + } + + return nil +} + +// From the spec, "Build metadata MAY be denoted by +// appending a plus sign and a series of dot separated identifiers immediately +// following the patch or pre-release version. Identifiers MUST comprise only +// ASCII alphanumerics and hyphen [0-9A-Za-z-]. Identifiers MUST NOT be empty." +func validateMetadata(m string) error { + eparts := strings.Split(m, ".") + for _, p := range eparts { + if !containsOnly(p, allowed) { + return ErrInvalidMetadata + } + } + return nil +} diff --git a/vendor/github.com/Masterminds/semver/version_fuzz.go b/vendor/github.com/Masterminds/semver/version_fuzz.go deleted file mode 100644 index b42bcd6..0000000 --- a/vendor/github.com/Masterminds/semver/version_fuzz.go +++ /dev/null @@ -1,10 +0,0 @@ -// +build gofuzz - -package semver - -func Fuzz(data []byte) int { - if _, err := NewVersion(string(data)); err != nil { - return 0 - } - return 1 -} diff --git a/vendor/github.com/Masterminds/sprig/.travis.yml b/vendor/github.com/Masterminds/sprig/.travis.yml deleted file mode 100644 index b9da8b8..0000000 --- a/vendor/github.com/Masterminds/sprig/.travis.yml +++ /dev/null @@ -1,26 +0,0 @@ -language: go - -go: - - 1.9.x - - 1.10.x - - 1.11.x - - 1.12.x - - 1.13.x - - tip - -# Setting sudo access to false will let Travis CI use containers rather than -# VMs to run the tests. For more details see: -# - http://docs.travis-ci.com/user/workers/container-based-infrastructure/ -# - http://docs.travis-ci.com/user/workers/standard-infrastructure/ -sudo: false - -script: - - make setup test - -notifications: - webhooks: - urls: - - https://webhooks.gitter.im/e/06e3328629952dabe3e0 - on_success: change # options: [always|never|change] default: always - on_failure: always # options: [always|never|change] default: always - on_start: never # options: [always|never|change] default: always diff --git a/vendor/github.com/Masterminds/sprig/Makefile b/vendor/github.com/Masterminds/sprig/Makefile deleted file mode 100644 index 63a93fd..0000000 --- a/vendor/github.com/Masterminds/sprig/Makefile +++ /dev/null @@ -1,13 +0,0 @@ - -HAS_GLIDE := $(shell command -v glide;) - -.PHONY: test -test: - go test -v . - -.PHONY: setup -setup: -ifndef HAS_GLIDE - go get -u github.com/Masterminds/glide -endif - glide install diff --git a/vendor/github.com/Masterminds/sprig/appveyor.yml b/vendor/github.com/Masterminds/sprig/appveyor.yml deleted file mode 100644 index d545a98..0000000 --- a/vendor/github.com/Masterminds/sprig/appveyor.yml +++ /dev/null @@ -1,26 +0,0 @@ - -version: build-{build}.{branch} - -clone_folder: C:\gopath\src\github.com\Masterminds\sprig -shallow_clone: true - -environment: - GOPATH: C:\gopath - -platform: - - x64 - -install: - - go get -u github.com/Masterminds/glide - - set PATH=%GOPATH%\bin;%PATH% - - go version - - go env - -build_script: - - glide install - - go install ./... - -test_script: - - go test -v - -deploy: off diff --git a/vendor/github.com/Masterminds/sprig/glide.yaml b/vendor/github.com/Masterminds/sprig/glide.yaml deleted file mode 100644 index f317d2b..0000000 --- a/vendor/github.com/Masterminds/sprig/glide.yaml +++ /dev/null @@ -1,19 +0,0 @@ -package: github.com/Masterminds/sprig -import: -- package: github.com/Masterminds/goutils - version: ^1.0.0 -- package: github.com/google/uuid - version: ^1.0.0 -- package: golang.org/x/crypto - subpackages: - - scrypt -- package: github.com/Masterminds/semver - version: ^v1.2.2 -- package: github.com/stretchr/testify - version: ^v1.2.2 -- package: github.com/imdario/mergo - version: ~0.3.7 -- package: github.com/huandu/xstrings - version: ^1.2 -- package: github.com/mitchellh/copystructure - version: ^1.0.0 diff --git a/vendor/github.com/Masterminds/sprig/numeric.go b/vendor/github.com/Masterminds/sprig/numeric.go deleted file mode 100644 index f4af4af..0000000 --- a/vendor/github.com/Masterminds/sprig/numeric.go +++ /dev/null @@ -1,169 +0,0 @@ -package sprig - -import ( - "fmt" - "math" - "reflect" - "strconv" -) - -// toFloat64 converts 64-bit floats -func toFloat64(v interface{}) float64 { - if str, ok := v.(string); ok { - iv, err := strconv.ParseFloat(str, 64) - if err != nil { - return 0 - } - return iv - } - - val := reflect.Indirect(reflect.ValueOf(v)) - switch val.Kind() { - case reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64, reflect.Int: - return float64(val.Int()) - case reflect.Uint8, reflect.Uint16, reflect.Uint32: - return float64(val.Uint()) - case reflect.Uint, reflect.Uint64: - return float64(val.Uint()) - case reflect.Float32, reflect.Float64: - return val.Float() - case reflect.Bool: - if val.Bool() == true { - return 1 - } - return 0 - default: - return 0 - } -} - -func toInt(v interface{}) int { - //It's not optimal. Bud I don't want duplicate toInt64 code. - return int(toInt64(v)) -} - -// toInt64 converts integer types to 64-bit integers -func toInt64(v interface{}) int64 { - if str, ok := v.(string); ok { - iv, err := strconv.ParseInt(str, 10, 64) - if err != nil { - return 0 - } - return iv - } - - val := reflect.Indirect(reflect.ValueOf(v)) - switch val.Kind() { - case reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64, reflect.Int: - return val.Int() - case reflect.Uint8, reflect.Uint16, reflect.Uint32: - return int64(val.Uint()) - case reflect.Uint, reflect.Uint64: - tv := val.Uint() - if tv <= math.MaxInt64 { - return int64(tv) - } - // TODO: What is the sensible thing to do here? - return math.MaxInt64 - case reflect.Float32, reflect.Float64: - return int64(val.Float()) - case reflect.Bool: - if val.Bool() == true { - return 1 - } - return 0 - default: - return 0 - } -} - -func max(a interface{}, i ...interface{}) int64 { - aa := toInt64(a) - for _, b := range i { - bb := toInt64(b) - if bb > aa { - aa = bb - } - } - return aa -} - -func min(a interface{}, i ...interface{}) int64 { - aa := toInt64(a) - for _, b := range i { - bb := toInt64(b) - if bb < aa { - aa = bb - } - } - return aa -} - -func until(count int) []int { - step := 1 - if count < 0 { - step = -1 - } - return untilStep(0, count, step) -} - -func untilStep(start, stop, step int) []int { - v := []int{} - - if stop < start { - if step >= 0 { - return v - } - for i := start; i > stop; i += step { - v = append(v, i) - } - return v - } - - if step <= 0 { - return v - } - for i := start; i < stop; i += step { - v = append(v, i) - } - return v -} - -func floor(a interface{}) float64 { - aa := toFloat64(a) - return math.Floor(aa) -} - -func ceil(a interface{}) float64 { - aa := toFloat64(a) - return math.Ceil(aa) -} - -func round(a interface{}, p int, r_opt ...float64) float64 { - roundOn := .5 - if len(r_opt) > 0 { - roundOn = r_opt[0] - } - val := toFloat64(a) - places := toFloat64(p) - - var round float64 - pow := math.Pow(10, places) - digit := pow * val - _, div := math.Modf(digit) - if div >= roundOn { - round = math.Ceil(digit) - } else { - round = math.Floor(digit) - } - return round / pow -} - -// converts unix octal to decimal -func toDecimal(v interface{}) int64 { - result, err := strconv.ParseInt(fmt.Sprint(v), 8, 64) - if err != nil { - return 0 - } - return result -} diff --git a/vendor/github.com/Masterminds/sprig/regex.go b/vendor/github.com/Masterminds/sprig/regex.go deleted file mode 100644 index 2016f66..0000000 --- a/vendor/github.com/Masterminds/sprig/regex.go +++ /dev/null @@ -1,35 +0,0 @@ -package sprig - -import ( - "regexp" -) - -func regexMatch(regex string, s string) bool { - match, _ := regexp.MatchString(regex, s) - return match -} - -func regexFindAll(regex string, s string, n int) []string { - r := regexp.MustCompile(regex) - return r.FindAllString(s, n) -} - -func regexFind(regex string, s string) string { - r := regexp.MustCompile(regex) - return r.FindString(s) -} - -func regexReplaceAll(regex string, s string, repl string) string { - r := regexp.MustCompile(regex) - return r.ReplaceAllString(s, repl) -} - -func regexReplaceAllLiteral(regex string, s string, repl string) string { - r := regexp.MustCompile(regex) - return r.ReplaceAllLiteralString(s, repl) -} - -func regexSplit(regex string, s string, n int) []string { - r := regexp.MustCompile(regex) - return r.Split(s, n) -} diff --git a/vendor/github.com/Masterminds/sprig/.gitignore b/vendor/github.com/Masterminds/sprig/v3/.gitignore similarity index 100% rename from vendor/github.com/Masterminds/sprig/.gitignore rename to vendor/github.com/Masterminds/sprig/v3/.gitignore diff --git a/vendor/github.com/Masterminds/sprig/CHANGELOG.md b/vendor/github.com/Masterminds/sprig/v3/CHANGELOG.md similarity index 76% rename from vendor/github.com/Masterminds/sprig/CHANGELOG.md rename to vendor/github.com/Masterminds/sprig/v3/CHANGELOG.md index 6a79fbd..fcdd4e8 100644 --- a/vendor/github.com/Masterminds/sprig/CHANGELOG.md +++ b/vendor/github.com/Masterminds/sprig/v3/CHANGELOG.md @@ -1,5 +1,93 @@ # Changelog +## Release 3.2.1 (2021-02-04) + +### Changed + +- Upgraded `Masterminds/goutils` to `v1.1.1`. see the [Security Advisory](https://github.com/Masterminds/goutils/security/advisories/GHSA-xg2h-wx96-xgxr) + +## Release 3.2.0 (2020-12-14) + +### Added + +- #211: Added randInt function (thanks @kochurovro) +- #223: Added fromJson and mustFromJson functions (thanks @mholt) +- #242: Added a bcrypt function (thanks @robbiet480) +- #253: Added randBytes function (thanks @MikaelSmith) +- #254: Added dig function for dicts (thanks @nyarly) +- #257: Added regexQuoteMeta for quoting regex metadata (thanks @rheaton) +- #261: Added filepath functions osBase, osDir, osExt, osClean, osIsAbs (thanks @zugl) +- #268: Added and and all functions for testing conditions (thanks @phuslu) +- #181: Added float64 arithmetic addf, add1f, subf, divf, mulf, maxf, and minf + (thanks @andrewmostello) +- #265: Added chunk function to split array into smaller arrays (thanks @karelbilek) +- #270: Extend certificate functions to handle non-RSA keys + add support for + ed25519 keys (thanks @misberner) + +### Changed + +- Removed testing and support for Go 1.12. ed25519 support requires Go 1.13 or newer +- Using semver 3.1.1 and mergo 0.3.11 + +### Fixed + +- #249: Fix htmlDateInZone example (thanks @spawnia) + +NOTE: The dependency github.com/imdario/mergo reverted the breaking change in +0.3.9 via 0.3.10 release. + +## Release 3.1.0 (2020-04-16) + +NOTE: The dependency github.com/imdario/mergo made a behavior change in 0.3.9 +that impacts sprig functionality. Do not use sprig with a version newer than 0.3.8. + +### Added + +- #225: Added support for generating htpasswd hash (thanks @rustycl0ck) +- #224: Added duration filter (thanks @frebib) +- #205: Added `seq` function (thanks @thadc23) + +### Changed + +- #203: Unlambda functions with correct signature (thanks @muesli) +- #236: Updated the license formatting for GitHub display purposes +- #238: Updated package dependency versions. Note, mergo not updated to 0.3.9 + as it causes a breaking change for sprig. That issue is tracked at + https://github.com/imdario/mergo/issues/139 + +### Fixed + +- #229: Fix `seq` example in docs (thanks @kalmant) + +## Release 3.0.2 (2019-12-13) + +### Fixed + +- #220: Updating to semver v3.0.3 to fix issue with <= ranges +- #218: fix typo elyptical->elliptic in ecdsa key description (thanks @laverya) + +## Release 3.0.1 (2019-12-08) + +### Fixed + +- #212: Updated semver fixing broken constraint checking with ^0.0 + +## Release 3.0.0 (2019-10-02) + +### Added + +- #187: Added durationRound function (thanks @yjp20) +- #189: Added numerous template functions that return errors rather than panic (thanks @nrvnrvn) +- #193: Added toRawJson support (thanks @Dean-Coakley) +- #197: Added get support to dicts (thanks @Dean-Coakley) + +### Changed + +- #186: Moving dependency management to Go modules +- #186: Updated semver to v3. This has changes in the way ^ is handled +- #194: Updated documentation on merging and how it copies. Added example using deepCopy +- #196: trunc now supports negative values (thanks @Dean-Coakley) + ## Release 2.22.0 (2019-10-02) ### Added diff --git a/vendor/github.com/Masterminds/sprig/LICENSE.txt b/vendor/github.com/Masterminds/sprig/v3/LICENSE.txt similarity index 96% rename from vendor/github.com/Masterminds/sprig/LICENSE.txt rename to vendor/github.com/Masterminds/sprig/v3/LICENSE.txt index 5c95acc..f311b1e 100644 --- a/vendor/github.com/Masterminds/sprig/LICENSE.txt +++ b/vendor/github.com/Masterminds/sprig/v3/LICENSE.txt @@ -1,5 +1,4 @@ -Sprig -Copyright (C) 2013 Masterminds +Copyright (C) 2013-2020 Masterminds Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the "Software"), to deal diff --git a/vendor/github.com/Masterminds/sprig/v3/Makefile b/vendor/github.com/Masterminds/sprig/v3/Makefile new file mode 100644 index 0000000..78d409c --- /dev/null +++ b/vendor/github.com/Masterminds/sprig/v3/Makefile @@ -0,0 +1,9 @@ +.PHONY: test +test: + @echo "==> Running tests" + GO111MODULE=on go test -v + +.PHONY: test-cover +test-cover: + @echo "==> Running Tests with coverage" + GO111MODULE=on go test -cover . diff --git a/vendor/github.com/Masterminds/sprig/README.md b/vendor/github.com/Masterminds/sprig/v3/README.md similarity index 65% rename from vendor/github.com/Masterminds/sprig/README.md rename to vendor/github.com/Masterminds/sprig/v3/README.md index b705695..c37ba01 100644 --- a/vendor/github.com/Masterminds/sprig/README.md +++ b/vendor/github.com/Masterminds/sprig/v3/README.md @@ -1,6 +1,9 @@ # Sprig: Template functions for Go templates + +[![GoDoc](https://img.shields.io/static/v1?label=godoc&message=reference&color=blue)](https://pkg.go.dev/github.com/Masterminds/sprig/v3) +[![Go Report Card](https://goreportcard.com/badge/github.com/Masterminds/sprig)](https://goreportcard.com/report/github.com/Masterminds/sprig) [![Stability: Sustained](https://masterminds.github.io/stability/sustained.svg)](https://masterminds.github.io/stability/sustained.html) -[![Build Status](https://travis-ci.org/Masterminds/sprig.svg?branch=master)](https://travis-ci.org/Masterminds/sprig) +[![](https://github.com/Masterminds/sprig/workflows/Tests/badge.svg)](https://github.com/Masterminds/sprig/actions) The Go language comes with a [built-in template language](http://golang.org/pkg/text/template/), but not @@ -11,6 +14,26 @@ It is inspired by the template functions found in [Twig](http://twig.sensiolabs.org/documentation) and in various JavaScript libraries, such as [underscore.js](http://underscorejs.org/). +## IMPORTANT NOTES + +Sprig leverages [mergo](https://github.com/imdario/mergo) to handle merges. In +its v0.3.9 release there was a behavior change that impacts merging template +functions in sprig. It is currently recommended to use v0.3.8 of that package. +Using v0.3.9 will cause sprig tests to fail. The issue in mergo is tracked at +https://github.com/imdario/mergo/issues/139. + +## Package Versions + +There are two active major versions of the `sprig` package. + +* v3 is currently stable release series on the `master` branch. The Go API should + remain compatible with v2, the current stable version. Behavior change behind + some functions is the reason for the new major version. +* v2 is the previous stable release series. It has been more than three years since + the initial release of v2. You can read the documentation and see the code + on the [release-2](https://github.com/Masterminds/sprig/tree/release-2) branch. + Bug fixes to this major version will continue for some time. + ## Usage **Template developers**: Please use Sprig's [function documentation](http://masterminds.github.io/sprig/) for diff --git a/vendor/github.com/Masterminds/sprig/crypto.go b/vendor/github.com/Masterminds/sprig/v3/crypto.go similarity index 65% rename from vendor/github.com/Masterminds/sprig/crypto.go rename to vendor/github.com/Masterminds/sprig/v3/crypto.go index 7a418ba..13a5cd5 100644 --- a/vendor/github.com/Masterminds/sprig/crypto.go +++ b/vendor/github.com/Masterminds/sprig/v3/crypto.go @@ -2,10 +2,12 @@ package sprig import ( "bytes" + "crypto" "crypto/aes" "crypto/cipher" "crypto/dsa" "crypto/ecdsa" + "crypto/ed25519" "crypto/elliptic" "crypto/hmac" "crypto/rand" @@ -21,13 +23,16 @@ import ( "encoding/pem" "errors" "fmt" - "io" "hash/adler32" + "io" "math/big" "net" "time" + "strings" + "github.com/google/uuid" + bcrypt_lib "golang.org/x/crypto/bcrypt" "golang.org/x/crypto/scrypt" ) @@ -46,14 +51,38 @@ func adler32sum(input string) string { return fmt.Sprintf("%d", hash) } +func bcrypt(input string) string { + hash, err := bcrypt_lib.GenerateFromPassword([]byte(input), bcrypt_lib.DefaultCost) + if err != nil { + return fmt.Sprintf("failed to encrypt string with bcrypt: %s", err) + } + + return string(hash) +} + +func htpasswd(username string, password string) string { + if strings.Contains(username, ":") { + return fmt.Sprintf("invalid username: %s", username) + } + return fmt.Sprintf("%s:%s", username, bcrypt(password)) +} + +func randBytes(count int) (string, error) { + buf := make([]byte, count) + if _, err := rand.Read(buf); err != nil { + return "", err + } + return base64.StdEncoding.EncodeToString(buf), nil +} + // uuidv4 provides a safe and secure UUID v4 implementation func uuidv4() string { - return fmt.Sprintf("%s", uuid.New()) + return uuid.New().String() } -var master_password_seed = "com.lyndir.masterpassword" +var masterPasswordSeed = "com.lyndir.masterpassword" -var password_type_templates = map[string][][]byte{ +var passwordTypeTemplates = map[string][][]byte{ "maximum": {[]byte("anoxxxxxxxxxxxxxxxxx"), []byte("axxxxxxxxxxxxxxxxxno")}, "long": {[]byte("CvcvnoCvcvCvcv"), []byte("CvcvCvcvnoCvcv"), []byte("CvcvCvcvCvcvno"), []byte("CvccnoCvcvCvcv"), []byte("CvccCvcvnoCvcv"), []byte("CvccCvcvCvcvno"), []byte("CvcvnoCvccCvcv"), []byte("CvcvCvccnoCvcv"), []byte("CvcvCvccCvcvno"), []byte("CvcvnoCvcvCvcc"), @@ -66,7 +95,7 @@ var password_type_templates = map[string][][]byte{ "pin": {[]byte("nnnn")}, } -var template_characters = map[byte]string{ +var templateCharacters = map[byte]string{ 'V': "AEIOU", 'C': "BCDFGHJKLMNPQRSTVWXYZ", 'v': "aeiou", @@ -78,14 +107,14 @@ var template_characters = map[byte]string{ 'x': "AEIOUaeiouBCDFGHJKLMNPQRSTVWXYZbcdfghjklmnpqrstvwxyz0123456789!@#$%^&*()", } -func derivePassword(counter uint32, password_type, password, user, site string) string { - var templates = password_type_templates[password_type] +func derivePassword(counter uint32, passwordType, password, user, site string) string { + var templates = passwordTypeTemplates[passwordType] if templates == nil { - return fmt.Sprintf("cannot find password template %s", password_type) + return fmt.Sprintf("cannot find password template %s", passwordType) } var buffer bytes.Buffer - buffer.WriteString(master_password_seed) + buffer.WriteString(masterPasswordSeed) binary.Write(&buffer, binary.BigEndian, uint32(len(user))) buffer.WriteString(user) @@ -95,7 +124,7 @@ func derivePassword(counter uint32, password_type, password, user, site string) return fmt.Sprintf("failed to derive password: %s", err) } - buffer.Truncate(len(master_password_seed)) + buffer.Truncate(len(masterPasswordSeed)) binary.Write(&buffer, binary.BigEndian, uint32(len(site))) buffer.WriteString(site) binary.Write(&buffer, binary.BigEndian, counter) @@ -107,9 +136,9 @@ func derivePassword(counter uint32, password_type, password, user, site string) buffer.Truncate(0) for i, element := range temp { - pass_chars := template_characters[element] - pass_char := pass_chars[int(seed[i+1])%len(pass_chars)] - buffer.WriteByte(pass_char) + passChars := templateCharacters[element] + passChar := passChars[int(seed[i+1])%len(passChars)] + buffer.WriteByte(passChar) } return buffer.String() @@ -133,6 +162,8 @@ func generatePrivateKey(typ string) string { case "ecdsa": // again, good enough for government work priv, err = ecdsa.GenerateKey(elliptic.P256(), rand.Reader) + case "ed25519": + _, priv, err = ed25519.GenerateKey(rand.Reader) default: return "Unknown type " + typ } @@ -143,6 +174,8 @@ func generatePrivateKey(typ string) string { return string(pem.EncodeToMemory(pemBlockForKey(priv))) } +// DSAKeyFormat stores the format for DSA keys. +// Used by pemBlockForKey type DSAKeyFormat struct { Version int P, Q, G, Y, X *big.Int @@ -163,7 +196,73 @@ func pemBlockForKey(priv interface{}) *pem.Block { b, _ := x509.MarshalECPrivateKey(k) return &pem.Block{Type: "EC PRIVATE KEY", Bytes: b} default: - return nil + // attempt PKCS#8 format for all other keys + b, err := x509.MarshalPKCS8PrivateKey(k) + if err != nil { + return nil + } + return &pem.Block{Type: "PRIVATE KEY", Bytes: b} + } +} + +func parsePrivateKeyPEM(pemBlock string) (crypto.PrivateKey, error) { + block, _ := pem.Decode([]byte(pemBlock)) + if block == nil { + return nil, errors.New("no PEM data in input") + } + + if block.Type == "PRIVATE KEY" { + priv, err := x509.ParsePKCS8PrivateKey(block.Bytes) + if err != nil { + return nil, fmt.Errorf("decoding PEM as PKCS#8: %s", err) + } + return priv, nil + } else if !strings.HasSuffix(block.Type, " PRIVATE KEY") { + return nil, fmt.Errorf("no private key data in PEM block of type %s", block.Type) + } + + switch block.Type[:len(block.Type)-12] { // strip " PRIVATE KEY" + case "RSA": + priv, err := x509.ParsePKCS1PrivateKey(block.Bytes) + if err != nil { + return nil, fmt.Errorf("parsing RSA private key from PEM: %s", err) + } + return priv, nil + case "EC": + priv, err := x509.ParseECPrivateKey(block.Bytes) + if err != nil { + return nil, fmt.Errorf("parsing EC private key from PEM: %s", err) + } + return priv, nil + case "DSA": + var k DSAKeyFormat + _, err := asn1.Unmarshal(block.Bytes, &k) + if err != nil { + return nil, fmt.Errorf("parsing DSA private key from PEM: %s", err) + } + priv := &dsa.PrivateKey{ + PublicKey: dsa.PublicKey{ + Parameters: dsa.Parameters{ + P: k.P, Q: k.Q, G: k.G, + }, + Y: k.Y, + }, + X: k.X, + } + return priv, nil + default: + return nil, fmt.Errorf("invalid private key type %s", block.Type) + } +} + +func getPublicKey(priv crypto.PrivateKey) (crypto.PublicKey, error) { + switch k := priv.(type) { + case interface{ Public() crypto.PublicKey }: + return k.Public(), nil + case *dsa.PrivateKey: + return &k.PublicKey, nil + default: + return nil, fmt.Errorf("unable to get public key for type %T", priv) } } @@ -197,14 +296,10 @@ func buildCustomCertificate(b64cert string, b64key string) (certificate, error) ) } - decodedKey, _ := pem.Decode(key) - if decodedKey == nil { - return crt, errors.New("unable to decode key") - } - _, err = x509.ParsePKCS1PrivateKey(decodedKey.Bytes) + _, err = parsePrivateKeyPEM(string(key)) if err != nil { return crt, fmt.Errorf( - "error parsing prive key: decodedKey.Bytes: %s", + "error parsing private key: %s", err, ) } @@ -218,6 +313,31 @@ func buildCustomCertificate(b64cert string, b64key string) (certificate, error) func generateCertificateAuthority( cn string, daysValid int, +) (certificate, error) { + priv, err := rsa.GenerateKey(rand.Reader, 2048) + if err != nil { + return certificate{}, fmt.Errorf("error generating rsa key: %s", err) + } + + return generateCertificateAuthorityWithKeyInternal(cn, daysValid, priv) +} + +func generateCertificateAuthorityWithPEMKey( + cn string, + daysValid int, + privPEM string, +) (certificate, error) { + priv, err := parsePrivateKeyPEM(privPEM) + if err != nil { + return certificate{}, fmt.Errorf("parsing private key: %s", err) + } + return generateCertificateAuthorityWithKeyInternal(cn, daysValid, priv) +} + +func generateCertificateAuthorityWithKeyInternal( + cn string, + daysValid int, + priv crypto.PrivateKey, ) (certificate, error) { ca := certificate{} @@ -231,24 +351,44 @@ func generateCertificateAuthority( x509.KeyUsageCertSign template.IsCA = true + ca.Cert, ca.Key, err = getCertAndKey(template, priv, template, priv) + + return ca, err +} + +func generateSelfSignedCertificate( + cn string, + ips []interface{}, + alternateDNS []interface{}, + daysValid int, +) (certificate, error) { priv, err := rsa.GenerateKey(rand.Reader, 2048) if err != nil { - return ca, fmt.Errorf("error generating rsa key: %s", err) + return certificate{}, fmt.Errorf("error generating rsa key: %s", err) } + return generateSelfSignedCertificateWithKeyInternal(cn, ips, alternateDNS, daysValid, priv) +} - ca.Cert, ca.Key, err = getCertAndKey(template, priv, template, priv) +func generateSelfSignedCertificateWithPEMKey( + cn string, + ips []interface{}, + alternateDNS []interface{}, + daysValid int, + privPEM string, +) (certificate, error) { + priv, err := parsePrivateKeyPEM(privPEM) if err != nil { - return ca, err + return certificate{}, fmt.Errorf("parsing private key: %s", err) } - - return ca, nil + return generateSelfSignedCertificateWithKeyInternal(cn, ips, alternateDNS, daysValid, priv) } -func generateSelfSignedCertificate( +func generateSelfSignedCertificateWithKeyInternal( cn string, ips []interface{}, alternateDNS []interface{}, daysValid int, + priv crypto.PrivateKey, ) (certificate, error) { cert := certificate{} @@ -257,25 +397,47 @@ func generateSelfSignedCertificate( return cert, err } + cert.Cert, cert.Key, err = getCertAndKey(template, priv, template, priv) + + return cert, err +} + +func generateSignedCertificate( + cn string, + ips []interface{}, + alternateDNS []interface{}, + daysValid int, + ca certificate, +) (certificate, error) { priv, err := rsa.GenerateKey(rand.Reader, 2048) if err != nil { - return cert, fmt.Errorf("error generating rsa key: %s", err) + return certificate{}, fmt.Errorf("error generating rsa key: %s", err) } + return generateSignedCertificateWithKeyInternal(cn, ips, alternateDNS, daysValid, ca, priv) +} - cert.Cert, cert.Key, err = getCertAndKey(template, priv, template, priv) +func generateSignedCertificateWithPEMKey( + cn string, + ips []interface{}, + alternateDNS []interface{}, + daysValid int, + ca certificate, + privPEM string, +) (certificate, error) { + priv, err := parsePrivateKeyPEM(privPEM) if err != nil { - return cert, err + return certificate{}, fmt.Errorf("parsing private key: %s", err) } - - return cert, nil + return generateSignedCertificateWithKeyInternal(cn, ips, alternateDNS, daysValid, ca, priv) } -func generateSignedCertificate( +func generateSignedCertificateWithKeyInternal( cn string, ips []interface{}, alternateDNS []interface{}, daysValid int, ca certificate, + priv crypto.PrivateKey, ) (certificate, error) { cert := certificate{} @@ -290,14 +452,10 @@ func generateSignedCertificate( err, ) } - decodedSignerKey, _ := pem.Decode([]byte(ca.Key)) - if decodedSignerKey == nil { - return cert, errors.New("unable to decode key") - } - signerKey, err := x509.ParsePKCS1PrivateKey(decodedSignerKey.Bytes) + signerKey, err := parsePrivateKeyPEM(ca.Key) if err != nil { return cert, fmt.Errorf( - "error parsing prive key: decodedSignerKey.Bytes: %s", + "error parsing private key: %s", err, ) } @@ -307,35 +465,31 @@ func generateSignedCertificate( return cert, err } - priv, err := rsa.GenerateKey(rand.Reader, 2048) - if err != nil { - return cert, fmt.Errorf("error generating rsa key: %s", err) - } - cert.Cert, cert.Key, err = getCertAndKey( template, priv, signerCert, signerKey, ) - if err != nil { - return cert, err - } - return cert, nil + return cert, err } func getCertAndKey( template *x509.Certificate, - signeeKey *rsa.PrivateKey, + signeeKey crypto.PrivateKey, parent *x509.Certificate, - signingKey *rsa.PrivateKey, + signingKey crypto.PrivateKey, ) (string, string, error) { + signeePubKey, err := getPublicKey(signeeKey) + if err != nil { + return "", "", fmt.Errorf("error retrieving public key from signee key: %s", err) + } derBytes, err := x509.CreateCertificate( rand.Reader, template, parent, - &signeeKey.PublicKey, + signeePubKey, signingKey, ) if err != nil { @@ -353,15 +507,12 @@ func getCertAndKey( keyBuffer := bytes.Buffer{} if err := pem.Encode( &keyBuffer, - &pem.Block{ - Type: "RSA PRIVATE KEY", - Bytes: x509.MarshalPKCS1PrivateKey(signeeKey), - }, + pemBlockForKey(signeeKey), ); err != nil { return "", "", fmt.Errorf("error pem-encoding key: %s", err) } - return string(certBuffer.Bytes()), string(keyBuffer.Bytes()), nil + return certBuffer.String(), keyBuffer.String(), nil } func getBaseCertTemplate( diff --git a/vendor/github.com/Masterminds/sprig/date.go b/vendor/github.com/Masterminds/sprig/v3/date.go similarity index 52% rename from vendor/github.com/Masterminds/sprig/date.go rename to vendor/github.com/Masterminds/sprig/v3/date.go index d1d6155..ed022dd 100644 --- a/vendor/github.com/Masterminds/sprig/date.go +++ b/vendor/github.com/Masterminds/sprig/v3/date.go @@ -55,6 +55,14 @@ func dateModify(fmt string, date time.Time) time.Time { return date.Add(d) } +func mustDateModify(fmt string, date time.Time) (time.Time, error) { + d, err := time.ParseDuration(fmt) + if err != nil { + return time.Time{}, err + } + return date.Add(d), nil +} + func dateAgo(date interface{}) string { var t time.Time @@ -73,11 +81,72 @@ func dateAgo(date interface{}) string { return duration.String() } +func duration(sec interface{}) string { + var n int64 + switch value := sec.(type) { + default: + n = 0 + case string: + n, _ = strconv.ParseInt(value, 10, 64) + case int64: + n = value + } + return (time.Duration(n) * time.Second).String() +} + +func durationRound(duration interface{}) string { + var d time.Duration + switch duration := duration.(type) { + default: + d = 0 + case string: + d, _ = time.ParseDuration(duration) + case int64: + d = time.Duration(duration) + case time.Time: + d = time.Since(duration) + } + + u := uint64(d) + neg := d < 0 + if neg { + u = -u + } + + var ( + year = uint64(time.Hour) * 24 * 365 + month = uint64(time.Hour) * 24 * 30 + day = uint64(time.Hour) * 24 + hour = uint64(time.Hour) + minute = uint64(time.Minute) + second = uint64(time.Second) + ) + switch { + case u > year: + return strconv.FormatUint(u/year, 10) + "y" + case u > month: + return strconv.FormatUint(u/month, 10) + "mo" + case u > day: + return strconv.FormatUint(u/day, 10) + "d" + case u > hour: + return strconv.FormatUint(u/hour, 10) + "h" + case u > minute: + return strconv.FormatUint(u/minute, 10) + "m" + case u > second: + return strconv.FormatUint(u/second, 10) + "s" + } + return "0s" +} + func toDate(fmt, str string) time.Time { t, _ := time.ParseInLocation(fmt, str, time.Local) return t } +func mustToDate(fmt, str string) (time.Time, error) { + return time.ParseInLocation(fmt, str, time.Local) +} + func unixEpoch(date time.Time) string { return strconv.FormatInt(date.Unix(), 10) } diff --git a/vendor/github.com/Masterminds/sprig/defaults.go b/vendor/github.com/Masterminds/sprig/v3/defaults.go similarity index 53% rename from vendor/github.com/Masterminds/sprig/defaults.go rename to vendor/github.com/Masterminds/sprig/v3/defaults.go index ed6a8ab..b9f9796 100644 --- a/vendor/github.com/Masterminds/sprig/defaults.go +++ b/vendor/github.com/Masterminds/sprig/v3/defaults.go @@ -1,10 +1,18 @@ package sprig import ( + "bytes" "encoding/json" + "math/rand" "reflect" + "strings" + "time" ) +func init() { + rand.Seed(time.Now().UnixNano()) +} + // dfault checks whether `given` is set, and returns default if not set. // // This returns `d` if `given` appears not to be set, and `given` otherwise. @@ -37,7 +45,7 @@ func empty(given interface{}) bool { case reflect.Array, reflect.Slice, reflect.Map, reflect.String: return g.Len() == 0 case reflect.Bool: - return g.Bool() == false + return !g.Bool() case reflect.Complex64, reflect.Complex128: return g.Complex() == 0 case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: @@ -61,18 +69,90 @@ func coalesce(v ...interface{}) interface{} { return nil } +// all returns true if empty(x) is false for all values x in the list. +// If the list is empty, return true. +func all(v ...interface{}) bool { + for _, val := range v { + if empty(val) { + return false + } + } + return true +} + +// any returns true if empty(x) is false for any x in the list. +// If the list is empty, return false. +func any(v ...interface{}) bool { + for _, val := range v { + if !empty(val) { + return true + } + } + return false +} + +// fromJson decodes JSON into a structured value, ignoring errors. +func fromJson(v string) interface{} { + output, _ := mustFromJson(v) + return output +} + +// mustFromJson decodes JSON into a structured value, returning errors. +func mustFromJson(v string) (interface{}, error) { + var output interface{} + err := json.Unmarshal([]byte(v), &output) + return output, err +} + // toJson encodes an item into a JSON string func toJson(v interface{}) string { output, _ := json.Marshal(v) return string(output) } +func mustToJson(v interface{}) (string, error) { + output, err := json.Marshal(v) + if err != nil { + return "", err + } + return string(output), nil +} + // toPrettyJson encodes an item into a pretty (indented) JSON string func toPrettyJson(v interface{}) string { output, _ := json.MarshalIndent(v, "", " ") return string(output) } +func mustToPrettyJson(v interface{}) (string, error) { + output, err := json.MarshalIndent(v, "", " ") + if err != nil { + return "", err + } + return string(output), nil +} + +// toRawJson encodes an item into a JSON string with no escaping of HTML characters. +func toRawJson(v interface{}) string { + output, err := mustToRawJson(v) + if err != nil { + panic(err) + } + return string(output) +} + +// mustToRawJson encodes an item into a JSON string with no escaping of HTML characters. +func mustToRawJson(v interface{}) (string, error) { + buf := new(bytes.Buffer) + enc := json.NewEncoder(buf) + enc.SetEscapeHTML(false) + err := enc.Encode(&v) + if err != nil { + return "", err + } + return strings.TrimSuffix(buf.String(), "\n"), nil +} + // ternary returns the first value if the last value is true, otherwise returns the second value. func ternary(vt interface{}, vf interface{}, v bool) interface{} { if v { diff --git a/vendor/github.com/Masterminds/sprig/dict.go b/vendor/github.com/Masterminds/sprig/v3/dict.go similarity index 63% rename from vendor/github.com/Masterminds/sprig/dict.go rename to vendor/github.com/Masterminds/sprig/v3/dict.go index 738405b..ade8896 100644 --- a/vendor/github.com/Masterminds/sprig/dict.go +++ b/vendor/github.com/Masterminds/sprig/v3/dict.go @@ -5,6 +5,13 @@ import ( "github.com/mitchellh/copystructure" ) +func get(d map[string]interface{}, key string) interface{} { + if val, ok := d[key]; ok { + return val + } + return "" +} + func set(d map[string]interface{}, key string, value interface{}) map[string]interface{} { d[key] = value return d @@ -90,6 +97,15 @@ func merge(dst map[string]interface{}, srcs ...map[string]interface{}) interface return dst } +func mustMerge(dst map[string]interface{}, srcs ...map[string]interface{}) (interface{}, error) { + for _, src := range srcs { + if err := mergo.Merge(&dst, src); err != nil { + return nil, err + } + } + return dst, nil +} + func mergeOverwrite(dst map[string]interface{}, srcs ...map[string]interface{}) interface{} { for _, src := range srcs { if err := mergo.MergeWithOverwrite(&dst, src); err != nil { @@ -100,6 +116,15 @@ func mergeOverwrite(dst map[string]interface{}, srcs ...map[string]interface{}) return dst } +func mustMergeOverwrite(dst map[string]interface{}, srcs ...map[string]interface{}) (interface{}, error) { + for _, src := range srcs { + if err := mergo.MergeWithOverwrite(&dst, src); err != nil { + return nil, err + } + } + return dst, nil +} + func values(dict map[string]interface{}) []interface{} { values := []interface{}{} for _, value := range dict { @@ -110,10 +135,40 @@ func values(dict map[string]interface{}) []interface{} { } func deepCopy(i interface{}) interface{} { - c, err := copystructure.Copy(i) + c, err := mustDeepCopy(i) if err != nil { panic("deepCopy error: " + err.Error()) } return c } + +func mustDeepCopy(i interface{}) (interface{}, error) { + return copystructure.Copy(i) +} + +func dig(ps ...interface{}) (interface{}, error) { + if len(ps) < 3 { + panic("dig needs at least three arguments") + } + dict := ps[len(ps)-1].(map[string]interface{}) + def := ps[len(ps)-2] + ks := make([]string, len(ps)-2) + for i := 0; i < len(ks); i++ { + ks[i] = ps[i].(string) + } + + return digFromDict(dict, def, ks) +} + +func digFromDict(dict map[string]interface{}, d interface{}, ks []string) (interface{}, error) { + k, ns := ks[0], ks[1:len(ks)] + step, has := dict[k] + if !has { + return d, nil + } + if len(ns) == 0 { + return step, nil + } + return digFromDict(step.(map[string]interface{}), d, ns) +} diff --git a/vendor/github.com/Masterminds/sprig/doc.go b/vendor/github.com/Masterminds/sprig/v3/doc.go similarity index 92% rename from vendor/github.com/Masterminds/sprig/doc.go rename to vendor/github.com/Masterminds/sprig/v3/doc.go index 8f8f1d7..aabb9d4 100644 --- a/vendor/github.com/Masterminds/sprig/doc.go +++ b/vendor/github.com/Masterminds/sprig/v3/doc.go @@ -1,5 +1,5 @@ /* -Sprig: Template functions for Go. +Package sprig provides template functions for Go. This package contains a number of utility functions for working with data inside of Go `html/template` and `text/template` files. diff --git a/vendor/github.com/Masterminds/sprig/functions.go b/vendor/github.com/Masterminds/sprig/v3/functions.go similarity index 58% rename from vendor/github.com/Masterminds/sprig/functions.go rename to vendor/github.com/Masterminds/sprig/v3/functions.go index 7b5b0af..57fcec1 100644 --- a/vendor/github.com/Masterminds/sprig/functions.go +++ b/vendor/github.com/Masterminds/sprig/v3/functions.go @@ -3,8 +3,10 @@ package sprig import ( "errors" "html/template" + "math/rand" "os" "path" + "path/filepath" "reflect" "strconv" "strings" @@ -13,9 +15,10 @@ import ( util "github.com/Masterminds/goutils" "github.com/huandu/xstrings" + "github.com/shopspring/decimal" ) -// Produce the function map. +// FuncMap produces the function map. // // Use this to pass the functions into the template engine: // @@ -63,7 +66,7 @@ func GenericFuncMap() map[string]interface{} { } // These functions are not guaranteed to evaluate to the same result for given input, because they -// refer to the environemnt or global state. +// refer to the environment or global state. var nonhermeticFunctions = []string{ // Date functions "date", @@ -80,6 +83,7 @@ var nonhermeticFunctions = []string{ "randAlpha", "randAscii", "randNumeric", + "randBytes", "uuidv4", // OS @@ -94,17 +98,22 @@ var genericMap = map[string]interface{}{ "hello": func() string { return "Hello!" }, // Date functions - "date": date, - "date_in_zone": dateInZone, - "date_modify": dateModify, - "now": func() time.Time { return time.Now() }, - "htmlDate": htmlDate, - "htmlDateInZone": htmlDateInZone, - "dateInZone": dateInZone, - "dateModify": dateModify, - "ago": dateAgo, - "toDate": toDate, - "unixEpoch": unixEpoch, + "ago": dateAgo, + "date": date, + "date_in_zone": dateInZone, + "date_modify": dateModify, + "dateInZone": dateInZone, + "dateModify": dateModify, + "duration": duration, + "durationRound": durationRound, + "htmlDate": htmlDate, + "htmlDateInZone": htmlDateInZone, + "must_date_modify": mustDateModify, + "mustDateModify": mustDateModify, + "mustToDate": mustToDate, + "now": time.Now, + "toDate": toDate, + "unixEpoch": unixEpoch, // Strings "abbrev": abbrev, @@ -158,6 +167,7 @@ var genericMap = map[string]interface{}{ "int64": toInt64, "int": toInt, "float64": toFloat64, + "seq": seq, "toDecimal": toDecimal, //"gt": func(a, b int) bool {return a > b}, @@ -194,9 +204,28 @@ var genericMap = map[string]interface{}{ } return val }, + "randInt": func(min, max int) int { return rand.Intn(max-min) + min }, + "add1f": func(i interface{}) float64 { + return execDecimalOp(i, []interface{}{1}, func(d1, d2 decimal.Decimal) decimal.Decimal { return d1.Add(d2) }) + }, + "addf": func(i ...interface{}) float64 { + a := interface{}(float64(0)) + return execDecimalOp(a, i, func(d1, d2 decimal.Decimal) decimal.Decimal { return d1.Add(d2) }) + }, + "subf": func(a interface{}, v ...interface{}) float64 { + return execDecimalOp(a, v, func(d1, d2 decimal.Decimal) decimal.Decimal { return d1.Sub(d2) }) + }, + "divf": func(a interface{}, v ...interface{}) float64 { + return execDecimalOp(a, v, func(d1, d2 decimal.Decimal) decimal.Decimal { return d1.Div(d2) }) + }, + "mulf": func(a interface{}, v ...interface{}) float64 { + return execDecimalOp(a, v, func(d1, d2 decimal.Decimal) decimal.Decimal { return d1.Mul(d2) }) + }, "biggest": max, "max": max, "min": min, + "maxf": maxf, + "minf": minf, "ceil": ceil, "floor": floor, "round": round, @@ -207,14 +236,24 @@ var genericMap = map[string]interface{}{ "sortAlpha": sortAlpha, // Defaults - "default": dfault, - "empty": empty, - "coalesce": coalesce, - "compact": compact, - "deepCopy": deepCopy, - "toJson": toJson, - "toPrettyJson": toPrettyJson, - "ternary": ternary, + "default": dfault, + "empty": empty, + "coalesce": coalesce, + "all": all, + "any": any, + "compact": compact, + "mustCompact": mustCompact, + "fromJson": fromJson, + "toJson": toJson, + "toPrettyJson": toPrettyJson, + "toRawJson": toRawJson, + "mustFromJson": mustFromJson, + "mustToJson": mustToJson, + "mustToPrettyJson": mustToPrettyJson, + "mustToRawJson": mustToRawJson, + "ternary": ternary, + "deepCopy": deepCopy, + "mustDeepCopy": mustDeepCopy, // Reflection "typeOf": typeOf, @@ -225,19 +264,26 @@ var genericMap = map[string]interface{}{ "deepEqual": reflect.DeepEqual, // OS: - "env": func(s string) string { return os.Getenv(s) }, - "expandenv": func(s string) string { return os.ExpandEnv(s) }, + "env": os.Getenv, + "expandenv": os.ExpandEnv, // Network: "getHostByName": getHostByName, - // File Paths: + // Paths: "base": path.Base, "dir": path.Dir, "clean": path.Clean, "ext": path.Ext, "isAbs": path.IsAbs, + // Filepaths: + "osBase": filepath.Base, + "osClean": filepath.Clean, + "osDir": filepath.Dir, + "osExt": filepath.Ext, + "osIsAbs": filepath.IsAbs, + // Encoding: "b64enc": base64encode, "b64dec": base64decode, @@ -245,42 +291,65 @@ var genericMap = map[string]interface{}{ "b32dec": base32decode, // Data Structures: - "tuple": list, // FIXME: with the addition of append/prepend these are no longer immutable. - "list": list, - "dict": dict, - "set": set, - "unset": unset, - "hasKey": hasKey, - "pluck": pluck, - "keys": keys, - "pick": pick, - "omit": omit, - "merge": merge, - "mergeOverwrite": mergeOverwrite, - "values": values, + "tuple": list, // FIXME: with the addition of append/prepend these are no longer immutable. + "list": list, + "dict": dict, + "get": get, + "set": set, + "unset": unset, + "hasKey": hasKey, + "pluck": pluck, + "keys": keys, + "pick": pick, + "omit": omit, + "merge": merge, + "mergeOverwrite": mergeOverwrite, + "mustMerge": mustMerge, + "mustMergeOverwrite": mustMergeOverwrite, + "values": values, "append": push, "push": push, - "prepend": prepend, - "first": first, - "rest": rest, - "last": last, - "initial": initial, - "reverse": reverse, - "uniq": uniq, - "without": without, - "has": has, - "slice": slice, - "concat": concat, + "mustAppend": mustPush, "mustPush": mustPush, + "prepend": prepend, + "mustPrepend": mustPrepend, + "first": first, + "mustFirst": mustFirst, + "rest": rest, + "mustRest": mustRest, + "last": last, + "mustLast": mustLast, + "initial": initial, + "mustInitial": mustInitial, + "reverse": reverse, + "mustReverse": mustReverse, + "uniq": uniq, + "mustUniq": mustUniq, + "without": without, + "mustWithout": mustWithout, + "has": has, + "mustHas": mustHas, + "slice": slice, + "mustSlice": mustSlice, + "concat": concat, + "dig": dig, + "chunk": chunk, + "mustChunk": mustChunk, // Crypto: + "bcrypt": bcrypt, + "htpasswd": htpasswd, "genPrivateKey": generatePrivateKey, "derivePassword": derivePassword, "buildCustomCert": buildCustomCertificate, "genCA": generateCertificateAuthority, + "genCAWithKey": generateCertificateAuthorityWithPEMKey, "genSelfSignedCert": generateSelfSignedCertificate, + "genSelfSignedCertWithKey": generateSelfSignedCertificateWithPEMKey, "genSignedCert": generateSignedCertificate, + "genSignedCertWithKey": generateSignedCertificateWithPEMKey, "encryptAES": encryptAES, "decryptAES": decryptAES, + "randBytes": randBytes, // UUIDs: "uuidv4": uuidv4, @@ -293,12 +362,19 @@ var genericMap = map[string]interface{}{ "fail": func(msg string) (string, error) { return "", errors.New(msg) }, // Regex - "regexMatch": regexMatch, - "regexFindAll": regexFindAll, - "regexFind": regexFind, - "regexReplaceAll": regexReplaceAll, - "regexReplaceAllLiteral": regexReplaceAllLiteral, - "regexSplit": regexSplit, + "regexMatch": regexMatch, + "mustRegexMatch": mustRegexMatch, + "regexFindAll": regexFindAll, + "mustRegexFindAll": mustRegexFindAll, + "regexFind": regexFind, + "mustRegexFind": mustRegexFind, + "regexReplaceAll": regexReplaceAll, + "mustRegexReplaceAll": mustRegexReplaceAll, + "regexReplaceAllLiteral": regexReplaceAllLiteral, + "mustRegexReplaceAllLiteral": mustRegexReplaceAllLiteral, + "regexSplit": regexSplit, + "mustRegexSplit": mustRegexSplit, + "regexQuoteMeta": regexQuoteMeta, // URLs: "urlParse": urlParse, diff --git a/vendor/github.com/Masterminds/sprig/list.go b/vendor/github.com/Masterminds/sprig/v3/list.go similarity index 58% rename from vendor/github.com/Masterminds/sprig/list.go rename to vendor/github.com/Masterminds/sprig/v3/list.go index c0381bb..ca0fbb7 100644 --- a/vendor/github.com/Masterminds/sprig/list.go +++ b/vendor/github.com/Masterminds/sprig/v3/list.go @@ -2,6 +2,7 @@ package sprig import ( "fmt" + "math" "reflect" "sort" ) @@ -15,6 +16,15 @@ func list(v ...interface{}) []interface{} { } func push(list interface{}, v interface{}) []interface{} { + l, err := mustPush(list, v) + if err != nil { + panic(err) + } + + return l +} + +func mustPush(list interface{}, v interface{}) ([]interface{}, error) { tp := reflect.TypeOf(list).Kind() switch tp { case reflect.Slice, reflect.Array: @@ -26,14 +36,23 @@ func push(list interface{}, v interface{}) []interface{} { nl[i] = l2.Index(i).Interface() } - return append(nl, v) + return append(nl, v), nil default: - panic(fmt.Sprintf("Cannot push on type %s", tp)) + return nil, fmt.Errorf("Cannot push on type %s", tp) } } func prepend(list interface{}, v interface{}) []interface{} { + l, err := mustPrepend(list, v) + if err != nil { + panic(err) + } + + return l +} + +func mustPrepend(list interface{}, v interface{}) ([]interface{}, error) { //return append([]interface{}{v}, list...) tp := reflect.TypeOf(list).Kind() @@ -47,14 +66,67 @@ func prepend(list interface{}, v interface{}) []interface{} { nl[i] = l2.Index(i).Interface() } - return append([]interface{}{v}, nl...) + return append([]interface{}{v}, nl...), nil + + default: + return nil, fmt.Errorf("Cannot prepend on type %s", tp) + } +} + +func chunk(size int, list interface{}) [][]interface{} { + l, err := mustChunk(size, list) + if err != nil { + panic(err) + } + + return l +} + +func mustChunk(size int, list interface{}) ([][]interface{}, error) { + tp := reflect.TypeOf(list).Kind() + switch tp { + case reflect.Slice, reflect.Array: + l2 := reflect.ValueOf(list) + + l := l2.Len() + + cs := int(math.Floor(float64(l-1)/float64(size)) + 1) + nl := make([][]interface{}, cs) + + for i := 0; i < cs; i++ { + clen := size + if i == cs-1 { + clen = int(math.Floor(math.Mod(float64(l), float64(size)))) + if clen == 0 { + clen = size + } + } + + nl[i] = make([]interface{}, clen) + + for j := 0; j < clen; j++ { + ix := i*size + j + nl[i][j] = l2.Index(ix).Interface() + } + } + + return nl, nil default: - panic(fmt.Sprintf("Cannot prepend on type %s", tp)) + return nil, fmt.Errorf("Cannot chunk type %s", tp) } } func last(list interface{}) interface{} { + l, err := mustLast(list) + if err != nil { + panic(err) + } + + return l +} + +func mustLast(list interface{}) (interface{}, error) { tp := reflect.TypeOf(list).Kind() switch tp { case reflect.Slice, reflect.Array: @@ -62,16 +134,25 @@ func last(list interface{}) interface{} { l := l2.Len() if l == 0 { - return nil + return nil, nil } - return l2.Index(l - 1).Interface() + return l2.Index(l - 1).Interface(), nil default: - panic(fmt.Sprintf("Cannot find last on type %s", tp)) + return nil, fmt.Errorf("Cannot find last on type %s", tp) } } func first(list interface{}) interface{} { + l, err := mustFirst(list) + if err != nil { + panic(err) + } + + return l +} + +func mustFirst(list interface{}) (interface{}, error) { tp := reflect.TypeOf(list).Kind() switch tp { case reflect.Slice, reflect.Array: @@ -79,16 +160,25 @@ func first(list interface{}) interface{} { l := l2.Len() if l == 0 { - return nil + return nil, nil } - return l2.Index(0).Interface() + return l2.Index(0).Interface(), nil default: - panic(fmt.Sprintf("Cannot find first on type %s", tp)) + return nil, fmt.Errorf("Cannot find first on type %s", tp) } } func rest(list interface{}) []interface{} { + l, err := mustRest(list) + if err != nil { + panic(err) + } + + return l +} + +func mustRest(list interface{}) ([]interface{}, error) { tp := reflect.TypeOf(list).Kind() switch tp { case reflect.Slice, reflect.Array: @@ -96,7 +186,7 @@ func rest(list interface{}) []interface{} { l := l2.Len() if l == 0 { - return nil + return nil, nil } nl := make([]interface{}, l-1) @@ -104,13 +194,22 @@ func rest(list interface{}) []interface{} { nl[i-1] = l2.Index(i).Interface() } - return nl + return nl, nil default: - panic(fmt.Sprintf("Cannot find rest on type %s", tp)) + return nil, fmt.Errorf("Cannot find rest on type %s", tp) } } func initial(list interface{}) []interface{} { + l, err := mustInitial(list) + if err != nil { + panic(err) + } + + return l +} + +func mustInitial(list interface{}) ([]interface{}, error) { tp := reflect.TypeOf(list).Kind() switch tp { case reflect.Slice, reflect.Array: @@ -118,7 +217,7 @@ func initial(list interface{}) []interface{} { l := l2.Len() if l == 0 { - return nil + return nil, nil } nl := make([]interface{}, l-1) @@ -126,9 +225,9 @@ func initial(list interface{}) []interface{} { nl[i] = l2.Index(i).Interface() } - return nl + return nl, nil default: - panic(fmt.Sprintf("Cannot find initial on type %s", tp)) + return nil, fmt.Errorf("Cannot find initial on type %s", tp) } } @@ -145,6 +244,15 @@ func sortAlpha(list interface{}) []string { } func reverse(v interface{}) []interface{} { + l, err := mustReverse(v) + if err != nil { + panic(err) + } + + return l +} + +func mustReverse(v interface{}) ([]interface{}, error) { tp := reflect.TypeOf(v).Kind() switch tp { case reflect.Slice, reflect.Array: @@ -157,13 +265,22 @@ func reverse(v interface{}) []interface{} { nl[l-i-1] = l2.Index(i).Interface() } - return nl + return nl, nil default: - panic(fmt.Sprintf("Cannot find reverse on type %s", tp)) + return nil, fmt.Errorf("Cannot find reverse on type %s", tp) } } func compact(list interface{}) []interface{} { + l, err := mustCompact(list) + if err != nil { + panic(err) + } + + return l +} + +func mustCompact(list interface{}) ([]interface{}, error) { tp := reflect.TypeOf(list).Kind() switch tp { case reflect.Slice, reflect.Array: @@ -179,13 +296,22 @@ func compact(list interface{}) []interface{} { } } - return nl + return nl, nil default: - panic(fmt.Sprintf("Cannot compact on type %s", tp)) + return nil, fmt.Errorf("Cannot compact on type %s", tp) } } func uniq(list interface{}) []interface{} { + l, err := mustUniq(list) + if err != nil { + panic(err) + } + + return l +} + +func mustUniq(list interface{}) ([]interface{}, error) { tp := reflect.TypeOf(list).Kind() switch tp { case reflect.Slice, reflect.Array: @@ -201,9 +327,9 @@ func uniq(list interface{}) []interface{} { } } - return dest + return dest, nil default: - panic(fmt.Sprintf("Cannot find uniq on type %s", tp)) + return nil, fmt.Errorf("Cannot find uniq on type %s", tp) } } @@ -217,6 +343,15 @@ func inList(haystack []interface{}, needle interface{}) bool { } func without(list interface{}, omit ...interface{}) []interface{} { + l, err := mustWithout(list, omit...) + if err != nil { + panic(err) + } + + return l +} + +func mustWithout(list interface{}, omit ...interface{}) ([]interface{}, error) { tp := reflect.TypeOf(list).Kind() switch tp { case reflect.Slice, reflect.Array: @@ -232,15 +367,24 @@ func without(list interface{}, omit ...interface{}) []interface{} { } } - return res + return res, nil default: - panic(fmt.Sprintf("Cannot find without on type %s", tp)) + return nil, fmt.Errorf("Cannot find without on type %s", tp) } } func has(needle interface{}, haystack interface{}) bool { + l, err := mustHas(needle, haystack) + if err != nil { + panic(err) + } + + return l +} + +func mustHas(needle interface{}, haystack interface{}) (bool, error) { if haystack == nil { - return false + return false, nil } tp := reflect.TypeOf(haystack).Kind() switch tp { @@ -251,13 +395,13 @@ func has(needle interface{}, haystack interface{}) bool { for i := 0; i < l; i++ { item = l2.Index(i).Interface() if reflect.DeepEqual(needle, item) { - return true + return true, nil } } - return false + return false, nil default: - panic(fmt.Sprintf("Cannot find has on type %s", tp)) + return false, fmt.Errorf("Cannot find has on type %s", tp) } } @@ -267,6 +411,15 @@ func has(needle interface{}, haystack interface{}) bool { // slice $list 3 5 -> list[3:5] // slice $list 3 -> list[3:5] = list[3:] func slice(list interface{}, indices ...interface{}) interface{} { + l, err := mustSlice(list, indices...) + if err != nil { + panic(err) + } + + return l +} + +func mustSlice(list interface{}, indices ...interface{}) (interface{}, error) { tp := reflect.TypeOf(list).Kind() switch tp { case reflect.Slice, reflect.Array: @@ -274,7 +427,7 @@ func slice(list interface{}, indices ...interface{}) interface{} { l := l2.Len() if l == 0 { - return nil + return nil, nil } var start, end int @@ -287,9 +440,9 @@ func slice(list interface{}, indices ...interface{}) interface{} { end = toInt(indices[1]) } - return l2.Slice(start, end).Interface() + return l2.Slice(start, end).Interface(), nil default: - panic(fmt.Sprintf("list should be type of slice or array but %s", tp)) + return nil, fmt.Errorf("list should be type of slice or array but %s", tp) } } diff --git a/vendor/github.com/Masterminds/sprig/network.go b/vendor/github.com/Masterminds/sprig/v3/network.go similarity index 75% rename from vendor/github.com/Masterminds/sprig/network.go rename to vendor/github.com/Masterminds/sprig/v3/network.go index d786cc7..108d78a 100644 --- a/vendor/github.com/Masterminds/sprig/network.go +++ b/vendor/github.com/Masterminds/sprig/v3/network.go @@ -7,6 +7,6 @@ import ( func getHostByName(name string) string { addrs, _ := net.LookupHost(name) - //TODO: add error handing when release v3 cames out + //TODO: add error handing when release v3 comes out return addrs[rand.Intn(len(addrs))] } diff --git a/vendor/github.com/Masterminds/sprig/v3/numeric.go b/vendor/github.com/Masterminds/sprig/v3/numeric.go new file mode 100644 index 0000000..f68e418 --- /dev/null +++ b/vendor/github.com/Masterminds/sprig/v3/numeric.go @@ -0,0 +1,186 @@ +package sprig + +import ( + "fmt" + "math" + "strconv" + "strings" + + "github.com/spf13/cast" + "github.com/shopspring/decimal" +) + +// toFloat64 converts 64-bit floats +func toFloat64(v interface{}) float64 { + return cast.ToFloat64(v) +} + +func toInt(v interface{}) int { + return cast.ToInt(v) +} + +// toInt64 converts integer types to 64-bit integers +func toInt64(v interface{}) int64 { + return cast.ToInt64(v) +} + +func max(a interface{}, i ...interface{}) int64 { + aa := toInt64(a) + for _, b := range i { + bb := toInt64(b) + if bb > aa { + aa = bb + } + } + return aa +} + +func maxf(a interface{}, i ...interface{}) float64 { + aa := toFloat64(a) + for _, b := range i { + bb := toFloat64(b) + aa = math.Max(aa, bb) + } + return aa +} + +func min(a interface{}, i ...interface{}) int64 { + aa := toInt64(a) + for _, b := range i { + bb := toInt64(b) + if bb < aa { + aa = bb + } + } + return aa +} + +func minf(a interface{}, i ...interface{}) float64 { + aa := toFloat64(a) + for _, b := range i { + bb := toFloat64(b) + aa = math.Min(aa, bb) + } + return aa +} + +func until(count int) []int { + step := 1 + if count < 0 { + step = -1 + } + return untilStep(0, count, step) +} + +func untilStep(start, stop, step int) []int { + v := []int{} + + if stop < start { + if step >= 0 { + return v + } + for i := start; i > stop; i += step { + v = append(v, i) + } + return v + } + + if step <= 0 { + return v + } + for i := start; i < stop; i += step { + v = append(v, i) + } + return v +} + +func floor(a interface{}) float64 { + aa := toFloat64(a) + return math.Floor(aa) +} + +func ceil(a interface{}) float64 { + aa := toFloat64(a) + return math.Ceil(aa) +} + +func round(a interface{}, p int, rOpt ...float64) float64 { + roundOn := .5 + if len(rOpt) > 0 { + roundOn = rOpt[0] + } + val := toFloat64(a) + places := toFloat64(p) + + var round float64 + pow := math.Pow(10, places) + digit := pow * val + _, div := math.Modf(digit) + if div >= roundOn { + round = math.Ceil(digit) + } else { + round = math.Floor(digit) + } + return round / pow +} + +// converts unix octal to decimal +func toDecimal(v interface{}) int64 { + result, err := strconv.ParseInt(fmt.Sprint(v), 8, 64) + if err != nil { + return 0 + } + return result +} + +func seq(params ...int) string { + increment := 1 + switch len(params) { + case 0: + return "" + case 1: + start := 1 + end := params[0] + if end < start { + increment = -1 + } + return intArrayToString(untilStep(start, end+increment, increment), " ") + case 3: + start := params[0] + end := params[2] + step := params[1] + if end < start { + increment = -1 + if step > 0 { + return "" + } + } + return intArrayToString(untilStep(start, end+increment, step), " ") + case 2: + start := params[0] + end := params[1] + step := 1 + if end < start { + step = -1 + } + return intArrayToString(untilStep(start, end+step, step), " ") + default: + return "" + } +} + +func intArrayToString(slice []int, delimeter string) string { + return strings.Trim(strings.Join(strings.Fields(fmt.Sprint(slice)), delimeter), "[]") +} + +// performs a float and subsequent decimal.Decimal conversion on inputs, +// and iterates through a and b executing the mathmetical operation f +func execDecimalOp(a interface{}, b []interface{}, f func(d1, d2 decimal.Decimal) decimal.Decimal) float64 { + prt := decimal.NewFromFloat(toFloat64(a)) + for _, x := range b { + dx := decimal.NewFromFloat(toFloat64(x)) + prt = f(prt, dx) + } + rslt, _ := prt.Float64() + return rslt +} diff --git a/vendor/github.com/Masterminds/sprig/reflect.go b/vendor/github.com/Masterminds/sprig/v3/reflect.go similarity index 100% rename from vendor/github.com/Masterminds/sprig/reflect.go rename to vendor/github.com/Masterminds/sprig/v3/reflect.go diff --git a/vendor/github.com/Masterminds/sprig/v3/regex.go b/vendor/github.com/Masterminds/sprig/v3/regex.go new file mode 100644 index 0000000..fab5510 --- /dev/null +++ b/vendor/github.com/Masterminds/sprig/v3/regex.go @@ -0,0 +1,83 @@ +package sprig + +import ( + "regexp" +) + +func regexMatch(regex string, s string) bool { + match, _ := regexp.MatchString(regex, s) + return match +} + +func mustRegexMatch(regex string, s string) (bool, error) { + return regexp.MatchString(regex, s) +} + +func regexFindAll(regex string, s string, n int) []string { + r := regexp.MustCompile(regex) + return r.FindAllString(s, n) +} + +func mustRegexFindAll(regex string, s string, n int) ([]string, error) { + r, err := regexp.Compile(regex) + if err != nil { + return []string{}, err + } + return r.FindAllString(s, n), nil +} + +func regexFind(regex string, s string) string { + r := regexp.MustCompile(regex) + return r.FindString(s) +} + +func mustRegexFind(regex string, s string) (string, error) { + r, err := regexp.Compile(regex) + if err != nil { + return "", err + } + return r.FindString(s), nil +} + +func regexReplaceAll(regex string, s string, repl string) string { + r := regexp.MustCompile(regex) + return r.ReplaceAllString(s, repl) +} + +func mustRegexReplaceAll(regex string, s string, repl string) (string, error) { + r, err := regexp.Compile(regex) + if err != nil { + return "", err + } + return r.ReplaceAllString(s, repl), nil +} + +func regexReplaceAllLiteral(regex string, s string, repl string) string { + r := regexp.MustCompile(regex) + return r.ReplaceAllLiteralString(s, repl) +} + +func mustRegexReplaceAllLiteral(regex string, s string, repl string) (string, error) { + r, err := regexp.Compile(regex) + if err != nil { + return "", err + } + return r.ReplaceAllLiteralString(s, repl), nil +} + +func regexSplit(regex string, s string, n int) []string { + r := regexp.MustCompile(regex) + return r.Split(s, n) +} + +func mustRegexSplit(regex string, s string, n int) ([]string, error) { + r, err := regexp.Compile(regex) + if err != nil { + return []string{}, err + } + return r.Split(s, n), nil +} + +func regexQuoteMeta(s string) string { + return regexp.QuoteMeta(s) +} diff --git a/vendor/github.com/Masterminds/sprig/semver.go b/vendor/github.com/Masterminds/sprig/v3/semver.go similarity index 90% rename from vendor/github.com/Masterminds/sprig/semver.go rename to vendor/github.com/Masterminds/sprig/v3/semver.go index c2bf8a1..3fbe08a 100644 --- a/vendor/github.com/Masterminds/sprig/semver.go +++ b/vendor/github.com/Masterminds/sprig/v3/semver.go @@ -1,7 +1,7 @@ package sprig import ( - sv2 "github.com/Masterminds/semver" + sv2 "github.com/Masterminds/semver/v3" ) func semverCompare(constraint, version string) (bool, error) { diff --git a/vendor/github.com/Masterminds/sprig/strings.go b/vendor/github.com/Masterminds/sprig/v3/strings.go similarity index 97% rename from vendor/github.com/Masterminds/sprig/strings.go rename to vendor/github.com/Masterminds/sprig/v3/strings.go index 943fa3e..e0ae628 100644 --- a/vendor/github.com/Masterminds/sprig/strings.go +++ b/vendor/github.com/Masterminds/sprig/v3/strings.go @@ -154,9 +154,9 @@ func strslice(v interface{}) []string { default: if v == nil { return []string{} - } else { - return []string{strval(v)} } + + return []string{strval(v)} } } } @@ -187,10 +187,13 @@ func strval(v interface{}) string { } func trunc(c int, s string) string { - if len(s) <= c { - return s + if c < 0 && len(s)+c > 0 { + return s[len(s)+c:] + } + if c >= 0 && len(s) > c { + return s[:c] } - return s[0:c] + return s } func join(sep string, v interface{}) string { diff --git a/vendor/github.com/Masterminds/sprig/url.go b/vendor/github.com/Masterminds/sprig/v3/url.go similarity index 64% rename from vendor/github.com/Masterminds/sprig/url.go rename to vendor/github.com/Masterminds/sprig/v3/url.go index 5f22d80..b8e120e 100644 --- a/vendor/github.com/Masterminds/sprig/url.go +++ b/vendor/github.com/Masterminds/sprig/v3/url.go @@ -7,7 +7,8 @@ import ( ) func dictGetOrEmpty(dict map[string]interface{}, key string) string { - value, ok := dict[key]; if !ok { + value, ok := dict[key] + if !ok { return "" } tp := reflect.TypeOf(value).Kind() @@ -20,19 +21,19 @@ func dictGetOrEmpty(dict map[string]interface{}, key string) string { // parses given URL to return dict object func urlParse(v string) map[string]interface{} { dict := map[string]interface{}{} - parsedUrl, err := url.Parse(v) + parsedURL, err := url.Parse(v) if err != nil { panic(fmt.Sprintf("unable to parse url: %s", err)) } - dict["scheme"] = parsedUrl.Scheme - dict["host"] = parsedUrl.Host - dict["hostname"] = parsedUrl.Hostname() - dict["path"] = parsedUrl.Path - dict["query"] = parsedUrl.RawQuery - dict["opaque"] = parsedUrl.Opaque - dict["fragment"] = parsedUrl.Fragment - if parsedUrl.User != nil { - dict["userinfo"] = parsedUrl.User.String() + dict["scheme"] = parsedURL.Scheme + dict["host"] = parsedURL.Host + dict["hostname"] = parsedURL.Hostname() + dict["path"] = parsedURL.Path + dict["query"] = parsedURL.RawQuery + dict["opaque"] = parsedURL.Opaque + dict["fragment"] = parsedURL.Fragment + if parsedURL.User != nil { + dict["userinfo"] = parsedURL.User.String() } else { dict["userinfo"] = "" } @@ -42,25 +43,24 @@ func urlParse(v string) map[string]interface{} { // join given dict to URL string func urlJoin(d map[string]interface{}) string { - resUrl := url.URL{ + resURL := url.URL{ Scheme: dictGetOrEmpty(d, "scheme"), Host: dictGetOrEmpty(d, "host"), Path: dictGetOrEmpty(d, "path"), RawQuery: dictGetOrEmpty(d, "query"), Opaque: dictGetOrEmpty(d, "opaque"), Fragment: dictGetOrEmpty(d, "fragment"), - } userinfo := dictGetOrEmpty(d, "userinfo") - var user *url.Userinfo = nil + var user *url.Userinfo if userinfo != "" { - tempUrl, err := url.Parse(fmt.Sprintf("proto://%s@host", userinfo)) + tempURL, err := url.Parse(fmt.Sprintf("proto://%s@host", userinfo)) if err != nil { panic(fmt.Sprintf("unable to parse userinfo in dict: %s", err)) } - user = tempUrl.User + user = tempURL.User } - resUrl.User = user - return resUrl.String() + resURL.User = user + return resURL.String() } diff --git a/vendor/github.com/google/uuid/hash.go b/vendor/github.com/google/uuid/hash.go index b174616..b404f4b 100644 --- a/vendor/github.com/google/uuid/hash.go +++ b/vendor/github.com/google/uuid/hash.go @@ -26,8 +26,8 @@ var ( // NewMD5 and NewSHA1. func NewHash(h hash.Hash, space UUID, data []byte, version int) UUID { h.Reset() - h.Write(space[:]) - h.Write(data) + h.Write(space[:]) //nolint:errcheck + h.Write(data) //nolint:errcheck s := h.Sum(nil) var uuid UUID copy(uuid[:], s) diff --git a/vendor/github.com/google/uuid/null.go b/vendor/github.com/google/uuid/null.go new file mode 100644 index 0000000..d7fcbf2 --- /dev/null +++ b/vendor/github.com/google/uuid/null.go @@ -0,0 +1,118 @@ +// Copyright 2021 Google Inc. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package uuid + +import ( + "bytes" + "database/sql/driver" + "encoding/json" + "fmt" +) + +var jsonNull = []byte("null") + +// NullUUID represents a UUID that may be null. +// NullUUID implements the SQL driver.Scanner interface so +// it can be used as a scan destination: +// +// var u uuid.NullUUID +// err := db.QueryRow("SELECT name FROM foo WHERE id=?", id).Scan(&u) +// ... +// if u.Valid { +// // use u.UUID +// } else { +// // NULL value +// } +// +type NullUUID struct { + UUID UUID + Valid bool // Valid is true if UUID is not NULL +} + +// Scan implements the SQL driver.Scanner interface. +func (nu *NullUUID) Scan(value interface{}) error { + if value == nil { + nu.UUID, nu.Valid = Nil, false + return nil + } + + err := nu.UUID.Scan(value) + if err != nil { + nu.Valid = false + return err + } + + nu.Valid = true + return nil +} + +// Value implements the driver Valuer interface. +func (nu NullUUID) Value() (driver.Value, error) { + if !nu.Valid { + return nil, nil + } + // Delegate to UUID Value function + return nu.UUID.Value() +} + +// MarshalBinary implements encoding.BinaryMarshaler. +func (nu NullUUID) MarshalBinary() ([]byte, error) { + if nu.Valid { + return nu.UUID[:], nil + } + + return []byte(nil), nil +} + +// UnmarshalBinary implements encoding.BinaryUnmarshaler. +func (nu *NullUUID) UnmarshalBinary(data []byte) error { + if len(data) != 16 { + return fmt.Errorf("invalid UUID (got %d bytes)", len(data)) + } + copy(nu.UUID[:], data) + nu.Valid = true + return nil +} + +// MarshalText implements encoding.TextMarshaler. +func (nu NullUUID) MarshalText() ([]byte, error) { + if nu.Valid { + return nu.UUID.MarshalText() + } + + return jsonNull, nil +} + +// UnmarshalText implements encoding.TextUnmarshaler. +func (nu *NullUUID) UnmarshalText(data []byte) error { + id, err := ParseBytes(data) + if err != nil { + nu.Valid = false + return err + } + nu.UUID = id + nu.Valid = true + return nil +} + +// MarshalJSON implements json.Marshaler. +func (nu NullUUID) MarshalJSON() ([]byte, error) { + if nu.Valid { + return json.Marshal(nu.UUID) + } + + return jsonNull, nil +} + +// UnmarshalJSON implements json.Unmarshaler. +func (nu *NullUUID) UnmarshalJSON(data []byte) error { + if bytes.Equal(data, jsonNull) { + *nu = NullUUID{} + return nil // valid null UUID + } + err := json.Unmarshal(data, &nu.UUID) + nu.Valid = err == nil + return err +} diff --git a/vendor/github.com/google/uuid/sql.go b/vendor/github.com/google/uuid/sql.go index f326b54..2e02ec0 100644 --- a/vendor/github.com/google/uuid/sql.go +++ b/vendor/github.com/google/uuid/sql.go @@ -9,7 +9,7 @@ import ( "fmt" ) -// Scan implements sql.Scanner so UUIDs can be read from databases transparently +// Scan implements sql.Scanner so UUIDs can be read from databases transparently. // Currently, database types that map to string and []byte are supported. Please // consult database-specific driver documentation for matching types. func (uuid *UUID) Scan(src interface{}) error { diff --git a/vendor/github.com/google/uuid/uuid.go b/vendor/github.com/google/uuid/uuid.go index 524404c..a57207a 100644 --- a/vendor/github.com/google/uuid/uuid.go +++ b/vendor/github.com/google/uuid/uuid.go @@ -12,6 +12,7 @@ import ( "fmt" "io" "strings" + "sync" ) // A UUID is a 128 bit (16 byte) Universal Unique IDentifier as defined in RFC @@ -33,7 +34,27 @@ const ( Future // Reserved for future definition. ) -var rander = rand.Reader // random function +const randPoolSize = 16 * 16 + +var ( + rander = rand.Reader // random function + poolEnabled = false + poolMu sync.Mutex + poolPos = randPoolSize // protected with poolMu + pool [randPoolSize]byte // protected with poolMu +) + +type invalidLengthError struct{ len int } + +func (err invalidLengthError) Error() string { + return fmt.Sprintf("invalid UUID length: %d", err.len) +} + +// IsInvalidLengthError is matcher function for custom error invalidLengthError +func IsInvalidLengthError(err error) bool { + _, ok := err.(invalidLengthError) + return ok +} // Parse decodes s into a UUID or returns an error. Both the standard UUID // forms of xxxxxxxx-xxxx-xxxx-xxxx-xxxxxxxxxxxx and @@ -68,7 +89,7 @@ func Parse(s string) (UUID, error) { } return uuid, nil default: - return uuid, fmt.Errorf("invalid UUID length: %d", len(s)) + return uuid, invalidLengthError{len(s)} } // s is now at least 36 bytes long // it must be of the form xxxxxxxx-xxxx-xxxx-xxxx-xxxxxxxxxxxx @@ -112,7 +133,7 @@ func ParseBytes(b []byte) (UUID, error) { } return uuid, nil default: - return uuid, fmt.Errorf("invalid UUID length: %d", len(b)) + return uuid, invalidLengthError{len(b)} } // s is now at least 36 bytes long // it must be of the form xxxxxxxx-xxxx-xxxx-xxxx-xxxxxxxxxxxx @@ -243,3 +264,31 @@ func SetRand(r io.Reader) { } rander = r } + +// EnableRandPool enables internal randomness pool used for Random +// (Version 4) UUID generation. The pool contains random bytes read from +// the random number generator on demand in batches. Enabling the pool +// may improve the UUID generation throughput significantly. +// +// Since the pool is stored on the Go heap, this feature may be a bad fit +// for security sensitive applications. +// +// Both EnableRandPool and DisableRandPool are not thread-safe and should +// only be called when there is no possibility that New or any other +// UUID Version 4 generation function will be called concurrently. +func EnableRandPool() { + poolEnabled = true +} + +// DisableRandPool disables the randomness pool if it was previously +// enabled with EnableRandPool. +// +// Both EnableRandPool and DisableRandPool are not thread-safe and should +// only be called when there is no possibility that New or any other +// UUID Version 4 generation function will be called concurrently. +func DisableRandPool() { + poolEnabled = false + defer poolMu.Unlock() + poolMu.Lock() + poolPos = randPoolSize +} diff --git a/vendor/github.com/google/uuid/version4.go b/vendor/github.com/google/uuid/version4.go index c110465..7697802 100644 --- a/vendor/github.com/google/uuid/version4.go +++ b/vendor/github.com/google/uuid/version4.go @@ -14,11 +14,21 @@ func New() UUID { return Must(NewRandom()) } +// NewString creates a new random UUID and returns it as a string or panics. +// NewString is equivalent to the expression +// +// uuid.New().String() +func NewString() string { + return Must(NewRandom()).String() +} + // NewRandom returns a Random (Version 4) UUID. // // The strength of the UUIDs is based on the strength of the crypto/rand // package. // +// Uses the randomness pool if it was enabled with EnableRandPool. +// // A note about uniqueness derived from the UUID Wikipedia entry: // // Randomly generated UUIDs have 122 random bits. One's annual risk of being @@ -27,7 +37,10 @@ func New() UUID { // equivalent to the odds of creating a few tens of trillions of UUIDs in a // year and having one duplicate. func NewRandom() (UUID, error) { - return NewRandomFromReader(rander) + if !poolEnabled { + return NewRandomFromReader(rander) + } + return newRandomFromPool() } // NewRandomFromReader returns a UUID based on bytes read from a given io.Reader. @@ -41,3 +54,23 @@ func NewRandomFromReader(r io.Reader) (UUID, error) { uuid[8] = (uuid[8] & 0x3f) | 0x80 // Variant is 10 return uuid, nil } + +func newRandomFromPool() (UUID, error) { + var uuid UUID + poolMu.Lock() + if poolPos == randPoolSize { + _, err := io.ReadFull(rander, pool[:]) + if err != nil { + poolMu.Unlock() + return Nil, err + } + poolPos = 0 + } + copy(uuid[:], pool[poolPos:(poolPos+16)]) + poolPos += 16 + poolMu.Unlock() + + uuid[6] = (uuid[6] & 0x0f) | 0x40 // Version 4 + uuid[8] = (uuid[8] & 0x3f) | 0x80 // Variant is 10 + return uuid, nil +} diff --git a/vendor/github.com/hashicorp/errwrap/errwrap.go b/vendor/github.com/hashicorp/errwrap/errwrap.go index a733bef..44e368e 100644 --- a/vendor/github.com/hashicorp/errwrap/errwrap.go +++ b/vendor/github.com/hashicorp/errwrap/errwrap.go @@ -44,6 +44,8 @@ func Wrap(outer, inner error) error { // // format is the format of the error message. The string '{{err}}' will // be replaced with the original error message. +// +// Deprecated: Use fmt.Errorf() func Wrapf(format string, err error) error { outerMsg := "" if err != nil { @@ -148,6 +150,9 @@ func Walk(err error, cb WalkFunc) { for _, err := range e.WrappedErrors() { Walk(err, cb) } + case interface{ Unwrap() error }: + cb(err) + Walk(e.Unwrap(), cb) default: cb(err) } @@ -167,3 +172,7 @@ func (w *wrappedError) Error() string { func (w *wrappedError) WrappedErrors() []error { return []error{w.Outer, w.Inner} } + +func (w *wrappedError) Unwrap() error { + return w.Inner +} diff --git a/vendor/github.com/hashicorp/terraform-plugin-docs/internal/cmd/generate.go b/vendor/github.com/hashicorp/terraform-plugin-docs/internal/cmd/generate.go index 98b6b32..54e4d20 100644 --- a/vendor/github.com/hashicorp/terraform-plugin-docs/internal/cmd/generate.go +++ b/vendor/github.com/hashicorp/terraform-plugin-docs/internal/cmd/generate.go @@ -3,6 +3,7 @@ package cmd import ( "flag" "fmt" + "strings" "github.com/hashicorp/terraform-plugin-docs/internal/provider" ) @@ -10,8 +11,17 @@ import ( type generateCmd struct { commonCmd - flagLegacySidebar bool - tfVersion string + flagLegacySidebar bool + flagIgnoreDeprecated bool + + flagProviderName string + flagRenderedProviderName string + + flagRenderedWebsiteDir string + flagExamplesDir string + flagWebsiteTmpDir string + flagWebsiteSourceDir string + tfVersion string } func (cmd *generateCmd) Synopsis() string { @@ -19,13 +29,54 @@ func (cmd *generateCmd) Synopsis() string { } func (cmd *generateCmd) Help() string { - return `Usage: tfplugindocs generate` + strBuilder := &strings.Builder{} + + longestName := 0 + longestUsage := 0 + cmd.Flags().VisitAll(func(f *flag.Flag) { + if len(f.Name) > longestName { + longestName = len(f.Name) + } + if len(f.Usage) > longestUsage { + longestUsage = len(f.Usage) + } + }) + + strBuilder.WriteString(fmt.Sprintf("\nUsage: tfplugindocs generate []\n\n")) + cmd.Flags().VisitAll(func(f *flag.Flag) { + if f.DefValue != "" { + strBuilder.WriteString(fmt.Sprintf(" --%s %s%s%s (default: %q)\n", + f.Name, + strings.Repeat(" ", longestName-len(f.Name)+2), + f.Usage, + strings.Repeat(" ", longestUsage-len(f.Usage)+2), + f.DefValue, + )) + } else { + strBuilder.WriteString(fmt.Sprintf(" --%s %s%s%s\n", + f.Name, + strings.Repeat(" ", longestName-len(f.Name)+2), + f.Usage, + strings.Repeat(" ", longestUsage-len(f.Usage)+2), + )) + } + }) + strBuilder.WriteString("\n") + + return strBuilder.String() } func (cmd *generateCmd) Flags() *flag.FlagSet { fs := flag.NewFlagSet("generate", flag.ExitOnError) fs.BoolVar(&cmd.flagLegacySidebar, "legacy-sidebar", false, "generate the legacy .erb sidebar file") + fs.StringVar(&cmd.flagProviderName, "provider-name", "", "provider name, as used in Terraform configurations") + fs.StringVar(&cmd.flagRenderedProviderName, "rendered-provider-name", "", "provider name, as generated in documentation (ex. page titles, ...)") + fs.StringVar(&cmd.flagRenderedWebsiteDir, "rendered-website-dir", "docs", "output directory") + fs.StringVar(&cmd.flagExamplesDir, "examples-dir", "examples", "examples directory") + fs.StringVar(&cmd.flagWebsiteTmpDir, "website-temp-dir", "", "temporary directory (used during generation)") + fs.StringVar(&cmd.flagWebsiteSourceDir, "website-source-dir", "templates", "templates directory") fs.StringVar(&cmd.tfVersion, "tf-version", "", "terraform binary version to download") + fs.BoolVar(&cmd.flagIgnoreDeprecated, "ignore-deprecated", false, "don't generate documentation for deprecated resources and data-sources") return fs } @@ -41,7 +92,18 @@ func (cmd *generateCmd) Run(args []string) int { } func (cmd *generateCmd) runInternal() error { - err := provider.Generate(cmd.ui, cmd.flagLegacySidebar, cmd.tfVersion) + err := provider.Generate( + cmd.ui, + cmd.flagLegacySidebar, + cmd.flagProviderName, + cmd.flagRenderedProviderName, + cmd.flagRenderedWebsiteDir, + cmd.flagExamplesDir, + cmd.flagWebsiteTmpDir, + cmd.flagWebsiteSourceDir, + cmd.tfVersion, + cmd.flagIgnoreDeprecated, + ) if err != nil { return fmt.Errorf("unable to generate website: %w", err) } diff --git a/vendor/github.com/hashicorp/terraform-plugin-docs/internal/cmd/validate.go b/vendor/github.com/hashicorp/terraform-plugin-docs/internal/cmd/validate.go index c40b175..0f54c56 100644 --- a/vendor/github.com/hashicorp/terraform-plugin-docs/internal/cmd/validate.go +++ b/vendor/github.com/hashicorp/terraform-plugin-docs/internal/cmd/validate.go @@ -3,6 +3,7 @@ package cmd import ( "flag" "fmt" + "strings" "github.com/hashicorp/terraform-plugin-docs/internal/provider" ) @@ -16,7 +17,41 @@ func (cmd *validateCmd) Synopsis() string { } func (cmd *validateCmd) Help() string { - return `Usage: tfplugindocs validate` + strBuilder := &strings.Builder{} + + longestName := 0 + longestUsage := 0 + cmd.Flags().VisitAll(func(f *flag.Flag) { + if len(f.Name) > longestName { + longestName = len(f.Name) + } + if len(f.Usage) > longestUsage { + longestUsage = len(f.Usage) + } + }) + + strBuilder.WriteString(fmt.Sprintf("\nUsage: tfplugindocs validate []\n\n")) + cmd.Flags().VisitAll(func(f *flag.Flag) { + if f.DefValue != "" { + strBuilder.WriteString(fmt.Sprintf(" --%s %s%s%s (default: %q)\n", + f.Name, + strings.Repeat(" ", longestName-len(f.Name)+2), + f.Usage, + strings.Repeat(" ", longestUsage-len(f.Usage)+2), + f.DefValue, + )) + } else { + strBuilder.WriteString(fmt.Sprintf(" --%s %s%s%s\n", + f.Name, + strings.Repeat(" ", longestName-len(f.Name)+2), + f.Usage, + strings.Repeat(" ", longestUsage-len(f.Usage)+2), + )) + } + }) + strBuilder.WriteString("\n") + + return strBuilder.String() } func (cmd *validateCmd) Flags() *flag.FlagSet { diff --git a/vendor/github.com/hashicorp/terraform-plugin-docs/internal/provider/generate.go b/vendor/github.com/hashicorp/terraform-plugin-docs/internal/provider/generate.go index f7a2739..ce5a4b1 100644 --- a/vendor/github.com/hashicorp/terraform-plugin-docs/internal/provider/generate.go +++ b/vendor/github.com/hashicorp/terraform-plugin-docs/internal/provider/generate.go @@ -22,25 +22,12 @@ import ( "github.com/mitchellh/cli" ) -// TODO: convert these to flags? var ( - providerName string - - // rendered website dir - renderedWebsiteDir = "docs" - - // examples directory defaults - examplesDir = "examples" - // relative to examples dir examplesResourceFileTemplate = resourceFileTemplate("resources/{{.Name}}/resource.tf") examplesResourceImportTemplate = resourceFileTemplate("resources/{{.Name}}/import.sh") examplesDataSourceFileTemplate = resourceFileTemplate("data-sources/{{ .Name }}/data-source.tf") examplesProviderFileTemplate = providerFileTemplate("provider/provider.tf") - // templated website directory defaults - websiteTmp = "" - - websiteSourceDir = "templates" // used for override content websiteResourceFileTemplate = resourceFileTemplate("resources/{{ .ShortName }}.md.tmpl") websiteResourceFallbackFileTemplate = resourceFileTemplate("resources.md.tmpl") websiteResourceFileStatic = []resourceFileTemplate{ @@ -77,8 +64,16 @@ var ( ) type generator struct { - legacySidebar bool - tfVersion string + ignoreDeprecated bool + legacySidebar bool + tfVersion string + + providerName string + renderedProviderName string + renderedWebsiteDir string + examplesDir string + websiteTmpDir string + websiteSourceDir string ui cli.Ui } @@ -91,10 +86,18 @@ func (g *generator) warnf(format string, a ...interface{}) { g.ui.Warn(fmt.Sprintf(format, a...)) } -func Generate(ui cli.Ui, legacySidebar bool, tfVersion string) error { +func Generate(ui cli.Ui, legacySidebar bool, providerName, renderedProviderName, renderedWebsiteDir, examplesDir, websiteTmpDir, websiteSourceDir, tfVersion string, ignoreDeprecated bool) error { g := &generator{ - legacySidebar: legacySidebar, - tfVersion: tfVersion, + ignoreDeprecated: ignoreDeprecated, + legacySidebar: legacySidebar, + tfVersion: tfVersion, + + providerName: providerName, + renderedProviderName: renderedProviderName, + renderedWebsiteDir: renderedWebsiteDir, + examplesDir: examplesDir, + websiteTmpDir: websiteTmpDir, + websiteSourceDir: websiteSourceDir, ui: ui, } @@ -112,34 +115,39 @@ func (g *generator) Generate(ctx context.Context) error { return err } - if providerName == "" { + providerName := g.providerName + if g.providerName == "" { providerName = filepath.Base(wd) } - g.infof("rendering website for provider %q", providerName) + if g.renderedProviderName == "" { + g.renderedProviderName = providerName + } + + g.infof("rendering website for provider %q (as %q)", providerName, g.renderedProviderName) switch { - case websiteTmp == "": - websiteTmp, err = ioutil.TempDir("", "tfws") + case g.websiteTmpDir == "": + g.websiteTmpDir, err = ioutil.TempDir("", "tfws") if err != nil { return err } - defer os.RemoveAll(websiteTmp) + defer os.RemoveAll(g.websiteTmpDir) default: - g.infof("cleaning tmp dir %q", websiteTmp) - err = os.RemoveAll(websiteTmp) + g.infof("cleaning tmp dir %q", g.websiteTmpDir) + err = os.RemoveAll(g.websiteTmpDir) if err != nil { return err } - g.infof("creating tmp dir %q", websiteTmp) - err = os.MkdirAll(websiteTmp, 0755) + g.infof("creating tmp dir %q", g.websiteTmpDir) + err = os.MkdirAll(g.websiteTmpDir, 0755) if err != nil { return err } } - websiteSourceDirInfo, err := os.Stat(websiteSourceDir) + websiteSourceDirInfo, err := os.Stat(g.websiteSourceDir) switch { case os.IsNotExist(err): // do nothing, no template dir @@ -147,11 +155,11 @@ func (g *generator) Generate(ctx context.Context) error { return err default: if !websiteSourceDirInfo.IsDir() { - return fmt.Errorf("template path is not a directory: %s", websiteSourceDir) + return fmt.Errorf("template path is not a directory: %s", g.websiteSourceDir) } g.infof("copying any existing content to tmp dir") - err = cp(websiteSourceDir, filepath.Join(websiteTmp, "templates")) + err = cp(g.websiteSourceDir, filepath.Join(g.websiteTmpDir, "templates")) if err != nil { return err } @@ -189,7 +197,7 @@ func (g *generator) renderMissingResourceDoc(providerName, name, typeName string if err != nil { return fmt.Errorf("unable to render path for resource %q: %w", name, err) } - tmplPath = filepath.Join(websiteTmp, websiteSourceDir, tmplPath) + tmplPath = filepath.Join(g.websiteTmpDir, g.websiteSourceDir, tmplPath) if fileExists(tmplPath) { g.infof("resource %q template exists, skipping", name) return nil @@ -200,7 +208,7 @@ func (g *generator) renderMissingResourceDoc(providerName, name, typeName string if err != nil { return fmt.Errorf("unable to render path for resource %q: %w", name, err) } - candidatePath = filepath.Join(websiteTmp, websiteSourceDir, candidatePath) + candidatePath = filepath.Join(g.websiteTmpDir, g.websiteSourceDir, candidatePath) if fileExists(candidatePath) { g.infof("resource %q static file exists, skipping", name) return nil @@ -212,7 +220,7 @@ func (g *generator) renderMissingResourceDoc(providerName, name, typeName string return fmt.Errorf("unable to render example file path for %q: %w", name, err) } if examplePath != "" { - examplePath = filepath.Join(examplesDir, examplePath) + examplePath = filepath.Join(g.examplesDir, examplePath) } if !fileExists(examplePath) { examplePath = "" @@ -225,7 +233,7 @@ func (g *generator) renderMissingResourceDoc(providerName, name, typeName string return fmt.Errorf("unable to render example import file path for %q: %w", name, err) } if importPath != "" { - importPath = filepath.Join(examplesDir, importPath) + importPath = filepath.Join(g.examplesDir, importPath) } if !fileExists(importPath) { importPath = "" @@ -238,7 +246,7 @@ func (g *generator) renderMissingResourceDoc(providerName, name, typeName string if err != nil { return fmt.Errorf("unable to render path for resource %q: %w", name, err) } - fallbackTmplPath = filepath.Join(websiteTmp, websiteSourceDir, fallbackTmplPath) + fallbackTmplPath = filepath.Join(g.websiteTmpDir, g.websiteSourceDir, fallbackTmplPath) if fileExists(fallbackTmplPath) { g.infof("resource %q fallback template exists", name) tmplData, err := ioutil.ReadFile(fallbackTmplPath) @@ -249,7 +257,7 @@ func (g *generator) renderMissingResourceDoc(providerName, name, typeName string } g.infof("generating template for %q", name) - md, err := targetResourceTemplate.Render(name, providerName, typeName, examplePath, importPath, schema) + md, err := targetResourceTemplate.Render(name, providerName, g.renderedProviderName, typeName, examplePath, importPath, schema) if err != nil { return fmt.Errorf("unable to render template for %q: %w", name, err) } @@ -267,7 +275,7 @@ func (g *generator) renderMissingProviderDoc(providerName string, schema *tfjson if err != nil { return fmt.Errorf("unable to render path for provider %q: %w", providerName, err) } - tmplPath = filepath.Join(websiteTmp, websiteSourceDir, tmplPath) + tmplPath = filepath.Join(g.websiteTmpDir, g.websiteSourceDir, tmplPath) if fileExists(tmplPath) { g.infof("provider %q template exists, skipping", providerName) return nil @@ -278,7 +286,7 @@ func (g *generator) renderMissingProviderDoc(providerName string, schema *tfjson if err != nil { return fmt.Errorf("unable to render path for provider %q: %w", providerName, err) } - candidatePath = filepath.Join(websiteTmp, websiteSourceDir, candidatePath) + candidatePath = filepath.Join(g.websiteTmpDir, g.websiteSourceDir, candidatePath) if fileExists(candidatePath) { g.infof("provider %q static file exists, skipping", providerName) return nil @@ -290,14 +298,14 @@ func (g *generator) renderMissingProviderDoc(providerName string, schema *tfjson return fmt.Errorf("unable to render example file path for %q: %w", providerName, err) } if examplePath != "" { - examplePath = filepath.Join(examplesDir, examplePath) + examplePath = filepath.Join(g.examplesDir, examplePath) } if !fileExists(examplePath) { examplePath = "" } g.infof("generating template for %q", providerName) - md, err := defaultProviderTemplate.Render(providerName, examplePath, schema) + md, err := defaultProviderTemplate.Render(providerName, g.renderedProviderName, examplePath, schema) if err != nil { return fmt.Errorf("unable to render template for %q: %w", providerName, err) } @@ -313,6 +321,10 @@ func (g *generator) renderMissingProviderDoc(providerName string, schema *tfjson func (g *generator) renderMissingDocs(providerName string, providerSchema *tfjson.ProviderSchema) error { g.infof("generating missing resource content") for name, schema := range providerSchema.ResourceSchemas { + if g.ignoreDeprecated && schema.Block.Deprecated { + continue + } + err := g.renderMissingResourceDoc(providerName, name, "Resource", schema, websiteResourceFileTemplate, websiteResourceFallbackFileTemplate, @@ -326,6 +338,10 @@ func (g *generator) renderMissingDocs(providerName string, providerSchema *tfjso g.infof("generating missing data source content") for name, schema := range providerSchema.DataSourceSchemas { + if g.ignoreDeprecated && schema.Block.Deprecated { + continue + } + err := g.renderMissingResourceDoc(providerName, name, "Data Source", schema, websiteDataSourceFileTemplate, websiteDataSourceFallbackFileTemplate, @@ -352,7 +368,7 @@ func (g *generator) renderMissingDocs(providerName string, providerSchema *tfjso func (g *generator) renderStaticWebsite(providerName string, providerSchema *tfjson.ProviderSchema) error { g.infof("cleaning rendered website dir") - err := os.RemoveAll(renderedWebsiteDir) + err := os.RemoveAll(g.renderedWebsiteDir) if err != nil { return err } @@ -361,13 +377,13 @@ func (g *generator) renderStaticWebsite(providerName string, providerSchema *tfj g.infof("rendering templated website to static markdown") - err = filepath.Walk(websiteTmp, func(path string, info os.FileInfo, err error) error { + err = filepath.Walk(g.websiteTmpDir, func(path string, info os.FileInfo, err error) error { if info.IsDir() { // skip directories return nil } - rel, err := filepath.Rel(filepath.Join(websiteTmp, websiteSourceDir), path) + rel, err := filepath.Rel(filepath.Join(g.websiteTmpDir, g.websiteSourceDir), path) if err != nil { return err } @@ -380,7 +396,7 @@ func (g *generator) renderStaticWebsite(providerName string, providerSchema *tfj return nil } - renderedPath := filepath.Join(renderedWebsiteDir, rel) + renderedPath := filepath.Join(g.renderedWebsiteDir, rel) err = os.MkdirAll(filepath.Dir(renderedPath), 0755) if err != nil { return err @@ -408,11 +424,11 @@ func (g *generator) renderStaticWebsite(providerName string, providerSchema *tfj g.infof("rendering %q", rel) switch relDir { case "data-sources/": - resName := shortName + "_" + removeAllExt(relFile) - resSchema, ok := providerSchema.DataSourceSchemas[resName] - if ok { + resSchema, resName := resourceSchema(providerSchema.DataSourceSchemas, shortName, relFile) + exampleFilePath := filepath.Join(g.examplesDir, "data-sources", resName, "data-source.tf") + if resSchema != nil { tmpl := resourceTemplate(tmplData) - render, err := tmpl.Render(resName, providerName, "Data Source", "", "", resSchema) + render, err := tmpl.Render(resName, providerName, g.renderedProviderName, "Data Source", exampleFilePath, "", resSchema) if err != nil { return fmt.Errorf("unable to render data source template %q: %w", rel, err) } @@ -422,12 +438,15 @@ func (g *generator) renderStaticWebsite(providerName string, providerSchema *tfj } return nil } + g.warnf("data source entitled %q, or %q does not exist", shortName, resName) case "resources/": - resName := shortName + "_" + removeAllExt(relFile) - resSchema, ok := providerSchema.ResourceSchemas[resName] - if ok { + resSchema, resName := resourceSchema(providerSchema.ResourceSchemas, shortName, relFile) + exampleFilePath := filepath.Join(g.examplesDir, "resources", resName, "resource.tf") + importFilePath := filepath.Join(g.examplesDir, "resources", resName, "import.sh") + + if resSchema != nil { tmpl := resourceTemplate(tmplData) - render, err := tmpl.Render(resName, providerName, "Resource", "", "", resSchema) + render, err := tmpl.Render(resName, providerName, g.renderedProviderName, "Resource", exampleFilePath, importFilePath, resSchema) if err != nil { return fmt.Errorf("unable to render resource template %q: %w", rel, err) } @@ -437,10 +456,12 @@ func (g *generator) renderStaticWebsite(providerName string, providerSchema *tfj } return nil } + g.warnf("resource entitled %q, or %q does not exist", shortName, resName) case "": // provider if relFile == "index.md.tmpl" { tmpl := providerTemplate(tmplData) - render, err := tmpl.Render(providerName, "", providerSchema.ConfigSchema) + exampleFilePath := filepath.Join(g.examplesDir, "provider", "provider.tf") + render, err := tmpl.Render(providerName, g.renderedProviderName, exampleFilePath, providerSchema.ConfigSchema) if err != nil { return fmt.Errorf("unable to render provider template %q: %w", rel, err) } @@ -505,7 +526,7 @@ provider %[1]q { } i := install.NewInstaller() - sources := []src.Source{} + var sources []src.Source if g.tfVersion != "" { g.infof("downloading Terraform CLI binary version from releases.hashicorp.com: %s", g.tfVersion) sources = []src.Source{ diff --git a/vendor/github.com/hashicorp/terraform-plugin-docs/internal/provider/template.go b/vendor/github.com/hashicorp/terraform-plugin-docs/internal/provider/template.go index 4f1d24a..dcc1e54 100644 --- a/vendor/github.com/hashicorp/terraform-plugin-docs/internal/provider/template.go +++ b/vendor/github.com/hashicorp/terraform-plugin-docs/internal/provider/template.go @@ -7,7 +7,11 @@ import ( "strings" "text/template" + "golang.org/x/text/cases" + "golang.org/x/text/language" + tfjson "github.com/hashicorp/terraform-json" + "github.com/hashicorp/terraform-plugin-docs/internal/mdplain" "github.com/hashicorp/terraform-plugin-docs/internal/tmplfuncs" "github.com/hashicorp/terraform-plugin-docs/schemamd" @@ -30,17 +34,19 @@ type ( func newTemplate(name, text string) (*template.Template, error) { tmpl := template.New(name) + titleCaser := cases.Title(language.Und) - tmpl.Funcs(template.FuncMap(map[string]interface{}{ + tmpl.Funcs(map[string]interface{}{ "codefile": tmplfuncs.CodeFile, + "lower": strings.ToLower, "plainmarkdown": mdplain.PlainMarkdown, "prefixlines": tmplfuncs.PrefixLines, - "tffile": func(file string) (string, error) { - // TODO: omit comment handling - return tmplfuncs.CodeFile("terraform", file) - }, - "trimspace": strings.TrimSpace, - })) + "split": strings.Split, + "tffile": terraformCodeFile, + "title": titleCaser.String, + "trimspace": strings.TrimSpace, + "upper": strings.ToUpper, + }) var err error tmpl, err = tmpl.Parse(text) @@ -51,6 +57,11 @@ func newTemplate(name, text string) (*template.Template, error) { return tmpl, nil } +func terraformCodeFile(file string) (string, error) { + // TODO: omit comment handling + return tmplfuncs.CodeFile("terraform", file) +} + func renderTemplate(name string, text string, out io.Writer, data interface{}) error { tmpl, err := newTemplate(name, text) if err != nil { @@ -116,7 +127,7 @@ func (t providerFileTemplate) Render(name string) (string, error) { }{name, providerShortName(name)}) } -func (t providerTemplate) Render(providerName, exampleFile string, schema *tfjson.Schema) (string, error) { +func (t providerTemplate) Render(providerName, renderedProviderName, exampleFile string, schema *tfjson.Schema) (string, error) { schemaBuffer := bytes.NewBuffer(nil) err := schemamd.Render(schema, schemaBuffer) if err != nil { @@ -128,34 +139,33 @@ func (t providerTemplate) Render(providerName, exampleFile string, schema *tfjso return "", nil } return renderStringTemplate("providerTemplate", s, struct { - Type string - Name string Description string HasExample bool ExampleFile string - HasImport bool - ImportFile string - ProviderName string ProviderShortName string SchemaMarkdown string + + RenderedProviderName string }{ Description: schema.Block.Description, - HasExample: exampleFile != "", + HasExample: exampleFile != "" && fileExists(exampleFile), ExampleFile: exampleFile, ProviderName: providerName, ProviderShortName: providerShortName(providerName), SchemaMarkdown: schemaComment + "\n" + schemaBuffer.String(), + + RenderedProviderName: renderedProviderName, }) } -func (t resourceTemplate) Render(name, providerName, typeName, exampleFile, importFile string, schema *tfjson.Schema) (string, error) { +func (t resourceTemplate) Render(name, providerName, renderedProviderName, typeName, exampleFile, importFile string, schema *tfjson.Schema) (string, error) { schemaBuffer := bytes.NewBuffer(nil) err := schemamd.Render(schema, schemaBuffer) if err != nil { @@ -182,21 +192,25 @@ func (t resourceTemplate) Render(name, providerName, typeName, exampleFile, impo ProviderShortName string SchemaMarkdown string + + RenderedProviderName string }{ Type: typeName, Name: name, Description: schema.Block.Description, - HasExample: exampleFile != "", + HasExample: exampleFile != "" && fileExists(exampleFile), ExampleFile: exampleFile, - HasImport: importFile != "", + HasImport: importFile != "" && fileExists(importFile), ImportFile: importFile, ProviderName: providerName, ProviderShortName: providerShortName(providerName), SchemaMarkdown: schemaComment + "\n" + schemaBuffer.String(), + + RenderedProviderName: renderedProviderName, }) } diff --git a/vendor/github.com/hashicorp/terraform-plugin-docs/internal/provider/util.go b/vendor/github.com/hashicorp/terraform-plugin-docs/internal/provider/util.go index 052ddd8..1de2ed4 100644 --- a/vendor/github.com/hashicorp/terraform-plugin-docs/internal/provider/util.go +++ b/vendor/github.com/hashicorp/terraform-plugin-docs/internal/provider/util.go @@ -9,6 +9,8 @@ import ( "os/exec" "path/filepath" "strings" + + tfjson "github.com/hashicorp/terraform-json" ) func providerShortName(n string) string { @@ -52,6 +54,23 @@ func removeAllExt(file string) string { } } +// resourceSchema determines whether there is a schema in the supplied schemas map which +// has either the providerShortName or the providerShortName concatenated with the +// templateFileName (stripped of file extension. +func resourceSchema(schemas map[string]*tfjson.Schema, providerShortName, templateFileName string) (*tfjson.Schema, string) { + if schema, ok := schemas[providerShortName]; ok { + return schema, providerShortName + } + + resName := providerShortName + "_" + removeAllExt(templateFileName) + + if schema, ok := schemas[resName]; ok { + return schema, resName + } + + return nil, resName +} + func writeFile(path string, data string) error { dir, _ := filepath.Split(path) err := os.MkdirAll(dir, 0755) diff --git a/vendor/github.com/hashicorp/terraform-plugin-docs/schemamd/behaviors.go b/vendor/github.com/hashicorp/terraform-plugin-docs/schemamd/behaviors.go index 88fd7b0..954225e 100644 --- a/vendor/github.com/hashicorp/terraform-plugin-docs/schemamd/behaviors.go +++ b/vendor/github.com/hashicorp/terraform-plugin-docs/schemamd/behaviors.go @@ -16,12 +16,17 @@ func childAttributeIsOptional(att *tfjson.SchemaAttribute) bool { return att.Optional } -// childBlockIsOptional returns true for blocks with with min items 0 and any required or optional children. +// childBlockIsOptional returns true for blocks with with min items 0 +// which are either empty or have any required or optional children. func childBlockIsOptional(block *tfjson.SchemaBlockType) bool { if block.MinItems > 0 { return false } + if len(block.Block.NestedBlocks) == 0 && len(block.Block.Attributes) == 0 { + return true + } + for _, childBlock := range block.Block.NestedBlocks { if childBlockIsRequired(childBlock) { return true diff --git a/vendor/github.com/hashicorp/terraform-plugin-docs/schemamd/render.go b/vendor/github.com/hashicorp/terraform-plugin-docs/schemamd/render.go index 68568c6..df46a76 100644 --- a/vendor/github.com/hashicorp/terraform-plugin-docs/schemamd/render.go +++ b/vendor/github.com/hashicorp/terraform-plugin-docs/schemamd/render.go @@ -70,10 +70,6 @@ func writeAttribute(w io.Writer, path []string, att *tfjson.SchemaAttribute, gro return nil, err } - if name == "id" && att.Description == "" { - att.Description = "The ID of this resource." - } - if att.AttributeNestedType == nil { err = WriteAttributeDescription(w, att, false) } else { @@ -225,7 +221,18 @@ nameLoop: } } else if childAtt, ok := block.Attributes[n]; ok { for i, gf := range groupFilters { - if gf.filterAttribute(childAtt) { + // By default, the attribute `id` is place in the "Read-Only" group + // if the provider schema contained no `.Description` for it. + // + // If a `.Description` is provided instead, the behaviour will be the + // same as for every other attribute. + if strings.ToLower(n) == "id" && childAtt.Description == "" { + if strings.Contains(gf.topLevelTitle, "Read-Only") { + childAtt.Description = "The ID of this resource." + groups[i] = append(groups[i], n) + continue nameLoop + } + } else if gf.filterAttribute(childAtt) { groups[i] = append(groups[i], n) continue nameLoop } @@ -286,7 +293,9 @@ nameLoop: } for _, name := range sortedNames { - path := append(parents, name) + path := make([]string, len(parents), len(parents)+1) + copy(path, parents) + path = append(path, name) if childBlock, ok := block.NestedBlocks[name]; ok { nt, err := writeBlockType(w, path, childBlock) @@ -466,36 +475,55 @@ func writeObjectChildren(w io.Writer, parents []string, ty cty.Type, group group } func writeNestedAttributeChildren(w io.Writer, parents []string, nestedAttributes *tfjson.SchemaNestedAttributeType, group groupFilter) error { - _, err := io.WriteString(w, group.nestedTitle+"\n\n") - if err != nil { - return err - } - sortedNames := []string{} for n := range nestedAttributes.Attributes { sortedNames = append(sortedNames, n) } sort.Strings(sortedNames) - nestedTypes := []nestedType{} + groups := map[int][]string{} for _, name := range sortedNames { att := nestedAttributes.Attributes[name] - path := append(parents, name) - nt, err := writeAttribute(w, path, att, group) + for i, gf := range groupFilters { + if gf.filterAttribute(att) { + groups[i] = append(groups[i], name) + } + } + } + + nestedTypes := []nestedType{} + + for i, gf := range groupFilters { + names, ok := groups[i] + if !ok || len(names) == 0 { + continue + } + + _, err := io.WriteString(w, gf.nestedTitle+"\n\n") if err != nil { - return fmt.Errorf("unable to render attribute %q: %w", name, err) + return err } - nestedTypes = append(nestedTypes, nt...) - } + for _, name := range names { + att := nestedAttributes.Attributes[name] + path := append(parents, name) - _, err = io.WriteString(w, "\n") - if err != nil { - return err + nt, err := writeAttribute(w, path, att, group) + if err != nil { + return fmt.Errorf("unable to render attribute %q: %w", name, err) + } + + nestedTypes = append(nestedTypes, nt...) + } + + _, err = io.WriteString(w, "\n") + if err != nil { + return err + } } - err = writeNestedTypes(w, nestedTypes) + err := writeNestedTypes(w, nestedTypes) if err != nil { return err } diff --git a/vendor/github.com/imdario/mergo/README.md b/vendor/github.com/imdario/mergo/README.md index aa8cbd7..7e6f7ae 100644 --- a/vendor/github.com/imdario/mergo/README.md +++ b/vendor/github.com/imdario/mergo/README.md @@ -8,8 +8,7 @@ [![Coverage Status][9]][10] [![Sourcegraph][11]][12] [![FOSSA Status][13]][14] - -[![GoCenter Kudos][15]][16] +[![Become my sponsor][15]][16] [1]: https://travis-ci.org/imdario/mergo.png [2]: https://travis-ci.org/imdario/mergo @@ -25,8 +24,8 @@ [12]: https://sourcegraph.com/github.com/imdario/mergo?badge [13]: https://app.fossa.io/api/projects/git%2Bgithub.com%2Fimdario%2Fmergo.svg?type=shield [14]: https://app.fossa.io/projects/git%2Bgithub.com%2Fimdario%2Fmergo?ref=badge_shield -[15]: https://search.gocenter.io/api/ui/badge/github.com%2Fimdario%2Fmergo -[16]: https://search.gocenter.io/github.com/imdario/mergo +[15]: https://img.shields.io/github/sponsors/imdario +[16]: https://github.com/sponsors/imdario A helper to merge structs and maps in Golang. Useful for configuration default values, avoiding messy if-statements. @@ -36,11 +35,11 @@ Also a lovely [comune](http://en.wikipedia.org/wiki/Mergo) (municipality) in the ## Status -It is ready for production use. [It is used in several projects by Docker, Google, The Linux Foundation, VMWare, Shopify, etc](https://github.com/imdario/mergo#mergo-in-the-wild). +It is ready for production use. [It is used in several projects by Docker, Google, The Linux Foundation, VMWare, Shopify, Microsoft, etc](https://github.com/imdario/mergo#mergo-in-the-wild). ### Important note -Please keep in mind that a problematic PR broke [0.3.9](//github.com/imdario/mergo/releases/tag/0.3.9). I reverted it in [0.3.10](//github.com/imdario/mergo/releases/tag/0.3.10), and I consider it stable but not bug-free. Also, this version adds suppot for go modules. +Please keep in mind that a problematic PR broke [0.3.9](//github.com/imdario/mergo/releases/tag/0.3.9). I reverted it in [0.3.10](//github.com/imdario/mergo/releases/tag/0.3.10), and I consider it stable but not bug-free. Also, this version adds support for go modules. Keep in mind that in [0.3.2](//github.com/imdario/mergo/releases/tag/0.3.2), Mergo changed `Merge()`and `Map()` signatures to support [transformers](#transformers). I added an optional/variadic argument so that it won't break the existing code. @@ -51,12 +50,12 @@ If you were using Mergo before April 6th, 2015, please check your project works If Mergo is useful to you, consider buying me a coffee, a beer, or making a monthly donation to allow me to keep building great free software. :heart_eyes: Buy Me a Coffee at ko-fi.com -[![Beerpay](https://beerpay.io/imdario/mergo/badge.svg)](https://beerpay.io/imdario/mergo) -[![Beerpay](https://beerpay.io/imdario/mergo/make-wish.svg)](https://beerpay.io/imdario/mergo) Donate using Liberapay +Become my sponsor ### Mergo in the wild +- [cli/cli](https://github.com/cli/cli) - [moby/moby](https://github.com/moby/moby) - [kubernetes/kubernetes](https://github.com/kubernetes/kubernetes) - [vmware/dispatch](https://github.com/vmware/dispatch) @@ -98,6 +97,8 @@ If Mergo is useful to you, consider buying me a coffee, a beer, or making a mont - [jnuthong/item_search](https://github.com/jnuthong/item_search) - [bukalapak/snowboard](https://github.com/bukalapak/snowboard) - [containerssh/containerssh](https://github.com/containerssh/containerssh) +- [goreleaser/goreleaser](https://github.com/goreleaser/goreleaser) +- [tjpnz/structbot](https://github.com/tjpnz/structbot) ## Install @@ -168,7 +169,7 @@ func main() { Note: if test are failing due missing package, please execute: - go get gopkg.in/yaml.v2 + go get gopkg.in/yaml.v3 ### Transformers @@ -218,7 +219,6 @@ func main() { } ``` - ## Contact me If I can help you, you have an idea or you are using Mergo in your projects, don't hesitate to drop me a line (or a pull request): [@im_dario](https://twitter.com/im_dario) @@ -227,18 +227,6 @@ If I can help you, you have an idea or you are using Mergo in your projects, don Written by [Dario Castañé](http://dario.im). -## Top Contributors - -[![0](https://sourcerer.io/fame/imdario/imdario/mergo/images/0)](https://sourcerer.io/fame/imdario/imdario/mergo/links/0) -[![1](https://sourcerer.io/fame/imdario/imdario/mergo/images/1)](https://sourcerer.io/fame/imdario/imdario/mergo/links/1) -[![2](https://sourcerer.io/fame/imdario/imdario/mergo/images/2)](https://sourcerer.io/fame/imdario/imdario/mergo/links/2) -[![3](https://sourcerer.io/fame/imdario/imdario/mergo/images/3)](https://sourcerer.io/fame/imdario/imdario/mergo/links/3) -[![4](https://sourcerer.io/fame/imdario/imdario/mergo/images/4)](https://sourcerer.io/fame/imdario/imdario/mergo/links/4) -[![5](https://sourcerer.io/fame/imdario/imdario/mergo/images/5)](https://sourcerer.io/fame/imdario/imdario/mergo/links/5) -[![6](https://sourcerer.io/fame/imdario/imdario/mergo/images/6)](https://sourcerer.io/fame/imdario/imdario/mergo/links/6) -[![7](https://sourcerer.io/fame/imdario/imdario/mergo/images/7)](https://sourcerer.io/fame/imdario/imdario/mergo/links/7) - - ## License [BSD 3-Clause](http://opensource.org/licenses/BSD-3-Clause) license, as [Go language](http://golang.org/LICENSE). diff --git a/vendor/github.com/imdario/mergo/merge.go b/vendor/github.com/imdario/mergo/merge.go index 8c2a8fc..8b4e2f4 100644 --- a/vendor/github.com/imdario/mergo/merge.go +++ b/vendor/github.com/imdario/mergo/merge.go @@ -79,7 +79,7 @@ func deepMerge(dst, src reflect.Value, visited map[uintptr]*visit, depth int, co visited[h] = &visit{addr, typ, seen} } - if config.Transformers != nil && !isEmptyValue(dst) { + if config.Transformers != nil && !isReflectNil(dst) && dst.IsValid() { if fn := config.Transformers.Transformer(dst.Type()); fn != nil { err = fn(dst, src) return diff --git a/vendor/github.com/imdario/mergo/mergo.go b/vendor/github.com/imdario/mergo/mergo.go index 3cc926c..9fe362d 100644 --- a/vendor/github.com/imdario/mergo/mergo.go +++ b/vendor/github.com/imdario/mergo/mergo.go @@ -17,7 +17,7 @@ import ( var ( ErrNilArguments = errors.New("src and dst must not be nil") ErrDifferentArgumentsTypes = errors.New("src and dst must be of same type") - ErrNotSupported = errors.New("only structs and maps are supported") + ErrNotSupported = errors.New("only structs, maps, and slices are supported") ErrExpectedMapAsDestination = errors.New("dst was expected to be a map") ErrExpectedStructAsDestination = errors.New("dst was expected to be a struct") ErrNonPointerAgument = errors.New("dst must be a pointer") @@ -65,7 +65,7 @@ func resolveValues(dst, src interface{}) (vDst, vSrc reflect.Value, err error) { return } vDst = reflect.ValueOf(dst).Elem() - if vDst.Kind() != reflect.Struct && vDst.Kind() != reflect.Map { + if vDst.Kind() != reflect.Struct && vDst.Kind() != reflect.Map && vDst.Kind() != reflect.Slice { err = ErrNotSupported return } diff --git a/vendor/github.com/mitchellh/cli/.travis.yml b/vendor/github.com/mitchellh/cli/.travis.yml deleted file mode 100644 index 155ebfa..0000000 --- a/vendor/github.com/mitchellh/cli/.travis.yml +++ /dev/null @@ -1,16 +0,0 @@ -sudo: false - -language: go - -env: - - GO111MODULE=on - -go: - - "1.14" - - "1.15" - -branches: - only: - - master - -script: make updatedeps test testrace diff --git a/vendor/github.com/mitchellh/cli/README.md b/vendor/github.com/mitchellh/cli/README.md index 8f02cdd..d75ff86 100644 --- a/vendor/github.com/mitchellh/cli/README.md +++ b/vendor/github.com/mitchellh/cli/README.md @@ -1,13 +1,12 @@ -# Go CLI Library [![GoDoc](https://godoc.org/github.com/mitchellh/cli?status.png)](https://godoc.org/github.com/mitchellh/cli) +# Go CLI Library [![GoDoc](https://godoc.org/github.com/mitchellh/cli?status.png)](https://pkg.go.dev/github.com/mitchellh/cli) -cli is a library for implementing powerful command-line interfaces in Go. +cli is a library for implementing command-line interfaces in Go. cli is the library that powers the CLI for [Packer](https://github.com/mitchellh/packer), -[Serf](https://github.com/hashicorp/serf), [Consul](https://github.com/hashicorp/consul), [Vault](https://github.com/hashicorp/vault), -[Terraform](https://github.com/hashicorp/terraform), and -[Nomad](https://github.com/hashicorp/nomad). +[Terraform](https://github.com/hashicorp/terraform), +[Nomad](https://github.com/hashicorp/nomad), and more. ## Features @@ -21,7 +20,7 @@ cli is the library that powers the CLI for * Support for shell autocompletion of subcommands, flags, and arguments with callbacks in Go. You don't need to write any shell code. -* Automatic help generation for listing subcommands +* Automatic help generation for listing subcommands. * Automatic help flag recognition of `-h`, `--help`, etc. diff --git a/vendor/github.com/mitchellh/cli/cli.go b/vendor/github.com/mitchellh/cli/cli.go index 31fafa0..9520532 100644 --- a/vendor/github.com/mitchellh/cli/cli.go +++ b/vendor/github.com/mitchellh/cli/cli.go @@ -11,7 +11,7 @@ import ( "sync" "text/template" - "github.com/Masterminds/sprig" + "github.com/Masterminds/sprig/v3" "github.com/armon/go-radix" "github.com/posener/complete" ) @@ -680,12 +680,13 @@ func (c *CLI) processArgs() { } // Determine the argument we look to to end subcommands. - // We look at all arguments until one has a space. This - // disallows commands like: ./cli foo "bar baz". An argument - // with a space is always an argument. + // We look at all arguments until one is a flag or has a space. + // This disallows commands like: ./cli foo "bar baz". An + // argument with a space is always an argument. A blank + // argument is always an argument. j := 0 for k, v := range c.Args[i:] { - if strings.ContainsRune(v, ' ') { + if strings.ContainsRune(v, ' ') || v == "" || v[0] == '-' { break } diff --git a/vendor/github.com/posener/complete/.gitignore b/vendor/github.com/posener/complete/.gitignore index 1363720..293955f 100644 --- a/vendor/github.com/posener/complete/.gitignore +++ b/vendor/github.com/posener/complete/.gitignore @@ -1,2 +1,4 @@ .idea coverage.txt +gocomplete/gocomplete +example/self/self diff --git a/vendor/github.com/posener/complete/.travis.yml b/vendor/github.com/posener/complete/.travis.yml index c2798f8..6ba8d86 100644 --- a/vendor/github.com/posener/complete/.travis.yml +++ b/vendor/github.com/posener/complete/.travis.yml @@ -1,17 +1,16 @@ language: go -sudo: false go: - - 1.9 - - 1.8 - -before_install: - - go get -u -t ./... - - go get -u gopkg.in/alecthomas/gometalinter.v1 - - gometalinter.v1 --install + - tip + - 1.12.x + - 1.11.x + - 1.10.x script: - - gometalinter.v1 --config metalinter.json ./... - - ./test.sh + - go test -race -coverprofile=coverage.txt -covermode=atomic ./... after_success: - bash <(curl -s https://codecov.io/bash) + +matrix: + allow_failures: + - go: tip \ No newline at end of file diff --git a/vendor/github.com/posener/complete/readme.md b/vendor/github.com/posener/complete/README.md similarity index 74% rename from vendor/github.com/posener/complete/readme.md rename to vendor/github.com/posener/complete/README.md index 2a999ba..dcc6c89 100644 --- a/vendor/github.com/posener/complete/readme.md +++ b/vendor/github.com/posener/complete/README.md @@ -1,27 +1,29 @@ # complete -A tool for bash writing bash completion in go, and bash completion for the go command line. - [![Build Status](https://travis-ci.org/posener/complete.svg?branch=master)](https://travis-ci.org/posener/complete) [![codecov](https://codecov.io/gh/posener/complete/branch/master/graph/badge.svg)](https://codecov.io/gh/posener/complete) +[![golangci](https://golangci.com/badges/github.com/posener/complete.svg)](https://golangci.com/r/github.com/posener/complete) [![GoDoc](https://godoc.org/github.com/posener/complete?status.svg)](http://godoc.org/github.com/posener/complete) -[![Go Report Card](https://goreportcard.com/badge/github.com/posener/complete)](https://goreportcard.com/report/github.com/posener/complete) +[![goreadme](https://goreadme.herokuapp.com/badge/posener/complete.svg)](https://goreadme.herokuapp.com) + +Package complete provides a tool for bash writing bash completion in go, and bash completion for the go command line. Writing bash completion scripts is a hard work. This package provides an easy way to create bash completion scripts for any command, and also an easy way to install/uninstall the completion of the command. -## go command bash completion +#### Go Command Bash Completion -In [gocomplete](./gocomplete) there is an example for bash completion for the `go` command line. +In [./cmd/gocomplete](./cmd/gocomplete) there is an example for bash completion for the `go` command line. This is an example that uses the `complete` package on the `go` command - the `complete` package -can also be used to implement any completions, see [Usage](#usage). +can also be used to implement any completions, see #usage. -### Install +#### Install 1. Type in your shell: -``` + +```go go get -u github.com/posener/complete/gocomplete gocomplete -install ``` @@ -30,13 +32,13 @@ gocomplete -install Uninstall by `gocomplete -uninstall` -### Features +#### Features - Complete `go` command, including sub commands and all flags. - Complete packages names or `.go` files when necessary. - Complete test names after `-run` flag. -## complete package +#### Complete package Supported shells: @@ -44,7 +46,7 @@ Supported shells: - [x] zsh - [x] fish -### Usage +#### Usage Assuming you have program called `run` and you want to have bash completion for it, meaning, if you type `run` then space, then press the `Tab` key, @@ -52,7 +54,7 @@ the shell will suggest relevant complete options. In that case, we will create a program called `runcomplete`, a go program, with a `func main()` and so, that will make the completion of the `run` -program. Once the `runcomplete` will be in a binary form, we could +program. Once the `runcomplete` will be in a binary form, we could `runcomplete -install` and that will add to our shell all the bash completion options for `run`. @@ -109,9 +111,21 @@ func main() { } ``` -### Self completing program +#### Self completing program In case that the program that we want to complete is written in go we can make it self completing. +Here is an example: [./example/self/main.go](./example/self/main.go) . + +## Sub Packages + +* [cmd](./cmd): Package cmd used for command line options for the complete tool + +* [gocomplete](./gocomplete): Package main is complete tool for the go command line + +* [match](./match): Package match contains matchers that decide if to apply completion. + + +--- -Here is an [example](./example/self/main.go) +Created by [goreadme](https://github.com/apps/goreadme) diff --git a/vendor/github.com/posener/complete/args.go b/vendor/github.com/posener/complete/args.go index 1ba4d69..3340285 100644 --- a/vendor/github.com/posener/complete/args.go +++ b/vendor/github.com/posener/complete/args.go @@ -28,6 +28,8 @@ type Args struct { // Directory gives the directory of the current written // last argument if it represents a file name being written. // in case that it is not, we fall back to the current directory. +// +// Deprecated. func (a Args) Directory() string { if info, err := os.Stat(a.Last); err == nil && info.IsDir() { return fixPathForm(a.Last, a.Last) @@ -57,11 +59,20 @@ func newArgs(line string) Args { } } +// splitFields returns a list of fields from the given command line. +// If the last character is space, it appends an empty field in the end +// indicating that the field before it was completed. +// If the last field is of the form "a=b", it splits it to two fields: "a", "b", +// So it can be completed. func splitFields(line string) []string { parts := strings.Fields(line) + + // Add empty field if the last field was completed. if len(line) > 0 && unicode.IsSpace(rune(line[len(line)-1])) { parts = append(parts, "") } + + // Treat the last field if it is of the form "a=b" parts = splitLastEqual(parts) return parts } @@ -74,16 +85,17 @@ func splitLastEqual(line []string) []string { return append(line[:len(line)-1], parts...) } +// from returns a copy of Args of all arguments after the i'th argument. func (a Args) from(i int) Args { - if i > len(a.All) { - i = len(a.All) + if i >= len(a.All) { + i = len(a.All) - 1 } - a.All = a.All[i:] + a.All = a.All[i+1:] - if i > len(a.Completed) { - i = len(a.Completed) + if i >= len(a.Completed) { + i = len(a.Completed) - 1 } - a.Completed = a.Completed[i:] + a.Completed = a.Completed[i+1:] return a } diff --git a/vendor/github.com/posener/complete/cmd/cmd.go b/vendor/github.com/posener/complete/cmd/cmd.go index 7137dee..b99fe52 100644 --- a/vendor/github.com/posener/complete/cmd/cmd.go +++ b/vendor/github.com/posener/complete/cmd/cmd.go @@ -103,7 +103,7 @@ func (f *CLI) AddFlags(flags *flag.FlagSet) { fmt.Sprintf("Uninstall completion for %s command", f.Name)) } if flags.Lookup("y") == nil { - flags.BoolVar(&f.yes, "y", false, "Don't prompt user for typing 'yes'") + flags.BoolVar(&f.yes, "y", false, "Don't prompt user for typing 'yes' when installing completion") } } diff --git a/vendor/github.com/posener/complete/cmd/install/bash.go b/vendor/github.com/posener/complete/cmd/install/bash.go index a287f99..17c64de 100644 --- a/vendor/github.com/posener/complete/cmd/install/bash.go +++ b/vendor/github.com/posener/complete/cmd/install/bash.go @@ -10,20 +10,25 @@ type bash struct { rc string } -func (b bash) Install(cmd, bin string) error { +func (b bash) IsInstalled(cmd, bin string) bool { completeCmd := b.cmd(cmd, bin) - if lineInFile(b.rc, completeCmd) { + return lineInFile(b.rc, completeCmd) +} + +func (b bash) Install(cmd, bin string) error { + if b.IsInstalled(cmd, bin) { return fmt.Errorf("already installed in %s", b.rc) } + completeCmd := b.cmd(cmd, bin) return appendToFile(b.rc, completeCmd) } func (b bash) Uninstall(cmd, bin string) error { - completeCmd := b.cmd(cmd, bin) - if !lineInFile(b.rc, completeCmd) { + if !b.IsInstalled(cmd, bin) { return fmt.Errorf("does not installed in %s", b.rc) } + completeCmd := b.cmd(cmd, bin) return removeFromFile(b.rc, completeCmd) } diff --git a/vendor/github.com/posener/complete/cmd/install/fish.go b/vendor/github.com/posener/complete/cmd/install/fish.go index f04e7c3..2b64bfc 100644 --- a/vendor/github.com/posener/complete/cmd/install/fish.go +++ b/vendor/github.com/posener/complete/cmd/install/fish.go @@ -14,37 +14,56 @@ type fish struct { configDir string } -func (f fish) Install(cmd, bin string) error { - completionFile := filepath.Join(f.configDir, "completions", fmt.Sprintf("%s.fish", cmd)) - completeCmd := f.cmd(cmd, bin) +func (f fish) IsInstalled(cmd, bin string) bool { + completionFile := f.getCompletionFilePath(cmd) if _, err := os.Stat(completionFile); err == nil { - return fmt.Errorf("already installed at %s", completionFile) + return true + } + return false +} + +func (f fish) Install(cmd, bin string) error { + if f.IsInstalled(cmd, bin) { + return fmt.Errorf("already installed at %s", f.getCompletionFilePath(cmd)) + } + + completionFile := f.getCompletionFilePath(cmd) + completeCmd, err := f.cmd(cmd, bin) + if err != nil { + return err } return createFile(completionFile, completeCmd) } func (f fish) Uninstall(cmd, bin string) error { - completionFile := filepath.Join(f.configDir, "completions", fmt.Sprintf("%s.fish", cmd)) - if _, err := os.Stat(completionFile); err != nil { + if !f.IsInstalled(cmd, bin) { return fmt.Errorf("does not installed in %s", f.configDir) } + completionFile := f.getCompletionFilePath(cmd) return os.Remove(completionFile) } -func (f fish) cmd(cmd, bin string) string { +func (f fish) getCompletionFilePath(cmd string) string { + return filepath.Join(f.configDir, "completions", fmt.Sprintf("%s.fish", cmd)) +} + +func (f fish) cmd(cmd, bin string) (string, error) { var buf bytes.Buffer params := struct{ Cmd, Bin string }{cmd, bin} - template.Must(template.New("cmd").Parse(` + tmpl := template.Must(template.New("cmd").Parse(` function __complete_{{.Cmd}} - set -lx COMP_LINE (string join ' ' (commandline -o)) - test (commandline -ct) = "" + set -lx COMP_LINE (commandline -cp) + test -z (commandline -ct) and set COMP_LINE "$COMP_LINE " {{.Bin}} end -complete -c {{.Cmd}} -a "(__complete_{{.Cmd}})" -`)).Execute(&buf, params) - - return string(buf.Bytes()) +complete -f -c {{.Cmd}} -a "(__complete_{{.Cmd}})" +`)) + err := tmpl.Execute(&buf, params) + if err != nil { + return "", err + } + return buf.String(), nil } diff --git a/vendor/github.com/posener/complete/cmd/install/install.go b/vendor/github.com/posener/complete/cmd/install/install.go index 4a70624..884c23f 100644 --- a/vendor/github.com/posener/complete/cmd/install/install.go +++ b/vendor/github.com/posener/complete/cmd/install/install.go @@ -5,11 +5,13 @@ import ( "os" "os/user" "path/filepath" + "runtime" "github.com/hashicorp/go-multierror" ) type installer interface { + IsInstalled(cmd, bin string) bool Install(cmd, bin string) error Uninstall(cmd, bin string) error } @@ -36,6 +38,24 @@ func Install(cmd string) error { return err } +// IsInstalled returns true if the completion +// for the given cmd is installed. +func IsInstalled(cmd string) bool { + bin, err := getBinaryPath() + if err != nil { + return false + } + + for _, i := range installers() { + installed := i.IsInstalled(cmd, bin) + if installed { + return true + } + } + + return false +} + // Uninstall complete command given: // cmd: is the command name func Uninstall(cmd string) error { @@ -51,7 +71,7 @@ func Uninstall(cmd string) error { for _, i := range is { errI := i.Uninstall(cmd, bin) if errI != nil { - multierror.Append(err, errI) + err = multierror.Append(err, errI) } } @@ -59,7 +79,16 @@ func Uninstall(cmd string) error { } func installers() (i []installer) { - for _, rc := range [...]string{".bashrc", ".bash_profile", ".bash_login", ".profile"} { + // The list of bash config files candidates where it is + // possible to install the completion command. + var bashConfFiles []string + switch runtime.GOOS { + case "darwin": + bashConfFiles = []string{".bash_profile"} + default: + bashConfFiles = []string{".bashrc", ".bash_profile", ".bash_login", ".profile"} + } + for _, rc := range bashConfFiles { if f := rcFile(rc); f != "" { i = append(i, bash{f}) break diff --git a/vendor/github.com/posener/complete/cmd/install/utils.go b/vendor/github.com/posener/complete/cmd/install/utils.go index bb709bc..d34ac8c 100644 --- a/vendor/github.com/posener/complete/cmd/install/utils.go +++ b/vendor/github.com/posener/complete/cmd/install/utils.go @@ -115,7 +115,10 @@ func removeContentToTempFile(name, content string) (string, error) { if str == content { continue } - wf.WriteString(str + "\n") + _, err = wf.WriteString(str + "\n") + if err != nil { + return "", err + } prefix = prefix[:0] } return wf.Name(), nil diff --git a/vendor/github.com/posener/complete/cmd/install/zsh.go b/vendor/github.com/posener/complete/cmd/install/zsh.go index a625f53..29950ab 100644 --- a/vendor/github.com/posener/complete/cmd/install/zsh.go +++ b/vendor/github.com/posener/complete/cmd/install/zsh.go @@ -11,12 +11,17 @@ type zsh struct { rc string } -func (z zsh) Install(cmd, bin string) error { +func (z zsh) IsInstalled(cmd, bin string) bool { completeCmd := z.cmd(cmd, bin) - if lineInFile(z.rc, completeCmd) { + return lineInFile(z.rc, completeCmd) +} + +func (z zsh) Install(cmd, bin string) error { + if z.IsInstalled(cmd, bin) { return fmt.Errorf("already installed in %s", z.rc) } + completeCmd := z.cmd(cmd, bin) bashCompInit := "autoload -U +X bashcompinit && bashcompinit" if !lineInFile(z.rc, bashCompInit) { completeCmd = bashCompInit + "\n" + completeCmd @@ -26,11 +31,11 @@ func (z zsh) Install(cmd, bin string) error { } func (z zsh) Uninstall(cmd, bin string) error { - completeCmd := z.cmd(cmd, bin) - if !lineInFile(z.rc, completeCmd) { + if !z.IsInstalled(cmd, bin) { return fmt.Errorf("does not installed in %s", z.rc) } + completeCmd := z.cmd(cmd, bin) return removeFromFile(z.rc, completeCmd) } diff --git a/vendor/github.com/posener/complete/complete.go b/vendor/github.com/posener/complete/complete.go index 185d1e8..423cbec 100644 --- a/vendor/github.com/posener/complete/complete.go +++ b/vendor/github.com/posener/complete/complete.go @@ -1,8 +1,3 @@ -// Package complete provides a tool for bash writing bash completion in go. -// -// Writing bash completion scripts is a hard work. This package provides an easy way -// to create bash completion scripts for any command, and also an easy way to install/uninstall -// the completion of the command. package complete import ( @@ -10,14 +5,16 @@ import ( "fmt" "io" "os" + "strconv" + "strings" "github.com/posener/complete/cmd" - "github.com/posener/complete/match" ) const ( - envComplete = "COMP_LINE" - envDebug = "COMP_DEBUG" + envLine = "COMP_LINE" + envPoint = "COMP_POINT" + envDebug = "COMP_DEBUG" ) // Complete structs define completion for a command with CLI options @@ -55,13 +52,18 @@ func (c *Complete) Run() bool { // For installation: it assumes that flags were added and parsed before // it was called. func (c *Complete) Complete() bool { - line, ok := getLine() + line, point, ok := getEnv() if !ok { // make sure flags parsed, // in case they were not added in the main program return c.CLI.Run() } - Log("Completing line: %s", line) + + if point >= 0 && point < len(line) { + line = line[:point] + } + + Log("Completing phrase: %s", line) a := newArgs(line) Log("Completing last field: %s", a.Last) options := c.Command.Predict(a) @@ -70,7 +72,7 @@ func (c *Complete) Complete() bool { // filter only options that match the last argument matches := []string{} for _, option := range options { - if match.Prefix(option, a.Last) { + if strings.HasPrefix(option, a.Last) { matches = append(matches, option) } } @@ -79,12 +81,19 @@ func (c *Complete) Complete() bool { return true } -func getLine() (string, bool) { - line := os.Getenv(envComplete) +func getEnv() (line string, point int, ok bool) { + line = os.Getenv(envLine) if line == "" { - return "", false + return + } + point, err := strconv.Atoi(os.Getenv(envPoint)) + if err != nil { + // If failed parsing point for some reason, set it to point + // on the end of the line. + Log("Failed parsing point %s: %v", os.Getenv(envPoint), err) + point = len(line) } - return line, true + return line, point, true } func (c *Complete) output(options []string) { diff --git a/vendor/github.com/posener/complete/doc.go b/vendor/github.com/posener/complete/doc.go new file mode 100644 index 0000000..0ae09a1 --- /dev/null +++ b/vendor/github.com/posener/complete/doc.go @@ -0,0 +1,110 @@ +/* +Package complete provides a tool for bash writing bash completion in go, and bash completion for the go command line. + +Writing bash completion scripts is a hard work. This package provides an easy way +to create bash completion scripts for any command, and also an easy way to install/uninstall +the completion of the command. + +Go Command Bash Completion + +In ./cmd/gocomplete there is an example for bash completion for the `go` command line. + +This is an example that uses the `complete` package on the `go` command - the `complete` package +can also be used to implement any completions, see #usage. + +Install + +1. Type in your shell: + + go get -u github.com/posener/complete/gocomplete + gocomplete -install + +2. Restart your shell + +Uninstall by `gocomplete -uninstall` + +Features + +- Complete `go` command, including sub commands and all flags. +- Complete packages names or `.go` files when necessary. +- Complete test names after `-run` flag. + +Complete package + +Supported shells: + +- [x] bash +- [x] zsh +- [x] fish + +Usage + +Assuming you have program called `run` and you want to have bash completion +for it, meaning, if you type `run` then space, then press the `Tab` key, +the shell will suggest relevant complete options. + +In that case, we will create a program called `runcomplete`, a go program, +with a `func main()` and so, that will make the completion of the `run` +program. Once the `runcomplete` will be in a binary form, we could +`runcomplete -install` and that will add to our shell all the bash completion +options for `run`. + +So here it is: + + import "github.com/posener/complete" + + func main() { + + // create a Command object, that represents the command we want + // to complete. + run := complete.Command{ + + // Sub defines a list of sub commands of the program, + // this is recursive, since every command is of type command also. + Sub: complete.Commands{ + + // add a build sub command + "build": complete.Command { + + // define flags of the build sub command + Flags: complete.Flags{ + // build sub command has a flag '-cpus', which + // expects number of cpus after it. in that case + // anything could complete this flag. + "-cpus": complete.PredictAnything, + }, + }, + }, + + // define flags of the 'run' main command + Flags: complete.Flags{ + // a flag -o, which expects a file ending with .out after + // it, the tab completion will auto complete for files matching + // the given pattern. + "-o": complete.PredictFiles("*.out"), + }, + + // define global flags of the 'run' main command + // those will show up also when a sub command was entered in the + // command line + GlobalFlags: complete.Flags{ + + // a flag '-h' which does not expects anything after it + "-h": complete.PredictNothing, + }, + } + + // run the command completion, as part of the main() function. + // this triggers the autocompletion when needed. + // name must be exactly as the binary that we want to complete. + complete.New("run", run).Run() + } + +Self completing program + +In case that the program that we want to complete is written in go we +can make it self completing. +Here is an example: ./example/self/main.go . + +*/ +package complete diff --git a/vendor/github.com/posener/complete/goreadme.json b/vendor/github.com/posener/complete/goreadme.json new file mode 100644 index 0000000..025ec76 --- /dev/null +++ b/vendor/github.com/posener/complete/goreadme.json @@ -0,0 +1,9 @@ +{ + "badges": { + "travis_ci": true, + "code_cov": true, + "golang_ci": true, + "go_doc": true, + "goreadme": true + } +} \ No newline at end of file diff --git a/vendor/github.com/posener/complete/log.go b/vendor/github.com/posener/complete/log.go index 797a80c..c302955 100644 --- a/vendor/github.com/posener/complete/log.go +++ b/vendor/github.com/posener/complete/log.go @@ -1,7 +1,6 @@ package complete import ( - "io" "io/ioutil" "log" "os" @@ -15,7 +14,7 @@ import ( var Log = getLogger() func getLogger() func(format string, args ...interface{}) { - var logfile io.Writer = ioutil.Discard + var logfile = ioutil.Discard if os.Getenv(envDebug) != "" { logfile = os.Stderr } diff --git a/vendor/github.com/posener/complete/match/file.go b/vendor/github.com/posener/complete/match/file.go deleted file mode 100644 index 051171e..0000000 --- a/vendor/github.com/posener/complete/match/file.go +++ /dev/null @@ -1,19 +0,0 @@ -package match - -import "strings" - -// File returns true if prefix can match the file -func File(file, prefix string) bool { - // special case for current directory completion - if file == "./" && (prefix == "." || prefix == "") { - return true - } - if prefix == "." && strings.HasPrefix(file, ".") { - return true - } - - file = strings.TrimPrefix(file, "./") - prefix = strings.TrimPrefix(prefix, "./") - - return strings.HasPrefix(file, prefix) -} diff --git a/vendor/github.com/posener/complete/match/match.go b/vendor/github.com/posener/complete/match/match.go deleted file mode 100644 index 812fcac..0000000 --- a/vendor/github.com/posener/complete/match/match.go +++ /dev/null @@ -1,6 +0,0 @@ -package match - -// Match matches two strings -// it is used for comparing a term to the last typed -// word, the prefix, and see if it is a possible auto complete option. -type Match func(term, prefix string) bool diff --git a/vendor/github.com/posener/complete/match/prefix.go b/vendor/github.com/posener/complete/match/prefix.go deleted file mode 100644 index 9a01ba6..0000000 --- a/vendor/github.com/posener/complete/match/prefix.go +++ /dev/null @@ -1,9 +0,0 @@ -package match - -import "strings" - -// Prefix is a simple Matcher, if the word is it's prefix, there is a match -// Match returns true if a has the prefix as prefix -func Prefix(long, prefix string) bool { - return strings.HasPrefix(long, prefix) -} diff --git a/vendor/github.com/posener/complete/metalinter.json b/vendor/github.com/posener/complete/metalinter.json deleted file mode 100644 index 799c1d0..0000000 --- a/vendor/github.com/posener/complete/metalinter.json +++ /dev/null @@ -1,21 +0,0 @@ -{ - "Vendor": true, - "DisableAll": true, - "Enable": [ - "gofmt", - "goimports", - "interfacer", - "goconst", - "misspell", - "unconvert", - "gosimple", - "golint", - "structcheck", - "deadcode", - "vet" - ], - "Exclude": [ - "initTests is unused" - ], - "Deadline": "2m" -} diff --git a/vendor/github.com/posener/complete/predict_files.go b/vendor/github.com/posener/complete/predict_files.go index c8adf7e..25ae2d5 100644 --- a/vendor/github.com/posener/complete/predict_files.go +++ b/vendor/github.com/posener/complete/predict_files.go @@ -5,8 +5,6 @@ import ( "os" "path/filepath" "strings" - - "github.com/posener/complete/match" ) // PredictDirs will search for directories in the given started to be typed @@ -53,7 +51,7 @@ func predictFiles(a Args, pattern string, allowFiles bool) []string { return nil } - dir := a.Directory() + dir := directory(a.Last) files := listFiles(dir, pattern, allowFiles) // add dir if match @@ -62,6 +60,19 @@ func predictFiles(a Args, pattern string, allowFiles bool) []string { return PredictFilesSet(files).Predict(a) } +// directory gives the directory of the given partial path +// in case that it is not, we fall back to the current directory. +func directory(path string) string { + if info, err := os.Stat(path); err == nil && info.IsDir() { + return fixPathForm(path, path) + } + dir := filepath.Dir(path) + if info, err := os.Stat(dir); err == nil && info.IsDir() { + return fixPathForm(path, dir) + } + return "./" +} + // PredictFilesSet predict according to file rules to a given set of file names func PredictFilesSet(files []string) PredictFunc { return func(a Args) (prediction []string) { @@ -70,7 +81,7 @@ func PredictFilesSet(files []string) PredictFunc { f = fixPathForm(a.Last, f) // test matching of file to the argument - if match.File(f, a.Last) { + if matchFile(f, a.Last) { prediction = append(prediction, f) } } @@ -106,3 +117,58 @@ func listFiles(dir, pattern string, allowFiles bool) []string { } return list } + +// MatchFile returns true if prefix can match the file +func matchFile(file, prefix string) bool { + // special case for current directory completion + if file == "./" && (prefix == "." || prefix == "") { + return true + } + if prefix == "." && strings.HasPrefix(file, ".") { + return true + } + + file = strings.TrimPrefix(file, "./") + prefix = strings.TrimPrefix(prefix, "./") + + return strings.HasPrefix(file, prefix) +} + +// fixPathForm changes a file name to a relative name +func fixPathForm(last string, file string) string { + // get wording directory for relative name + workDir, err := os.Getwd() + if err != nil { + return file + } + + abs, err := filepath.Abs(file) + if err != nil { + return file + } + + // if last is absolute, return path as absolute + if filepath.IsAbs(last) { + return fixDirPath(abs) + } + + rel, err := filepath.Rel(workDir, abs) + if err != nil { + return file + } + + // fix ./ prefix of path + if rel != "." && strings.HasPrefix(last, ".") { + rel = "./" + rel + } + + return fixDirPath(rel) +} + +func fixDirPath(path string) string { + info, err := os.Stat(path) + if err == nil && info.IsDir() && !strings.HasSuffix(path, "/") { + path += "/" + } + return path +} diff --git a/vendor/github.com/posener/complete/test.sh b/vendor/github.com/posener/complete/test.sh deleted file mode 100644 index 56bfcf1..0000000 --- a/vendor/github.com/posener/complete/test.sh +++ /dev/null @@ -1,12 +0,0 @@ -#!/usr/bin/env bash - -set -e -echo "" > coverage.txt - -for d in $(go list ./... | grep -v vendor); do - go test -v -race -coverprofile=profile.out -covermode=atomic $d - if [ -f profile.out ]; then - cat profile.out >> coverage.txt - rm profile.out - fi -done \ No newline at end of file diff --git a/vendor/github.com/posener/complete/utils.go b/vendor/github.com/posener/complete/utils.go deleted file mode 100644 index 58b8b79..0000000 --- a/vendor/github.com/posener/complete/utils.go +++ /dev/null @@ -1,46 +0,0 @@ -package complete - -import ( - "os" - "path/filepath" - "strings" -) - -// fixPathForm changes a file name to a relative name -func fixPathForm(last string, file string) string { - // get wording directory for relative name - workDir, err := os.Getwd() - if err != nil { - return file - } - - abs, err := filepath.Abs(file) - if err != nil { - return file - } - - // if last is absolute, return path as absolute - if filepath.IsAbs(last) { - return fixDirPath(abs) - } - - rel, err := filepath.Rel(workDir, abs) - if err != nil { - return file - } - - // fix ./ prefix of path - if rel != "." && strings.HasPrefix(last, ".") { - rel = "./" + rel - } - - return fixDirPath(rel) -} - -func fixDirPath(path string) string { - info, err := os.Stat(path) - if err == nil && info.IsDir() && !strings.HasSuffix(path, "/") { - path += "/" - } - return path -} diff --git a/vendor/github.com/shopspring/decimal/.gitignore b/vendor/github.com/shopspring/decimal/.gitignore new file mode 100644 index 0000000..ff36b98 --- /dev/null +++ b/vendor/github.com/shopspring/decimal/.gitignore @@ -0,0 +1,9 @@ +.git +*.swp + +# IntelliJ +.idea/ +*.iml + +# VS code +*.code-workspace diff --git a/vendor/github.com/shopspring/decimal/.travis.yml b/vendor/github.com/shopspring/decimal/.travis.yml new file mode 100644 index 0000000..6326d40 --- /dev/null +++ b/vendor/github.com/shopspring/decimal/.travis.yml @@ -0,0 +1,19 @@ +language: go + +arch: + - amd64 + - ppc64le + +go: + - 1.7.x + - 1.14.x + - 1.15.x + - 1.16.x + - 1.17.x + - tip + +install: + - go build . + +script: + - go test -v diff --git a/vendor/github.com/shopspring/decimal/CHANGELOG.md b/vendor/github.com/shopspring/decimal/CHANGELOG.md new file mode 100644 index 0000000..aea6115 --- /dev/null +++ b/vendor/github.com/shopspring/decimal/CHANGELOG.md @@ -0,0 +1,49 @@ +## Decimal v1.3.1 + +#### ENHANCEMENTS +- Reduce memory allocation in case of initialization from big.Int [#252](https://github.com/shopspring/decimal/pull/252) + +#### BUGFIXES +- Fix binary marshalling of decimal zero value [#253](https://github.com/shopspring/decimal/pull/253) + +## Decimal v1.3.0 + +#### FEATURES +- Add NewFromFormattedString initializer [#184](https://github.com/shopspring/decimal/pull/184) +- Add NewNullDecimal initializer [#234](https://github.com/shopspring/decimal/pull/234) +- Add implementation of natural exponent function (Taylor, Hull-Abraham) [#229](https://github.com/shopspring/decimal/pull/229) +- Add RoundUp, RoundDown, RoundCeil, RoundFloor methods [#196](https://github.com/shopspring/decimal/pull/196) [#202](https://github.com/shopspring/decimal/pull/202) [#220](https://github.com/shopspring/decimal/pull/220) +- Add XML support for NullDecimal [#192](https://github.com/shopspring/decimal/pull/192) +- Add IsInteger method [#179](https://github.com/shopspring/decimal/pull/179) +- Add Copy helper method [#123](https://github.com/shopspring/decimal/pull/123) +- Add InexactFloat64 helper method [#205](https://github.com/shopspring/decimal/pull/205) +- Add CoefficientInt64 helper method [#244](https://github.com/shopspring/decimal/pull/244) + +#### ENHANCEMENTS +- Performance optimization of NewFromString init method [#198](https://github.com/shopspring/decimal/pull/198) +- Performance optimization of Abs and Round methods [#240](https://github.com/shopspring/decimal/pull/240) +- Additional tests (CI) for ppc64le architecture [#188](https://github.com/shopspring/decimal/pull/188) + +#### BUGFIXES +- Fix rounding in FormatFloat fallback path (roundShortest method, fix taken from Go main repository) [#161](https://github.com/shopspring/decimal/pull/161) +- Add slice range checks to UnmarshalBinary method [#232](https://github.com/shopspring/decimal/pull/232) + +## Decimal v1.2.0 + +#### BREAKING +- Drop support for Go version older than 1.7 [#172](https://github.com/shopspring/decimal/pull/172) + +#### FEATURES +- Add NewFromInt and NewFromInt32 initializers [#72](https://github.com/shopspring/decimal/pull/72) +- Add support for Go modules [#157](https://github.com/shopspring/decimal/pull/157) +- Add BigInt, BigFloat helper methods [#171](https://github.com/shopspring/decimal/pull/171) + +#### ENHANCEMENTS +- Memory usage optimization [#160](https://github.com/shopspring/decimal/pull/160) +- Updated travis CI golang versions [#156](https://github.com/shopspring/decimal/pull/156) +- Update documentation [#173](https://github.com/shopspring/decimal/pull/173) +- Improve code quality [#174](https://github.com/shopspring/decimal/pull/174) + +#### BUGFIXES +- Revert remove insignificant digits [#159](https://github.com/shopspring/decimal/pull/159) +- Remove 15 interval for RoundCash [#166](https://github.com/shopspring/decimal/pull/166) diff --git a/vendor/github.com/shopspring/decimal/LICENSE b/vendor/github.com/shopspring/decimal/LICENSE new file mode 100644 index 0000000..ad2148a --- /dev/null +++ b/vendor/github.com/shopspring/decimal/LICENSE @@ -0,0 +1,45 @@ +The MIT License (MIT) + +Copyright (c) 2015 Spring, Inc. + +Permission is hereby granted, free of charge, to any person obtaining a copy +of this software and associated documentation files (the "Software"), to deal +in the Software without restriction, including without limitation the rights +to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +copies of the Software, and to permit persons to whom the Software is +furnished to do so, subject to the following conditions: + +The above copyright notice and this permission notice shall be included in +all copies or substantial portions of the Software. + +THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN +THE SOFTWARE. + +- Based on https://github.com/oguzbilgic/fpd, which has the following license: +""" +The MIT License (MIT) + +Copyright (c) 2013 Oguz Bilgic + +Permission is hereby granted, free of charge, to any person obtaining a copy of +this software and associated documentation files (the "Software"), to deal in +the Software without restriction, including without limitation the rights to +use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of +the Software, and to permit persons to whom the Software is furnished to do so, +subject to the following conditions: + +The above copyright notice and this permission notice shall be included in all +copies or substantial portions of the Software. + +THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS +FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR +COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER +IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN +CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. +""" diff --git a/vendor/github.com/shopspring/decimal/README.md b/vendor/github.com/shopspring/decimal/README.md new file mode 100644 index 0000000..2e35df0 --- /dev/null +++ b/vendor/github.com/shopspring/decimal/README.md @@ -0,0 +1,130 @@ +# decimal + +[![Build Status](https://app.travis-ci.com/shopspring/decimal.svg?branch=master)](https://app.travis-ci.com/shopspring/decimal) [![GoDoc](https://godoc.org/github.com/shopspring/decimal?status.svg)](https://godoc.org/github.com/shopspring/decimal) [![Go Report Card](https://goreportcard.com/badge/github.com/shopspring/decimal)](https://goreportcard.com/report/github.com/shopspring/decimal) + +Arbitrary-precision fixed-point decimal numbers in go. + +_Note:_ Decimal library can "only" represent numbers with a maximum of 2^31 digits after the decimal point. + +## Features + + * The zero-value is 0, and is safe to use without initialization + * Addition, subtraction, multiplication with no loss of precision + * Division with specified precision + * Database/sql serialization/deserialization + * JSON and XML serialization/deserialization + +## Install + +Run `go get github.com/shopspring/decimal` + +## Requirements + +Decimal library requires Go version `>=1.7` + +## Usage + +```go +package main + +import ( + "fmt" + "github.com/shopspring/decimal" +) + +func main() { + price, err := decimal.NewFromString("136.02") + if err != nil { + panic(err) + } + + quantity := decimal.NewFromInt(3) + + fee, _ := decimal.NewFromString(".035") + taxRate, _ := decimal.NewFromString(".08875") + + subtotal := price.Mul(quantity) + + preTax := subtotal.Mul(fee.Add(decimal.NewFromFloat(1))) + + total := preTax.Mul(taxRate.Add(decimal.NewFromFloat(1))) + + fmt.Println("Subtotal:", subtotal) // Subtotal: 408.06 + fmt.Println("Pre-tax:", preTax) // Pre-tax: 422.3421 + fmt.Println("Taxes:", total.Sub(preTax)) // Taxes: 37.482861375 + fmt.Println("Total:", total) // Total: 459.824961375 + fmt.Println("Tax rate:", total.Sub(preTax).Div(preTax)) // Tax rate: 0.08875 +} +``` + +## Documentation + +http://godoc.org/github.com/shopspring/decimal + +## Production Usage + +* [Spring](https://shopspring.com/), since August 14, 2014. +* If you are using this in production, please let us know! + +## FAQ + +#### Why don't you just use float64? + +Because float64 (or any binary floating point type, actually) can't represent +numbers such as `0.1` exactly. + +Consider this code: http://play.golang.org/p/TQBd4yJe6B You might expect that +it prints out `10`, but it actually prints `9.999999999999831`. Over time, +these small errors can really add up! + +#### Why don't you just use big.Rat? + +big.Rat is fine for representing rational numbers, but Decimal is better for +representing money. Why? Here's a (contrived) example: + +Let's say you use big.Rat, and you have two numbers, x and y, both +representing 1/3, and you have `z = 1 - x - y = 1/3`. If you print each one +out, the string output has to stop somewhere (let's say it stops at 3 decimal +digits, for simplicity), so you'll get 0.333, 0.333, and 0.333. But where did +the other 0.001 go? + +Here's the above example as code: http://play.golang.org/p/lCZZs0w9KE + +With Decimal, the strings being printed out represent the number exactly. So, +if you have `x = y = 1/3` (with precision 3), they will actually be equal to +0.333, and when you do `z = 1 - x - y`, `z` will be equal to .334. No money is +unaccounted for! + +You still have to be careful. If you want to split a number `N` 3 ways, you +can't just send `N/3` to three different people. You have to pick one to send +`N - (2/3*N)` to. That person will receive the fraction of a penny remainder. + +But, it is much easier to be careful with Decimal than with big.Rat. + +#### Why isn't the API similar to big.Int's? + +big.Int's API is built to reduce the number of memory allocations for maximal +performance. This makes sense for its use-case, but the trade-off is that the +API is awkward and easy to misuse. + +For example, to add two big.Ints, you do: `z := new(big.Int).Add(x, y)`. A +developer unfamiliar with this API might try to do `z := a.Add(a, b)`. This +modifies `a` and sets `z` as an alias for `a`, which they might not expect. It +also modifies any other aliases to `a`. + +Here's an example of the subtle bugs you can introduce with big.Int's API: +https://play.golang.org/p/x2R_78pa8r + +In contrast, it's difficult to make such mistakes with decimal. Decimals +behave like other go numbers types: even though `a = b` will not deep copy +`b` into `a`, it is impossible to modify a Decimal, since all Decimal methods +return new Decimals and do not modify the originals. The downside is that +this causes extra allocations, so Decimal is less performant. My assumption +is that if you're using Decimals, you probably care more about correctness +than performance. + +## License + +The MIT License (MIT) + +This is a heavily modified fork of [fpd.Decimal](https://github.com/oguzbilgic/fpd), which was also released under the MIT License. diff --git a/vendor/github.com/shopspring/decimal/decimal-go.go b/vendor/github.com/shopspring/decimal/decimal-go.go new file mode 100644 index 0000000..9958d69 --- /dev/null +++ b/vendor/github.com/shopspring/decimal/decimal-go.go @@ -0,0 +1,415 @@ +// Copyright 2009 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Multiprecision decimal numbers. +// For floating-point formatting only; not general purpose. +// Only operations are assign and (binary) left/right shift. +// Can do binary floating point in multiprecision decimal precisely +// because 2 divides 10; cannot do decimal floating point +// in multiprecision binary precisely. + +package decimal + +type decimal struct { + d [800]byte // digits, big-endian representation + nd int // number of digits used + dp int // decimal point + neg bool // negative flag + trunc bool // discarded nonzero digits beyond d[:nd] +} + +func (a *decimal) String() string { + n := 10 + a.nd + if a.dp > 0 { + n += a.dp + } + if a.dp < 0 { + n += -a.dp + } + + buf := make([]byte, n) + w := 0 + switch { + case a.nd == 0: + return "0" + + case a.dp <= 0: + // zeros fill space between decimal point and digits + buf[w] = '0' + w++ + buf[w] = '.' + w++ + w += digitZero(buf[w : w+-a.dp]) + w += copy(buf[w:], a.d[0:a.nd]) + + case a.dp < a.nd: + // decimal point in middle of digits + w += copy(buf[w:], a.d[0:a.dp]) + buf[w] = '.' + w++ + w += copy(buf[w:], a.d[a.dp:a.nd]) + + default: + // zeros fill space between digits and decimal point + w += copy(buf[w:], a.d[0:a.nd]) + w += digitZero(buf[w : w+a.dp-a.nd]) + } + return string(buf[0:w]) +} + +func digitZero(dst []byte) int { + for i := range dst { + dst[i] = '0' + } + return len(dst) +} + +// trim trailing zeros from number. +// (They are meaningless; the decimal point is tracked +// independent of the number of digits.) +func trim(a *decimal) { + for a.nd > 0 && a.d[a.nd-1] == '0' { + a.nd-- + } + if a.nd == 0 { + a.dp = 0 + } +} + +// Assign v to a. +func (a *decimal) Assign(v uint64) { + var buf [24]byte + + // Write reversed decimal in buf. + n := 0 + for v > 0 { + v1 := v / 10 + v -= 10 * v1 + buf[n] = byte(v + '0') + n++ + v = v1 + } + + // Reverse again to produce forward decimal in a.d. + a.nd = 0 + for n--; n >= 0; n-- { + a.d[a.nd] = buf[n] + a.nd++ + } + a.dp = a.nd + trim(a) +} + +// Maximum shift that we can do in one pass without overflow. +// A uint has 32 or 64 bits, and we have to be able to accommodate 9<> 63) +const maxShift = uintSize - 4 + +// Binary shift right (/ 2) by k bits. k <= maxShift to avoid overflow. +func rightShift(a *decimal, k uint) { + r := 0 // read pointer + w := 0 // write pointer + + // Pick up enough leading digits to cover first shift. + var n uint + for ; n>>k == 0; r++ { + if r >= a.nd { + if n == 0 { + // a == 0; shouldn't get here, but handle anyway. + a.nd = 0 + return + } + for n>>k == 0 { + n = n * 10 + r++ + } + break + } + c := uint(a.d[r]) + n = n*10 + c - '0' + } + a.dp -= r - 1 + + var mask uint = (1 << k) - 1 + + // Pick up a digit, put down a digit. + for ; r < a.nd; r++ { + c := uint(a.d[r]) + dig := n >> k + n &= mask + a.d[w] = byte(dig + '0') + w++ + n = n*10 + c - '0' + } + + // Put down extra digits. + for n > 0 { + dig := n >> k + n &= mask + if w < len(a.d) { + a.d[w] = byte(dig + '0') + w++ + } else if dig > 0 { + a.trunc = true + } + n = n * 10 + } + + a.nd = w + trim(a) +} + +// Cheat sheet for left shift: table indexed by shift count giving +// number of new digits that will be introduced by that shift. +// +// For example, leftcheats[4] = {2, "625"}. That means that +// if we are shifting by 4 (multiplying by 16), it will add 2 digits +// when the string prefix is "625" through "999", and one fewer digit +// if the string prefix is "000" through "624". +// +// Credit for this trick goes to Ken. + +type leftCheat struct { + delta int // number of new digits + cutoff string // minus one digit if original < a. +} + +var leftcheats = []leftCheat{ + // Leading digits of 1/2^i = 5^i. + // 5^23 is not an exact 64-bit floating point number, + // so have to use bc for the math. + // Go up to 60 to be large enough for 32bit and 64bit platforms. + /* + seq 60 | sed 's/^/5^/' | bc | + awk 'BEGIN{ print "\t{ 0, \"\" }," } + { + log2 = log(2)/log(10) + printf("\t{ %d, \"%s\" },\t// * %d\n", + int(log2*NR+1), $0, 2**NR) + }' + */ + {0, ""}, + {1, "5"}, // * 2 + {1, "25"}, // * 4 + {1, "125"}, // * 8 + {2, "625"}, // * 16 + {2, "3125"}, // * 32 + {2, "15625"}, // * 64 + {3, "78125"}, // * 128 + {3, "390625"}, // * 256 + {3, "1953125"}, // * 512 + {4, "9765625"}, // * 1024 + {4, "48828125"}, // * 2048 + {4, "244140625"}, // * 4096 + {4, "1220703125"}, // * 8192 + {5, "6103515625"}, // * 16384 + {5, "30517578125"}, // * 32768 + {5, "152587890625"}, // * 65536 + {6, "762939453125"}, // * 131072 + {6, "3814697265625"}, // * 262144 + {6, "19073486328125"}, // * 524288 + {7, "95367431640625"}, // * 1048576 + {7, "476837158203125"}, // * 2097152 + {7, "2384185791015625"}, // * 4194304 + {7, "11920928955078125"}, // * 8388608 + {8, "59604644775390625"}, // * 16777216 + {8, "298023223876953125"}, // * 33554432 + {8, "1490116119384765625"}, // * 67108864 + {9, "7450580596923828125"}, // * 134217728 + {9, "37252902984619140625"}, // * 268435456 + {9, "186264514923095703125"}, // * 536870912 + {10, "931322574615478515625"}, // * 1073741824 + {10, "4656612873077392578125"}, // * 2147483648 + {10, "23283064365386962890625"}, // * 4294967296 + {10, "116415321826934814453125"}, // * 8589934592 + {11, "582076609134674072265625"}, // * 17179869184 + {11, "2910383045673370361328125"}, // * 34359738368 + {11, "14551915228366851806640625"}, // * 68719476736 + {12, "72759576141834259033203125"}, // * 137438953472 + {12, "363797880709171295166015625"}, // * 274877906944 + {12, "1818989403545856475830078125"}, // * 549755813888 + {13, "9094947017729282379150390625"}, // * 1099511627776 + {13, "45474735088646411895751953125"}, // * 2199023255552 + {13, "227373675443232059478759765625"}, // * 4398046511104 + {13, "1136868377216160297393798828125"}, // * 8796093022208 + {14, "5684341886080801486968994140625"}, // * 17592186044416 + {14, "28421709430404007434844970703125"}, // * 35184372088832 + {14, "142108547152020037174224853515625"}, // * 70368744177664 + {15, "710542735760100185871124267578125"}, // * 140737488355328 + {15, "3552713678800500929355621337890625"}, // * 281474976710656 + {15, "17763568394002504646778106689453125"}, // * 562949953421312 + {16, "88817841970012523233890533447265625"}, // * 1125899906842624 + {16, "444089209850062616169452667236328125"}, // * 2251799813685248 + {16, "2220446049250313080847263336181640625"}, // * 4503599627370496 + {16, "11102230246251565404236316680908203125"}, // * 9007199254740992 + {17, "55511151231257827021181583404541015625"}, // * 18014398509481984 + {17, "277555756156289135105907917022705078125"}, // * 36028797018963968 + {17, "1387778780781445675529539585113525390625"}, // * 72057594037927936 + {18, "6938893903907228377647697925567626953125"}, // * 144115188075855872 + {18, "34694469519536141888238489627838134765625"}, // * 288230376151711744 + {18, "173472347597680709441192448139190673828125"}, // * 576460752303423488 + {19, "867361737988403547205962240695953369140625"}, // * 1152921504606846976 +} + +// Is the leading prefix of b lexicographically less than s? +func prefixIsLessThan(b []byte, s string) bool { + for i := 0; i < len(s); i++ { + if i >= len(b) { + return true + } + if b[i] != s[i] { + return b[i] < s[i] + } + } + return false +} + +// Binary shift left (* 2) by k bits. k <= maxShift to avoid overflow. +func leftShift(a *decimal, k uint) { + delta := leftcheats[k].delta + if prefixIsLessThan(a.d[0:a.nd], leftcheats[k].cutoff) { + delta-- + } + + r := a.nd // read index + w := a.nd + delta // write index + + // Pick up a digit, put down a digit. + var n uint + for r--; r >= 0; r-- { + n += (uint(a.d[r]) - '0') << k + quo := n / 10 + rem := n - 10*quo + w-- + if w < len(a.d) { + a.d[w] = byte(rem + '0') + } else if rem != 0 { + a.trunc = true + } + n = quo + } + + // Put down extra digits. + for n > 0 { + quo := n / 10 + rem := n - 10*quo + w-- + if w < len(a.d) { + a.d[w] = byte(rem + '0') + } else if rem != 0 { + a.trunc = true + } + n = quo + } + + a.nd += delta + if a.nd >= len(a.d) { + a.nd = len(a.d) + } + a.dp += delta + trim(a) +} + +// Binary shift left (k > 0) or right (k < 0). +func (a *decimal) Shift(k int) { + switch { + case a.nd == 0: + // nothing to do: a == 0 + case k > 0: + for k > maxShift { + leftShift(a, maxShift) + k -= maxShift + } + leftShift(a, uint(k)) + case k < 0: + for k < -maxShift { + rightShift(a, maxShift) + k += maxShift + } + rightShift(a, uint(-k)) + } +} + +// If we chop a at nd digits, should we round up? +func shouldRoundUp(a *decimal, nd int) bool { + if nd < 0 || nd >= a.nd { + return false + } + if a.d[nd] == '5' && nd+1 == a.nd { // exactly halfway - round to even + // if we truncated, a little higher than what's recorded - always round up + if a.trunc { + return true + } + return nd > 0 && (a.d[nd-1]-'0')%2 != 0 + } + // not halfway - digit tells all + return a.d[nd] >= '5' +} + +// Round a to nd digits (or fewer). +// If nd is zero, it means we're rounding +// just to the left of the digits, as in +// 0.09 -> 0.1. +func (a *decimal) Round(nd int) { + if nd < 0 || nd >= a.nd { + return + } + if shouldRoundUp(a, nd) { + a.RoundUp(nd) + } else { + a.RoundDown(nd) + } +} + +// Round a down to nd digits (or fewer). +func (a *decimal) RoundDown(nd int) { + if nd < 0 || nd >= a.nd { + return + } + a.nd = nd + trim(a) +} + +// Round a up to nd digits (or fewer). +func (a *decimal) RoundUp(nd int) { + if nd < 0 || nd >= a.nd { + return + } + + // round up + for i := nd - 1; i >= 0; i-- { + c := a.d[i] + if c < '9' { // can stop after this digit + a.d[i]++ + a.nd = i + 1 + return + } + } + + // Number is all 9s. + // Change to single 1 with adjusted decimal point. + a.d[0] = '1' + a.nd = 1 + a.dp++ +} + +// Extract integer part, rounded appropriately. +// No guarantees about overflow. +func (a *decimal) RoundedInteger() uint64 { + if a.dp > 20 { + return 0xFFFFFFFFFFFFFFFF + } + var i int + n := uint64(0) + for i = 0; i < a.dp && i < a.nd; i++ { + n = n*10 + uint64(a.d[i]-'0') + } + for ; i < a.dp; i++ { + n *= 10 + } + if shouldRoundUp(a, a.dp) { + n++ + } + return n +} diff --git a/vendor/github.com/shopspring/decimal/decimal.go b/vendor/github.com/shopspring/decimal/decimal.go new file mode 100644 index 0000000..84405ec --- /dev/null +++ b/vendor/github.com/shopspring/decimal/decimal.go @@ -0,0 +1,1904 @@ +// Package decimal implements an arbitrary precision fixed-point decimal. +// +// The zero-value of a Decimal is 0, as you would expect. +// +// The best way to create a new Decimal is to use decimal.NewFromString, ex: +// +// n, err := decimal.NewFromString("-123.4567") +// n.String() // output: "-123.4567" +// +// To use Decimal as part of a struct: +// +// type Struct struct { +// Number Decimal +// } +// +// Note: This can "only" represent numbers with a maximum of 2^31 digits after the decimal point. +package decimal + +import ( + "database/sql/driver" + "encoding/binary" + "fmt" + "math" + "math/big" + "regexp" + "strconv" + "strings" +) + +// DivisionPrecision is the number of decimal places in the result when it +// doesn't divide exactly. +// +// Example: +// +// d1 := decimal.NewFromFloat(2).Div(decimal.NewFromFloat(3)) +// d1.String() // output: "0.6666666666666667" +// d2 := decimal.NewFromFloat(2).Div(decimal.NewFromFloat(30000)) +// d2.String() // output: "0.0000666666666667" +// d3 := decimal.NewFromFloat(20000).Div(decimal.NewFromFloat(3)) +// d3.String() // output: "6666.6666666666666667" +// decimal.DivisionPrecision = 3 +// d4 := decimal.NewFromFloat(2).Div(decimal.NewFromFloat(3)) +// d4.String() // output: "0.667" +// +var DivisionPrecision = 16 + +// MarshalJSONWithoutQuotes should be set to true if you want the decimal to +// be JSON marshaled as a number, instead of as a string. +// WARNING: this is dangerous for decimals with many digits, since many JSON +// unmarshallers (ex: Javascript's) will unmarshal JSON numbers to IEEE 754 +// double-precision floating point numbers, which means you can potentially +// silently lose precision. +var MarshalJSONWithoutQuotes = false + +// ExpMaxIterations specifies the maximum number of iterations needed to calculate +// precise natural exponent value using ExpHullAbrham method. +var ExpMaxIterations = 1000 + +// Zero constant, to make computations faster. +// Zero should never be compared with == or != directly, please use decimal.Equal or decimal.Cmp instead. +var Zero = New(0, 1) + +var zeroInt = big.NewInt(0) +var oneInt = big.NewInt(1) +var twoInt = big.NewInt(2) +var fourInt = big.NewInt(4) +var fiveInt = big.NewInt(5) +var tenInt = big.NewInt(10) +var twentyInt = big.NewInt(20) + +var factorials = []Decimal{New(1, 0)} + +// Decimal represents a fixed-point decimal. It is immutable. +// number = value * 10 ^ exp +type Decimal struct { + value *big.Int + + // NOTE(vadim): this must be an int32, because we cast it to float64 during + // calculations. If exp is 64 bit, we might lose precision. + // If we cared about being able to represent every possible decimal, we + // could make exp a *big.Int but it would hurt performance and numbers + // like that are unrealistic. + exp int32 +} + +// New returns a new fixed-point decimal, value * 10 ^ exp. +func New(value int64, exp int32) Decimal { + return Decimal{ + value: big.NewInt(value), + exp: exp, + } +} + +// NewFromInt converts a int64 to Decimal. +// +// Example: +// +// NewFromInt(123).String() // output: "123" +// NewFromInt(-10).String() // output: "-10" +func NewFromInt(value int64) Decimal { + return Decimal{ + value: big.NewInt(value), + exp: 0, + } +} + +// NewFromInt32 converts a int32 to Decimal. +// +// Example: +// +// NewFromInt(123).String() // output: "123" +// NewFromInt(-10).String() // output: "-10" +func NewFromInt32(value int32) Decimal { + return Decimal{ + value: big.NewInt(int64(value)), + exp: 0, + } +} + +// NewFromBigInt returns a new Decimal from a big.Int, value * 10 ^ exp +func NewFromBigInt(value *big.Int, exp int32) Decimal { + return Decimal{ + value: new(big.Int).Set(value), + exp: exp, + } +} + +// NewFromString returns a new Decimal from a string representation. +// Trailing zeroes are not trimmed. +// +// Example: +// +// d, err := NewFromString("-123.45") +// d2, err := NewFromString(".0001") +// d3, err := NewFromString("1.47000") +// +func NewFromString(value string) (Decimal, error) { + originalInput := value + var intString string + var exp int64 + + // Check if number is using scientific notation + eIndex := strings.IndexAny(value, "Ee") + if eIndex != -1 { + expInt, err := strconv.ParseInt(value[eIndex+1:], 10, 32) + if err != nil { + if e, ok := err.(*strconv.NumError); ok && e.Err == strconv.ErrRange { + return Decimal{}, fmt.Errorf("can't convert %s to decimal: fractional part too long", value) + } + return Decimal{}, fmt.Errorf("can't convert %s to decimal: exponent is not numeric", value) + } + value = value[:eIndex] + exp = expInt + } + + pIndex := -1 + vLen := len(value) + for i := 0; i < vLen; i++ { + if value[i] == '.' { + if pIndex > -1 { + return Decimal{}, fmt.Errorf("can't convert %s to decimal: too many .s", value) + } + pIndex = i + } + } + + if pIndex == -1 { + // There is no decimal point, we can just parse the original string as + // an int + intString = value + } else { + if pIndex+1 < vLen { + intString = value[:pIndex] + value[pIndex+1:] + } else { + intString = value[:pIndex] + } + expInt := -len(value[pIndex+1:]) + exp += int64(expInt) + } + + var dValue *big.Int + // strconv.ParseInt is faster than new(big.Int).SetString so this is just a shortcut for strings we know won't overflow + if len(intString) <= 18 { + parsed64, err := strconv.ParseInt(intString, 10, 64) + if err != nil { + return Decimal{}, fmt.Errorf("can't convert %s to decimal", value) + } + dValue = big.NewInt(parsed64) + } else { + dValue = new(big.Int) + _, ok := dValue.SetString(intString, 10) + if !ok { + return Decimal{}, fmt.Errorf("can't convert %s to decimal", value) + } + } + + if exp < math.MinInt32 || exp > math.MaxInt32 { + // NOTE(vadim): I doubt a string could realistically be this long + return Decimal{}, fmt.Errorf("can't convert %s to decimal: fractional part too long", originalInput) + } + + return Decimal{ + value: dValue, + exp: int32(exp), + }, nil +} + +// NewFromFormattedString returns a new Decimal from a formatted string representation. +// The second argument - replRegexp, is a regular expression that is used to find characters that should be +// removed from given decimal string representation. All matched characters will be replaced with an empty string. +// +// Example: +// +// r := regexp.MustCompile("[$,]") +// d1, err := NewFromFormattedString("$5,125.99", r) +// +// r2 := regexp.MustCompile("[_]") +// d2, err := NewFromFormattedString("1_000_000", r2) +// +// r3 := regexp.MustCompile("[USD\\s]") +// d3, err := NewFromFormattedString("5000 USD", r3) +// +func NewFromFormattedString(value string, replRegexp *regexp.Regexp) (Decimal, error) { + parsedValue := replRegexp.ReplaceAllString(value, "") + d, err := NewFromString(parsedValue) + if err != nil { + return Decimal{}, err + } + return d, nil +} + +// RequireFromString returns a new Decimal from a string representation +// or panics if NewFromString would have returned an error. +// +// Example: +// +// d := RequireFromString("-123.45") +// d2 := RequireFromString(".0001") +// +func RequireFromString(value string) Decimal { + dec, err := NewFromString(value) + if err != nil { + panic(err) + } + return dec +} + +// NewFromFloat converts a float64 to Decimal. +// +// The converted number will contain the number of significant digits that can be +// represented in a float with reliable roundtrip. +// This is typically 15 digits, but may be more in some cases. +// See https://www.exploringbinary.com/decimal-precision-of-binary-floating-point-numbers/ for more information. +// +// For slightly faster conversion, use NewFromFloatWithExponent where you can specify the precision in absolute terms. +// +// NOTE: this will panic on NaN, +/-inf +func NewFromFloat(value float64) Decimal { + if value == 0 { + return New(0, 0) + } + return newFromFloat(value, math.Float64bits(value), &float64info) +} + +// NewFromFloat32 converts a float32 to Decimal. +// +// The converted number will contain the number of significant digits that can be +// represented in a float with reliable roundtrip. +// This is typically 6-8 digits depending on the input. +// See https://www.exploringbinary.com/decimal-precision-of-binary-floating-point-numbers/ for more information. +// +// For slightly faster conversion, use NewFromFloatWithExponent where you can specify the precision in absolute terms. +// +// NOTE: this will panic on NaN, +/-inf +func NewFromFloat32(value float32) Decimal { + if value == 0 { + return New(0, 0) + } + // XOR is workaround for https://github.com/golang/go/issues/26285 + a := math.Float32bits(value) ^ 0x80808080 + return newFromFloat(float64(value), uint64(a)^0x80808080, &float32info) +} + +func newFromFloat(val float64, bits uint64, flt *floatInfo) Decimal { + if math.IsNaN(val) || math.IsInf(val, 0) { + panic(fmt.Sprintf("Cannot create a Decimal from %v", val)) + } + exp := int(bits>>flt.mantbits) & (1<>(flt.expbits+flt.mantbits) != 0 + + roundShortest(&d, mant, exp, flt) + // If less than 19 digits, we can do calculation in an int64. + if d.nd < 19 { + tmp := int64(0) + m := int64(1) + for i := d.nd - 1; i >= 0; i-- { + tmp += m * int64(d.d[i]-'0') + m *= 10 + } + if d.neg { + tmp *= -1 + } + return Decimal{value: big.NewInt(tmp), exp: int32(d.dp) - int32(d.nd)} + } + dValue := new(big.Int) + dValue, ok := dValue.SetString(string(d.d[:d.nd]), 10) + if ok { + return Decimal{value: dValue, exp: int32(d.dp) - int32(d.nd)} + } + + return NewFromFloatWithExponent(val, int32(d.dp)-int32(d.nd)) +} + +// NewFromFloatWithExponent converts a float64 to Decimal, with an arbitrary +// number of fractional digits. +// +// Example: +// +// NewFromFloatWithExponent(123.456, -2).String() // output: "123.46" +// +func NewFromFloatWithExponent(value float64, exp int32) Decimal { + if math.IsNaN(value) || math.IsInf(value, 0) { + panic(fmt.Sprintf("Cannot create a Decimal from %v", value)) + } + + bits := math.Float64bits(value) + mant := bits & (1<<52 - 1) + exp2 := int32((bits >> 52) & (1<<11 - 1)) + sign := bits >> 63 + + if exp2 == 0 { + // specials + if mant == 0 { + return Decimal{} + } + // subnormal + exp2++ + } else { + // normal + mant |= 1 << 52 + } + + exp2 -= 1023 + 52 + + // normalizing base-2 values + for mant&1 == 0 { + mant = mant >> 1 + exp2++ + } + + // maximum number of fractional base-10 digits to represent 2^N exactly cannot be more than -N if N<0 + if exp < 0 && exp < exp2 { + if exp2 < 0 { + exp = exp2 + } else { + exp = 0 + } + } + + // representing 10^M * 2^N as 5^M * 2^(M+N) + exp2 -= exp + + temp := big.NewInt(1) + dMant := big.NewInt(int64(mant)) + + // applying 5^M + if exp > 0 { + temp = temp.SetInt64(int64(exp)) + temp = temp.Exp(fiveInt, temp, nil) + } else if exp < 0 { + temp = temp.SetInt64(-int64(exp)) + temp = temp.Exp(fiveInt, temp, nil) + dMant = dMant.Mul(dMant, temp) + temp = temp.SetUint64(1) + } + + // applying 2^(M+N) + if exp2 > 0 { + dMant = dMant.Lsh(dMant, uint(exp2)) + } else if exp2 < 0 { + temp = temp.Lsh(temp, uint(-exp2)) + } + + // rounding and downscaling + if exp > 0 || exp2 < 0 { + halfDown := new(big.Int).Rsh(temp, 1) + dMant = dMant.Add(dMant, halfDown) + dMant = dMant.Quo(dMant, temp) + } + + if sign == 1 { + dMant = dMant.Neg(dMant) + } + + return Decimal{ + value: dMant, + exp: exp, + } +} + +// Copy returns a copy of decimal with the same value and exponent, but a different pointer to value. +func (d Decimal) Copy() Decimal { + d.ensureInitialized() + return Decimal{ + value: &(*d.value), + exp: d.exp, + } +} + +// rescale returns a rescaled version of the decimal. Returned +// decimal may be less precise if the given exponent is bigger +// than the initial exponent of the Decimal. +// NOTE: this will truncate, NOT round +// +// Example: +// +// d := New(12345, -4) +// d2 := d.rescale(-1) +// d3 := d2.rescale(-4) +// println(d1) +// println(d2) +// println(d3) +// +// Output: +// +// 1.2345 +// 1.2 +// 1.2000 +// +func (d Decimal) rescale(exp int32) Decimal { + d.ensureInitialized() + + if d.exp == exp { + return Decimal{ + new(big.Int).Set(d.value), + d.exp, + } + } + + // NOTE(vadim): must convert exps to float64 before - to prevent overflow + diff := math.Abs(float64(exp) - float64(d.exp)) + value := new(big.Int).Set(d.value) + + expScale := new(big.Int).Exp(tenInt, big.NewInt(int64(diff)), nil) + if exp > d.exp { + value = value.Quo(value, expScale) + } else if exp < d.exp { + value = value.Mul(value, expScale) + } + + return Decimal{ + value: value, + exp: exp, + } +} + +// Abs returns the absolute value of the decimal. +func (d Decimal) Abs() Decimal { + if !d.IsNegative() { + return d + } + d.ensureInitialized() + d2Value := new(big.Int).Abs(d.value) + return Decimal{ + value: d2Value, + exp: d.exp, + } +} + +// Add returns d + d2. +func (d Decimal) Add(d2 Decimal) Decimal { + rd, rd2 := RescalePair(d, d2) + + d3Value := new(big.Int).Add(rd.value, rd2.value) + return Decimal{ + value: d3Value, + exp: rd.exp, + } +} + +// Sub returns d - d2. +func (d Decimal) Sub(d2 Decimal) Decimal { + rd, rd2 := RescalePair(d, d2) + + d3Value := new(big.Int).Sub(rd.value, rd2.value) + return Decimal{ + value: d3Value, + exp: rd.exp, + } +} + +// Neg returns -d. +func (d Decimal) Neg() Decimal { + d.ensureInitialized() + val := new(big.Int).Neg(d.value) + return Decimal{ + value: val, + exp: d.exp, + } +} + +// Mul returns d * d2. +func (d Decimal) Mul(d2 Decimal) Decimal { + d.ensureInitialized() + d2.ensureInitialized() + + expInt64 := int64(d.exp) + int64(d2.exp) + if expInt64 > math.MaxInt32 || expInt64 < math.MinInt32 { + // NOTE(vadim): better to panic than give incorrect results, as + // Decimals are usually used for money + panic(fmt.Sprintf("exponent %v overflows an int32!", expInt64)) + } + + d3Value := new(big.Int).Mul(d.value, d2.value) + return Decimal{ + value: d3Value, + exp: int32(expInt64), + } +} + +// Shift shifts the decimal in base 10. +// It shifts left when shift is positive and right if shift is negative. +// In simpler terms, the given value for shift is added to the exponent +// of the decimal. +func (d Decimal) Shift(shift int32) Decimal { + d.ensureInitialized() + return Decimal{ + value: new(big.Int).Set(d.value), + exp: d.exp + shift, + } +} + +// Div returns d / d2. If it doesn't divide exactly, the result will have +// DivisionPrecision digits after the decimal point. +func (d Decimal) Div(d2 Decimal) Decimal { + return d.DivRound(d2, int32(DivisionPrecision)) +} + +// QuoRem does divsion with remainder +// d.QuoRem(d2,precision) returns quotient q and remainder r such that +// d = d2 * q + r, q an integer multiple of 10^(-precision) +// 0 <= r < abs(d2) * 10 ^(-precision) if d>=0 +// 0 >= r > -abs(d2) * 10 ^(-precision) if d<0 +// Note that precision<0 is allowed as input. +func (d Decimal) QuoRem(d2 Decimal, precision int32) (Decimal, Decimal) { + d.ensureInitialized() + d2.ensureInitialized() + if d2.value.Sign() == 0 { + panic("decimal division by 0") + } + scale := -precision + e := int64(d.exp - d2.exp - scale) + if e > math.MaxInt32 || e < math.MinInt32 { + panic("overflow in decimal QuoRem") + } + var aa, bb, expo big.Int + var scalerest int32 + // d = a 10^ea + // d2 = b 10^eb + if e < 0 { + aa = *d.value + expo.SetInt64(-e) + bb.Exp(tenInt, &expo, nil) + bb.Mul(d2.value, &bb) + scalerest = d.exp + // now aa = a + // bb = b 10^(scale + eb - ea) + } else { + expo.SetInt64(e) + aa.Exp(tenInt, &expo, nil) + aa.Mul(d.value, &aa) + bb = *d2.value + scalerest = scale + d2.exp + // now aa = a ^ (ea - eb - scale) + // bb = b + } + var q, r big.Int + q.QuoRem(&aa, &bb, &r) + dq := Decimal{value: &q, exp: scale} + dr := Decimal{value: &r, exp: scalerest} + return dq, dr +} + +// DivRound divides and rounds to a given precision +// i.e. to an integer multiple of 10^(-precision) +// for a positive quotient digit 5 is rounded up, away from 0 +// if the quotient is negative then digit 5 is rounded down, away from 0 +// Note that precision<0 is allowed as input. +func (d Decimal) DivRound(d2 Decimal, precision int32) Decimal { + // QuoRem already checks initialization + q, r := d.QuoRem(d2, precision) + // the actual rounding decision is based on comparing r*10^precision and d2/2 + // instead compare 2 r 10 ^precision and d2 + var rv2 big.Int + rv2.Abs(r.value) + rv2.Lsh(&rv2, 1) + // now rv2 = abs(r.value) * 2 + r2 := Decimal{value: &rv2, exp: r.exp + precision} + // r2 is now 2 * r * 10 ^ precision + var c = r2.Cmp(d2.Abs()) + + if c < 0 { + return q + } + + if d.value.Sign()*d2.value.Sign() < 0 { + return q.Sub(New(1, -precision)) + } + + return q.Add(New(1, -precision)) +} + +// Mod returns d % d2. +func (d Decimal) Mod(d2 Decimal) Decimal { + quo := d.Div(d2).Truncate(0) + return d.Sub(d2.Mul(quo)) +} + +// Pow returns d to the power d2 +func (d Decimal) Pow(d2 Decimal) Decimal { + var temp Decimal + if d2.IntPart() == 0 { + return NewFromFloat(1) + } + temp = d.Pow(d2.Div(NewFromFloat(2))) + if d2.IntPart()%2 == 0 { + return temp.Mul(temp) + } + if d2.IntPart() > 0 { + return temp.Mul(temp).Mul(d) + } + return temp.Mul(temp).Div(d) +} + +// ExpHullAbrham calculates the natural exponent of decimal (e to the power of d) using Hull-Abraham algorithm. +// OverallPrecision argument specifies the overall precision of the result (integer part + decimal part). +// +// ExpHullAbrham is faster than ExpTaylor for small precision values, but it is much slower for large precision values. +// +// Example: +// +// NewFromFloat(26.1).ExpHullAbrham(2).String() // output: "220000000000" +// NewFromFloat(26.1).ExpHullAbrham(20).String() // output: "216314672147.05767284" +// +func (d Decimal) ExpHullAbrham(overallPrecision uint32) (Decimal, error) { + // Algorithm based on Variable precision exponential function. + // ACM Transactions on Mathematical Software by T. E. Hull & A. Abrham. + if d.IsZero() { + return Decimal{oneInt, 0}, nil + } + + currentPrecision := overallPrecision + + // Algorithm does not work if currentPrecision * 23 < |x|. + // Precision is automatically increased in such cases, so the value can be calculated precisely. + // If newly calculated precision is higher than ExpMaxIterations the currentPrecision will not be changed. + f := d.Abs().InexactFloat64() + if ncp := f / 23; ncp > float64(currentPrecision) && ncp < float64(ExpMaxIterations) { + currentPrecision = uint32(math.Ceil(ncp)) + } + + // fail if abs(d) beyond an over/underflow threshold + overflowThreshold := New(23*int64(currentPrecision), 0) + if d.Abs().Cmp(overflowThreshold) > 0 { + return Decimal{}, fmt.Errorf("over/underflow threshold, exp(x) cannot be calculated precisely") + } + + // Return 1 if abs(d) small enough; this also avoids later over/underflow + overflowThreshold2 := New(9, -int32(currentPrecision)-1) + if d.Abs().Cmp(overflowThreshold2) <= 0 { + return Decimal{oneInt, d.exp}, nil + } + + // t is the smallest integer >= 0 such that the corresponding abs(d/k) < 1 + t := d.exp + int32(d.NumDigits()) // Add d.NumDigits because the paper assumes that d.value [0.1, 1) + + if t < 0 { + t = 0 + } + + k := New(1, t) // reduction factor + r := Decimal{new(big.Int).Set(d.value), d.exp - t} // reduced argument + p := int32(currentPrecision) + t + 2 // precision for calculating the sum + + // Determine n, the number of therms for calculating sum + // use first Newton step (1.435p - 1.182) / log10(p/abs(r)) + // for solving appropriate equation, along with directed + // roundings and simple rational bound for log10(p/abs(r)) + rf := r.Abs().InexactFloat64() + pf := float64(p) + nf := math.Ceil((1.453*pf - 1.182) / math.Log10(pf/rf)) + if nf > float64(ExpMaxIterations) || math.IsNaN(nf) { + return Decimal{}, fmt.Errorf("exact value cannot be calculated in <=ExpMaxIterations iterations") + } + n := int64(nf) + + tmp := New(0, 0) + sum := New(1, 0) + one := New(1, 0) + for i := n - 1; i > 0; i-- { + tmp.value.SetInt64(i) + sum = sum.Mul(r.DivRound(tmp, p)) + sum = sum.Add(one) + } + + ki := k.IntPart() + res := New(1, 0) + for i := ki; i > 0; i-- { + res = res.Mul(sum) + } + + resNumDigits := int32(res.NumDigits()) + + var roundDigits int32 + if resNumDigits > abs(res.exp) { + roundDigits = int32(currentPrecision) - resNumDigits - res.exp + } else { + roundDigits = int32(currentPrecision) + } + + res = res.Round(roundDigits) + + return res, nil +} + +// ExpTaylor calculates the natural exponent of decimal (e to the power of d) using Taylor series expansion. +// Precision argument specifies how precise the result must be (number of digits after decimal point). +// Negative precision is allowed. +// +// ExpTaylor is much faster for large precision values than ExpHullAbrham. +// +// Example: +// +// d, err := NewFromFloat(26.1).ExpTaylor(2).String() +// d.String() // output: "216314672147.06" +// +// NewFromFloat(26.1).ExpTaylor(20).String() +// d.String() // output: "216314672147.05767284062928674083" +// +// NewFromFloat(26.1).ExpTaylor(-10).String() +// d.String() // output: "220000000000" +// +func (d Decimal) ExpTaylor(precision int32) (Decimal, error) { + // Note(mwoss): Implementation can be optimized by exclusively using big.Int API only + if d.IsZero() { + return Decimal{oneInt, 0}.Round(precision), nil + } + + var epsilon Decimal + var divPrecision int32 + if precision < 0 { + epsilon = New(1, -1) + divPrecision = 8 + } else { + epsilon = New(1, -precision-1) + divPrecision = precision + 1 + } + + decAbs := d.Abs() + pow := d.Abs() + factorial := New(1, 0) + + result := New(1, 0) + + for i := int64(1); ; { + step := pow.DivRound(factorial, divPrecision) + result = result.Add(step) + + // Stop Taylor series when current step is smaller than epsilon + if step.Cmp(epsilon) < 0 { + break + } + + pow = pow.Mul(decAbs) + + i++ + + // Calculate next factorial number or retrieve cached value + if len(factorials) >= int(i) && !factorials[i-1].IsZero() { + factorial = factorials[i-1] + } else { + // To avoid any race conditions, firstly the zero value is appended to a slice to create + // a spot for newly calculated factorial. After that, the zero value is replaced by calculated + // factorial using the index notation. + factorial = factorials[i-2].Mul(New(i, 0)) + factorials = append(factorials, Zero) + factorials[i-1] = factorial + } + } + + if d.Sign() < 0 { + result = New(1, 0).DivRound(result, precision+1) + } + + result = result.Round(precision) + return result, nil +} + +// NumDigits returns the number of digits of the decimal coefficient (d.Value) +// Note: Current implementation is extremely slow for large decimals and/or decimals with large fractional part +func (d Decimal) NumDigits() int { + // Note(mwoss): It can be optimized, unnecessary cast of big.Int to string + if d.IsNegative() { + return len(d.value.String()) - 1 + } + return len(d.value.String()) +} + +// IsInteger returns true when decimal can be represented as an integer value, otherwise, it returns false. +func (d Decimal) IsInteger() bool { + // The most typical case, all decimal with exponent higher or equal 0 can be represented as integer + if d.exp >= 0 { + return true + } + // When the exponent is negative we have to check every number after the decimal place + // If all of them are zeroes, we are sure that given decimal can be represented as an integer + var r big.Int + q := new(big.Int).Set(d.value) + for z := abs(d.exp); z > 0; z-- { + q.QuoRem(q, tenInt, &r) + if r.Cmp(zeroInt) != 0 { + return false + } + } + return true +} + +// Abs calculates absolute value of any int32. Used for calculating absolute value of decimal's exponent. +func abs(n int32) int32 { + if n < 0 { + return -n + } + return n +} + +// Cmp compares the numbers represented by d and d2 and returns: +// +// -1 if d < d2 +// 0 if d == d2 +// +1 if d > d2 +// +func (d Decimal) Cmp(d2 Decimal) int { + d.ensureInitialized() + d2.ensureInitialized() + + if d.exp == d2.exp { + return d.value.Cmp(d2.value) + } + + rd, rd2 := RescalePair(d, d2) + + return rd.value.Cmp(rd2.value) +} + +// Equal returns whether the numbers represented by d and d2 are equal. +func (d Decimal) Equal(d2 Decimal) bool { + return d.Cmp(d2) == 0 +} + +// Equals is deprecated, please use Equal method instead +func (d Decimal) Equals(d2 Decimal) bool { + return d.Equal(d2) +} + +// GreaterThan (GT) returns true when d is greater than d2. +func (d Decimal) GreaterThan(d2 Decimal) bool { + return d.Cmp(d2) == 1 +} + +// GreaterThanOrEqual (GTE) returns true when d is greater than or equal to d2. +func (d Decimal) GreaterThanOrEqual(d2 Decimal) bool { + cmp := d.Cmp(d2) + return cmp == 1 || cmp == 0 +} + +// LessThan (LT) returns true when d is less than d2. +func (d Decimal) LessThan(d2 Decimal) bool { + return d.Cmp(d2) == -1 +} + +// LessThanOrEqual (LTE) returns true when d is less than or equal to d2. +func (d Decimal) LessThanOrEqual(d2 Decimal) bool { + cmp := d.Cmp(d2) + return cmp == -1 || cmp == 0 +} + +// Sign returns: +// +// -1 if d < 0 +// 0 if d == 0 +// +1 if d > 0 +// +func (d Decimal) Sign() int { + if d.value == nil { + return 0 + } + return d.value.Sign() +} + +// IsPositive return +// +// true if d > 0 +// false if d == 0 +// false if d < 0 +func (d Decimal) IsPositive() bool { + return d.Sign() == 1 +} + +// IsNegative return +// +// true if d < 0 +// false if d == 0 +// false if d > 0 +func (d Decimal) IsNegative() bool { + return d.Sign() == -1 +} + +// IsZero return +// +// true if d == 0 +// false if d > 0 +// false if d < 0 +func (d Decimal) IsZero() bool { + return d.Sign() == 0 +} + +// Exponent returns the exponent, or scale component of the decimal. +func (d Decimal) Exponent() int32 { + return d.exp +} + +// Coefficient returns the coefficient of the decimal. It is scaled by 10^Exponent() +func (d Decimal) Coefficient() *big.Int { + d.ensureInitialized() + // we copy the coefficient so that mutating the result does not mutate the Decimal. + return new(big.Int).Set(d.value) +} + +// CoefficientInt64 returns the coefficient of the decimal as int64. It is scaled by 10^Exponent() +// If coefficient cannot be represented in an int64, the result will be undefined. +func (d Decimal) CoefficientInt64() int64 { + d.ensureInitialized() + return d.value.Int64() +} + +// IntPart returns the integer component of the decimal. +func (d Decimal) IntPart() int64 { + scaledD := d.rescale(0) + return scaledD.value.Int64() +} + +// BigInt returns integer component of the decimal as a BigInt. +func (d Decimal) BigInt() *big.Int { + scaledD := d.rescale(0) + i := &big.Int{} + i.SetString(scaledD.String(), 10) + return i +} + +// BigFloat returns decimal as BigFloat. +// Be aware that casting decimal to BigFloat might cause a loss of precision. +func (d Decimal) BigFloat() *big.Float { + f := &big.Float{} + f.SetString(d.String()) + return f +} + +// Rat returns a rational number representation of the decimal. +func (d Decimal) Rat() *big.Rat { + d.ensureInitialized() + if d.exp <= 0 { + // NOTE(vadim): must negate after casting to prevent int32 overflow + denom := new(big.Int).Exp(tenInt, big.NewInt(-int64(d.exp)), nil) + return new(big.Rat).SetFrac(d.value, denom) + } + + mul := new(big.Int).Exp(tenInt, big.NewInt(int64(d.exp)), nil) + num := new(big.Int).Mul(d.value, mul) + return new(big.Rat).SetFrac(num, oneInt) +} + +// Float64 returns the nearest float64 value for d and a bool indicating +// whether f represents d exactly. +// For more details, see the documentation for big.Rat.Float64 +func (d Decimal) Float64() (f float64, exact bool) { + return d.Rat().Float64() +} + +// InexactFloat64 returns the nearest float64 value for d. +// It doesn't indicate if the returned value represents d exactly. +func (d Decimal) InexactFloat64() float64 { + f, _ := d.Float64() + return f +} + +// String returns the string representation of the decimal +// with the fixed point. +// +// Example: +// +// d := New(-12345, -3) +// println(d.String()) +// +// Output: +// +// -12.345 +// +func (d Decimal) String() string { + return d.string(true) +} + +// StringFixed returns a rounded fixed-point string with places digits after +// the decimal point. +// +// Example: +// +// NewFromFloat(0).StringFixed(2) // output: "0.00" +// NewFromFloat(0).StringFixed(0) // output: "0" +// NewFromFloat(5.45).StringFixed(0) // output: "5" +// NewFromFloat(5.45).StringFixed(1) // output: "5.5" +// NewFromFloat(5.45).StringFixed(2) // output: "5.45" +// NewFromFloat(5.45).StringFixed(3) // output: "5.450" +// NewFromFloat(545).StringFixed(-1) // output: "550" +// +func (d Decimal) StringFixed(places int32) string { + rounded := d.Round(places) + return rounded.string(false) +} + +// StringFixedBank returns a banker rounded fixed-point string with places digits +// after the decimal point. +// +// Example: +// +// NewFromFloat(0).StringFixedBank(2) // output: "0.00" +// NewFromFloat(0).StringFixedBank(0) // output: "0" +// NewFromFloat(5.45).StringFixedBank(0) // output: "5" +// NewFromFloat(5.45).StringFixedBank(1) // output: "5.4" +// NewFromFloat(5.45).StringFixedBank(2) // output: "5.45" +// NewFromFloat(5.45).StringFixedBank(3) // output: "5.450" +// NewFromFloat(545).StringFixedBank(-1) // output: "540" +// +func (d Decimal) StringFixedBank(places int32) string { + rounded := d.RoundBank(places) + return rounded.string(false) +} + +// StringFixedCash returns a Swedish/Cash rounded fixed-point string. For +// more details see the documentation at function RoundCash. +func (d Decimal) StringFixedCash(interval uint8) string { + rounded := d.RoundCash(interval) + return rounded.string(false) +} + +// Round rounds the decimal to places decimal places. +// If places < 0, it will round the integer part to the nearest 10^(-places). +// +// Example: +// +// NewFromFloat(5.45).Round(1).String() // output: "5.5" +// NewFromFloat(545).Round(-1).String() // output: "550" +// +func (d Decimal) Round(places int32) Decimal { + if d.exp == -places { + return d + } + // truncate to places + 1 + ret := d.rescale(-places - 1) + + // add sign(d) * 0.5 + if ret.value.Sign() < 0 { + ret.value.Sub(ret.value, fiveInt) + } else { + ret.value.Add(ret.value, fiveInt) + } + + // floor for positive numbers, ceil for negative numbers + _, m := ret.value.DivMod(ret.value, tenInt, new(big.Int)) + ret.exp++ + if ret.value.Sign() < 0 && m.Cmp(zeroInt) != 0 { + ret.value.Add(ret.value, oneInt) + } + + return ret +} + +// RoundCeil rounds the decimal towards +infinity. +// +// Example: +// +// NewFromFloat(545).RoundCeil(-2).String() // output: "600" +// NewFromFloat(500).RoundCeil(-2).String() // output: "500" +// NewFromFloat(1.1001).RoundCeil(2).String() // output: "1.11" +// NewFromFloat(-1.454).RoundCeil(1).String() // output: "-1.5" +// +func (d Decimal) RoundCeil(places int32) Decimal { + if d.exp >= -places { + return d + } + + rescaled := d.rescale(-places) + if d.Equal(rescaled) { + return d + } + + if d.value.Sign() > 0 { + rescaled.value.Add(rescaled.value, oneInt) + } + + return rescaled +} + +// RoundFloor rounds the decimal towards -infinity. +// +// Example: +// +// NewFromFloat(545).RoundFloor(-2).String() // output: "500" +// NewFromFloat(-500).RoundFloor(-2).String() // output: "-500" +// NewFromFloat(1.1001).RoundFloor(2).String() // output: "1.1" +// NewFromFloat(-1.454).RoundFloor(1).String() // output: "-1.4" +// +func (d Decimal) RoundFloor(places int32) Decimal { + if d.exp >= -places { + return d + } + + rescaled := d.rescale(-places) + if d.Equal(rescaled) { + return d + } + + if d.value.Sign() < 0 { + rescaled.value.Sub(rescaled.value, oneInt) + } + + return rescaled +} + +// RoundUp rounds the decimal away from zero. +// +// Example: +// +// NewFromFloat(545).RoundUp(-2).String() // output: "600" +// NewFromFloat(500).RoundUp(-2).String() // output: "500" +// NewFromFloat(1.1001).RoundUp(2).String() // output: "1.11" +// NewFromFloat(-1.454).RoundUp(1).String() // output: "-1.4" +// +func (d Decimal) RoundUp(places int32) Decimal { + if d.exp >= -places { + return d + } + + rescaled := d.rescale(-places) + if d.Equal(rescaled) { + return d + } + + if d.value.Sign() > 0 { + rescaled.value.Add(rescaled.value, oneInt) + } else if d.value.Sign() < 0 { + rescaled.value.Sub(rescaled.value, oneInt) + } + + return rescaled +} + +// RoundDown rounds the decimal towards zero. +// +// Example: +// +// NewFromFloat(545).RoundDown(-2).String() // output: "500" +// NewFromFloat(-500).RoundDown(-2).String() // output: "-500" +// NewFromFloat(1.1001).RoundDown(2).String() // output: "1.1" +// NewFromFloat(-1.454).RoundDown(1).String() // output: "-1.5" +// +func (d Decimal) RoundDown(places int32) Decimal { + if d.exp >= -places { + return d + } + + rescaled := d.rescale(-places) + if d.Equal(rescaled) { + return d + } + return rescaled +} + +// RoundBank rounds the decimal to places decimal places. +// If the final digit to round is equidistant from the nearest two integers the +// rounded value is taken as the even number +// +// If places < 0, it will round the integer part to the nearest 10^(-places). +// +// Examples: +// +// NewFromFloat(5.45).RoundBank(1).String() // output: "5.4" +// NewFromFloat(545).RoundBank(-1).String() // output: "540" +// NewFromFloat(5.46).RoundBank(1).String() // output: "5.5" +// NewFromFloat(546).RoundBank(-1).String() // output: "550" +// NewFromFloat(5.55).RoundBank(1).String() // output: "5.6" +// NewFromFloat(555).RoundBank(-1).String() // output: "560" +// +func (d Decimal) RoundBank(places int32) Decimal { + + round := d.Round(places) + remainder := d.Sub(round).Abs() + + half := New(5, -places-1) + if remainder.Cmp(half) == 0 && round.value.Bit(0) != 0 { + if round.value.Sign() < 0 { + round.value.Add(round.value, oneInt) + } else { + round.value.Sub(round.value, oneInt) + } + } + + return round +} + +// RoundCash aka Cash/Penny/öre rounding rounds decimal to a specific +// interval. The amount payable for a cash transaction is rounded to the nearest +// multiple of the minimum currency unit available. The following intervals are +// available: 5, 10, 25, 50 and 100; any other number throws a panic. +// 5: 5 cent rounding 3.43 => 3.45 +// 10: 10 cent rounding 3.45 => 3.50 (5 gets rounded up) +// 25: 25 cent rounding 3.41 => 3.50 +// 50: 50 cent rounding 3.75 => 4.00 +// 100: 100 cent rounding 3.50 => 4.00 +// For more details: https://en.wikipedia.org/wiki/Cash_rounding +func (d Decimal) RoundCash(interval uint8) Decimal { + var iVal *big.Int + switch interval { + case 5: + iVal = twentyInt + case 10: + iVal = tenInt + case 25: + iVal = fourInt + case 50: + iVal = twoInt + case 100: + iVal = oneInt + default: + panic(fmt.Sprintf("Decimal does not support this Cash rounding interval `%d`. Supported: 5, 10, 25, 50, 100", interval)) + } + dVal := Decimal{ + value: iVal, + } + + // TODO: optimize those calculations to reduce the high allocations (~29 allocs). + return d.Mul(dVal).Round(0).Div(dVal).Truncate(2) +} + +// Floor returns the nearest integer value less than or equal to d. +func (d Decimal) Floor() Decimal { + d.ensureInitialized() + + if d.exp >= 0 { + return d + } + + exp := big.NewInt(10) + + // NOTE(vadim): must negate after casting to prevent int32 overflow + exp.Exp(exp, big.NewInt(-int64(d.exp)), nil) + + z := new(big.Int).Div(d.value, exp) + return Decimal{value: z, exp: 0} +} + +// Ceil returns the nearest integer value greater than or equal to d. +func (d Decimal) Ceil() Decimal { + d.ensureInitialized() + + if d.exp >= 0 { + return d + } + + exp := big.NewInt(10) + + // NOTE(vadim): must negate after casting to prevent int32 overflow + exp.Exp(exp, big.NewInt(-int64(d.exp)), nil) + + z, m := new(big.Int).DivMod(d.value, exp, new(big.Int)) + if m.Cmp(zeroInt) != 0 { + z.Add(z, oneInt) + } + return Decimal{value: z, exp: 0} +} + +// Truncate truncates off digits from the number, without rounding. +// +// NOTE: precision is the last digit that will not be truncated (must be >= 0). +// +// Example: +// +// decimal.NewFromString("123.456").Truncate(2).String() // "123.45" +// +func (d Decimal) Truncate(precision int32) Decimal { + d.ensureInitialized() + if precision >= 0 && -precision > d.exp { + return d.rescale(-precision) + } + return d +} + +// UnmarshalJSON implements the json.Unmarshaler interface. +func (d *Decimal) UnmarshalJSON(decimalBytes []byte) error { + if string(decimalBytes) == "null" { + return nil + } + + str, err := unquoteIfQuoted(decimalBytes) + if err != nil { + return fmt.Errorf("error decoding string '%s': %s", decimalBytes, err) + } + + decimal, err := NewFromString(str) + *d = decimal + if err != nil { + return fmt.Errorf("error decoding string '%s': %s", str, err) + } + return nil +} + +// MarshalJSON implements the json.Marshaler interface. +func (d Decimal) MarshalJSON() ([]byte, error) { + var str string + if MarshalJSONWithoutQuotes { + str = d.String() + } else { + str = "\"" + d.String() + "\"" + } + return []byte(str), nil +} + +// UnmarshalBinary implements the encoding.BinaryUnmarshaler interface. As a string representation +// is already used when encoding to text, this method stores that string as []byte +func (d *Decimal) UnmarshalBinary(data []byte) error { + // Verify we have at least 4 bytes for the exponent. The GOB encoded value + // may be empty. + if len(data) < 4 { + return fmt.Errorf("error decoding binary %v: expected at least 4 bytes, got %d", data, len(data)) + } + + // Extract the exponent + d.exp = int32(binary.BigEndian.Uint32(data[:4])) + + // Extract the value + d.value = new(big.Int) + if err := d.value.GobDecode(data[4:]); err != nil { + return fmt.Errorf("error decoding binary %v: %s", data, err) + } + + return nil +} + +// MarshalBinary implements the encoding.BinaryMarshaler interface. +func (d Decimal) MarshalBinary() (data []byte, err error) { + // Write the exponent first since it's a fixed size + v1 := make([]byte, 4) + binary.BigEndian.PutUint32(v1, uint32(d.exp)) + + // Add the value + var v2 []byte + if v2, err = d.value.GobEncode(); err != nil { + return + } + + // Return the byte array + data = append(v1, v2...) + return +} + +// Scan implements the sql.Scanner interface for database deserialization. +func (d *Decimal) Scan(value interface{}) error { + // first try to see if the data is stored in database as a Numeric datatype + switch v := value.(type) { + + case float32: + *d = NewFromFloat(float64(v)) + return nil + + case float64: + // numeric in sqlite3 sends us float64 + *d = NewFromFloat(v) + return nil + + case int64: + // at least in sqlite3 when the value is 0 in db, the data is sent + // to us as an int64 instead of a float64 ... + *d = New(v, 0) + return nil + + default: + // default is trying to interpret value stored as string + str, err := unquoteIfQuoted(v) + if err != nil { + return err + } + *d, err = NewFromString(str) + return err + } +} + +// Value implements the driver.Valuer interface for database serialization. +func (d Decimal) Value() (driver.Value, error) { + return d.String(), nil +} + +// UnmarshalText implements the encoding.TextUnmarshaler interface for XML +// deserialization. +func (d *Decimal) UnmarshalText(text []byte) error { + str := string(text) + + dec, err := NewFromString(str) + *d = dec + if err != nil { + return fmt.Errorf("error decoding string '%s': %s", str, err) + } + + return nil +} + +// MarshalText implements the encoding.TextMarshaler interface for XML +// serialization. +func (d Decimal) MarshalText() (text []byte, err error) { + return []byte(d.String()), nil +} + +// GobEncode implements the gob.GobEncoder interface for gob serialization. +func (d Decimal) GobEncode() ([]byte, error) { + return d.MarshalBinary() +} + +// GobDecode implements the gob.GobDecoder interface for gob serialization. +func (d *Decimal) GobDecode(data []byte) error { + return d.UnmarshalBinary(data) +} + +// StringScaled first scales the decimal then calls .String() on it. +// NOTE: buggy, unintuitive, and DEPRECATED! Use StringFixed instead. +func (d Decimal) StringScaled(exp int32) string { + return d.rescale(exp).String() +} + +func (d Decimal) string(trimTrailingZeros bool) string { + if d.exp >= 0 { + return d.rescale(0).value.String() + } + + abs := new(big.Int).Abs(d.value) + str := abs.String() + + var intPart, fractionalPart string + + // NOTE(vadim): this cast to int will cause bugs if d.exp == INT_MIN + // and you are on a 32-bit machine. Won't fix this super-edge case. + dExpInt := int(d.exp) + if len(str) > -dExpInt { + intPart = str[:len(str)+dExpInt] + fractionalPart = str[len(str)+dExpInt:] + } else { + intPart = "0" + + num0s := -dExpInt - len(str) + fractionalPart = strings.Repeat("0", num0s) + str + } + + if trimTrailingZeros { + i := len(fractionalPart) - 1 + for ; i >= 0; i-- { + if fractionalPart[i] != '0' { + break + } + } + fractionalPart = fractionalPart[:i+1] + } + + number := intPart + if len(fractionalPart) > 0 { + number += "." + fractionalPart + } + + if d.value.Sign() < 0 { + return "-" + number + } + + return number +} + +func (d *Decimal) ensureInitialized() { + if d.value == nil { + d.value = new(big.Int) + } +} + +// Min returns the smallest Decimal that was passed in the arguments. +// +// To call this function with an array, you must do: +// +// Min(arr[0], arr[1:]...) +// +// This makes it harder to accidentally call Min with 0 arguments. +func Min(first Decimal, rest ...Decimal) Decimal { + ans := first + for _, item := range rest { + if item.Cmp(ans) < 0 { + ans = item + } + } + return ans +} + +// Max returns the largest Decimal that was passed in the arguments. +// +// To call this function with an array, you must do: +// +// Max(arr[0], arr[1:]...) +// +// This makes it harder to accidentally call Max with 0 arguments. +func Max(first Decimal, rest ...Decimal) Decimal { + ans := first + for _, item := range rest { + if item.Cmp(ans) > 0 { + ans = item + } + } + return ans +} + +// Sum returns the combined total of the provided first and rest Decimals +func Sum(first Decimal, rest ...Decimal) Decimal { + total := first + for _, item := range rest { + total = total.Add(item) + } + + return total +} + +// Avg returns the average value of the provided first and rest Decimals +func Avg(first Decimal, rest ...Decimal) Decimal { + count := New(int64(len(rest)+1), 0) + sum := Sum(first, rest...) + return sum.Div(count) +} + +// RescalePair rescales two decimals to common exponential value (minimal exp of both decimals) +func RescalePair(d1 Decimal, d2 Decimal) (Decimal, Decimal) { + d1.ensureInitialized() + d2.ensureInitialized() + + if d1.exp == d2.exp { + return d1, d2 + } + + baseScale := min(d1.exp, d2.exp) + if baseScale != d1.exp { + return d1.rescale(baseScale), d2 + } + return d1, d2.rescale(baseScale) +} + +func min(x, y int32) int32 { + if x >= y { + return y + } + return x +} + +func unquoteIfQuoted(value interface{}) (string, error) { + var bytes []byte + + switch v := value.(type) { + case string: + bytes = []byte(v) + case []byte: + bytes = v + default: + return "", fmt.Errorf("could not convert value '%+v' to byte array of type '%T'", + value, value) + } + + // If the amount is quoted, strip the quotes + if len(bytes) > 2 && bytes[0] == '"' && bytes[len(bytes)-1] == '"' { + bytes = bytes[1 : len(bytes)-1] + } + return string(bytes), nil +} + +// NullDecimal represents a nullable decimal with compatibility for +// scanning null values from the database. +type NullDecimal struct { + Decimal Decimal + Valid bool +} + +func NewNullDecimal(d Decimal) NullDecimal { + return NullDecimal{ + Decimal: d, + Valid: true, + } +} + +// Scan implements the sql.Scanner interface for database deserialization. +func (d *NullDecimal) Scan(value interface{}) error { + if value == nil { + d.Valid = false + return nil + } + d.Valid = true + return d.Decimal.Scan(value) +} + +// Value implements the driver.Valuer interface for database serialization. +func (d NullDecimal) Value() (driver.Value, error) { + if !d.Valid { + return nil, nil + } + return d.Decimal.Value() +} + +// UnmarshalJSON implements the json.Unmarshaler interface. +func (d *NullDecimal) UnmarshalJSON(decimalBytes []byte) error { + if string(decimalBytes) == "null" { + d.Valid = false + return nil + } + d.Valid = true + return d.Decimal.UnmarshalJSON(decimalBytes) +} + +// MarshalJSON implements the json.Marshaler interface. +func (d NullDecimal) MarshalJSON() ([]byte, error) { + if !d.Valid { + return []byte("null"), nil + } + return d.Decimal.MarshalJSON() +} + +// UnmarshalText implements the encoding.TextUnmarshaler interface for XML +// deserialization +func (d *NullDecimal) UnmarshalText(text []byte) error { + str := string(text) + + // check for empty XML or XML without body e.g., + if str == "" { + d.Valid = false + return nil + } + if err := d.Decimal.UnmarshalText(text); err != nil { + d.Valid = false + return err + } + d.Valid = true + return nil +} + +// MarshalText implements the encoding.TextMarshaler interface for XML +// serialization. +func (d NullDecimal) MarshalText() (text []byte, err error) { + if !d.Valid { + return []byte{}, nil + } + return d.Decimal.MarshalText() +} + +// Trig functions + +// Atan returns the arctangent, in radians, of x. +func (d Decimal) Atan() Decimal { + if d.Equal(NewFromFloat(0.0)) { + return d + } + if d.GreaterThan(NewFromFloat(0.0)) { + return d.satan() + } + return d.Neg().satan().Neg() +} + +func (d Decimal) xatan() Decimal { + P0 := NewFromFloat(-8.750608600031904122785e-01) + P1 := NewFromFloat(-1.615753718733365076637e+01) + P2 := NewFromFloat(-7.500855792314704667340e+01) + P3 := NewFromFloat(-1.228866684490136173410e+02) + P4 := NewFromFloat(-6.485021904942025371773e+01) + Q0 := NewFromFloat(2.485846490142306297962e+01) + Q1 := NewFromFloat(1.650270098316988542046e+02) + Q2 := NewFromFloat(4.328810604912902668951e+02) + Q3 := NewFromFloat(4.853903996359136964868e+02) + Q4 := NewFromFloat(1.945506571482613964425e+02) + z := d.Mul(d) + b1 := P0.Mul(z).Add(P1).Mul(z).Add(P2).Mul(z).Add(P3).Mul(z).Add(P4).Mul(z) + b2 := z.Add(Q0).Mul(z).Add(Q1).Mul(z).Add(Q2).Mul(z).Add(Q3).Mul(z).Add(Q4) + z = b1.Div(b2) + z = d.Mul(z).Add(d) + return z +} + +// satan reduces its argument (known to be positive) +// to the range [0, 0.66] and calls xatan. +func (d Decimal) satan() Decimal { + Morebits := NewFromFloat(6.123233995736765886130e-17) // pi/2 = PIO2 + Morebits + Tan3pio8 := NewFromFloat(2.41421356237309504880) // tan(3*pi/8) + pi := NewFromFloat(3.14159265358979323846264338327950288419716939937510582097494459) + + if d.LessThanOrEqual(NewFromFloat(0.66)) { + return d.xatan() + } + if d.GreaterThan(Tan3pio8) { + return pi.Div(NewFromFloat(2.0)).Sub(NewFromFloat(1.0).Div(d).xatan()).Add(Morebits) + } + return pi.Div(NewFromFloat(4.0)).Add((d.Sub(NewFromFloat(1.0)).Div(d.Add(NewFromFloat(1.0)))).xatan()).Add(NewFromFloat(0.5).Mul(Morebits)) +} + +// sin coefficients +var _sin = [...]Decimal{ + NewFromFloat(1.58962301576546568060e-10), // 0x3de5d8fd1fd19ccd + NewFromFloat(-2.50507477628578072866e-8), // 0xbe5ae5e5a9291f5d + NewFromFloat(2.75573136213857245213e-6), // 0x3ec71de3567d48a1 + NewFromFloat(-1.98412698295895385996e-4), // 0xbf2a01a019bfdf03 + NewFromFloat(8.33333333332211858878e-3), // 0x3f8111111110f7d0 + NewFromFloat(-1.66666666666666307295e-1), // 0xbfc5555555555548 +} + +// Sin returns the sine of the radian argument x. +func (d Decimal) Sin() Decimal { + PI4A := NewFromFloat(7.85398125648498535156e-1) // 0x3fe921fb40000000, Pi/4 split into three parts + PI4B := NewFromFloat(3.77489470793079817668e-8) // 0x3e64442d00000000, + PI4C := NewFromFloat(2.69515142907905952645e-15) // 0x3ce8469898cc5170, + M4PI := NewFromFloat(1.273239544735162542821171882678754627704620361328125) // 4/pi + + if d.Equal(NewFromFloat(0.0)) { + return d + } + // make argument positive but save the sign + sign := false + if d.LessThan(NewFromFloat(0.0)) { + d = d.Neg() + sign = true + } + + j := d.Mul(M4PI).IntPart() // integer part of x/(Pi/4), as integer for tests on the phase angle + y := NewFromFloat(float64(j)) // integer part of x/(Pi/4), as float + + // map zeros to origin + if j&1 == 1 { + j++ + y = y.Add(NewFromFloat(1.0)) + } + j &= 7 // octant modulo 2Pi radians (360 degrees) + // reflect in x axis + if j > 3 { + sign = !sign + j -= 4 + } + z := d.Sub(y.Mul(PI4A)).Sub(y.Mul(PI4B)).Sub(y.Mul(PI4C)) // Extended precision modular arithmetic + zz := z.Mul(z) + + if j == 1 || j == 2 { + w := zz.Mul(zz).Mul(_cos[0].Mul(zz).Add(_cos[1]).Mul(zz).Add(_cos[2]).Mul(zz).Add(_cos[3]).Mul(zz).Add(_cos[4]).Mul(zz).Add(_cos[5])) + y = NewFromFloat(1.0).Sub(NewFromFloat(0.5).Mul(zz)).Add(w) + } else { + y = z.Add(z.Mul(zz).Mul(_sin[0].Mul(zz).Add(_sin[1]).Mul(zz).Add(_sin[2]).Mul(zz).Add(_sin[3]).Mul(zz).Add(_sin[4]).Mul(zz).Add(_sin[5]))) + } + if sign { + y = y.Neg() + } + return y +} + +// cos coefficients +var _cos = [...]Decimal{ + NewFromFloat(-1.13585365213876817300e-11), // 0xbda8fa49a0861a9b + NewFromFloat(2.08757008419747316778e-9), // 0x3e21ee9d7b4e3f05 + NewFromFloat(-2.75573141792967388112e-7), // 0xbe927e4f7eac4bc6 + NewFromFloat(2.48015872888517045348e-5), // 0x3efa01a019c844f5 + NewFromFloat(-1.38888888888730564116e-3), // 0xbf56c16c16c14f91 + NewFromFloat(4.16666666666665929218e-2), // 0x3fa555555555554b +} + +// Cos returns the cosine of the radian argument x. +func (d Decimal) Cos() Decimal { + + PI4A := NewFromFloat(7.85398125648498535156e-1) // 0x3fe921fb40000000, Pi/4 split into three parts + PI4B := NewFromFloat(3.77489470793079817668e-8) // 0x3e64442d00000000, + PI4C := NewFromFloat(2.69515142907905952645e-15) // 0x3ce8469898cc5170, + M4PI := NewFromFloat(1.273239544735162542821171882678754627704620361328125) // 4/pi + + // make argument positive + sign := false + if d.LessThan(NewFromFloat(0.0)) { + d = d.Neg() + } + + j := d.Mul(M4PI).IntPart() // integer part of x/(Pi/4), as integer for tests on the phase angle + y := NewFromFloat(float64(j)) // integer part of x/(Pi/4), as float + + // map zeros to origin + if j&1 == 1 { + j++ + y = y.Add(NewFromFloat(1.0)) + } + j &= 7 // octant modulo 2Pi radians (360 degrees) + // reflect in x axis + if j > 3 { + sign = !sign + j -= 4 + } + if j > 1 { + sign = !sign + } + + z := d.Sub(y.Mul(PI4A)).Sub(y.Mul(PI4B)).Sub(y.Mul(PI4C)) // Extended precision modular arithmetic + zz := z.Mul(z) + + if j == 1 || j == 2 { + y = z.Add(z.Mul(zz).Mul(_sin[0].Mul(zz).Add(_sin[1]).Mul(zz).Add(_sin[2]).Mul(zz).Add(_sin[3]).Mul(zz).Add(_sin[4]).Mul(zz).Add(_sin[5]))) + } else { + w := zz.Mul(zz).Mul(_cos[0].Mul(zz).Add(_cos[1]).Mul(zz).Add(_cos[2]).Mul(zz).Add(_cos[3]).Mul(zz).Add(_cos[4]).Mul(zz).Add(_cos[5])) + y = NewFromFloat(1.0).Sub(NewFromFloat(0.5).Mul(zz)).Add(w) + } + if sign { + y = y.Neg() + } + return y +} + +var _tanP = [...]Decimal{ + NewFromFloat(-1.30936939181383777646e+4), // 0xc0c992d8d24f3f38 + NewFromFloat(1.15351664838587416140e+6), // 0x413199eca5fc9ddd + NewFromFloat(-1.79565251976484877988e+7), // 0xc1711fead3299176 +} +var _tanQ = [...]Decimal{ + NewFromFloat(1.00000000000000000000e+0), + NewFromFloat(1.36812963470692954678e+4), //0x40cab8a5eeb36572 + NewFromFloat(-1.32089234440210967447e+6), //0xc13427bc582abc96 + NewFromFloat(2.50083801823357915839e+7), //0x4177d98fc2ead8ef + NewFromFloat(-5.38695755929454629881e+7), //0xc189afe03cbe5a31 +} + +// Tan returns the tangent of the radian argument x. +func (d Decimal) Tan() Decimal { + + PI4A := NewFromFloat(7.85398125648498535156e-1) // 0x3fe921fb40000000, Pi/4 split into three parts + PI4B := NewFromFloat(3.77489470793079817668e-8) // 0x3e64442d00000000, + PI4C := NewFromFloat(2.69515142907905952645e-15) // 0x3ce8469898cc5170, + M4PI := NewFromFloat(1.273239544735162542821171882678754627704620361328125) // 4/pi + + if d.Equal(NewFromFloat(0.0)) { + return d + } + + // make argument positive but save the sign + sign := false + if d.LessThan(NewFromFloat(0.0)) { + d = d.Neg() + sign = true + } + + j := d.Mul(M4PI).IntPart() // integer part of x/(Pi/4), as integer for tests on the phase angle + y := NewFromFloat(float64(j)) // integer part of x/(Pi/4), as float + + // map zeros to origin + if j&1 == 1 { + j++ + y = y.Add(NewFromFloat(1.0)) + } + + z := d.Sub(y.Mul(PI4A)).Sub(y.Mul(PI4B)).Sub(y.Mul(PI4C)) // Extended precision modular arithmetic + zz := z.Mul(z) + + if zz.GreaterThan(NewFromFloat(1e-14)) { + w := zz.Mul(_tanP[0].Mul(zz).Add(_tanP[1]).Mul(zz).Add(_tanP[2])) + x := zz.Add(_tanQ[1]).Mul(zz).Add(_tanQ[2]).Mul(zz).Add(_tanQ[3]).Mul(zz).Add(_tanQ[4]) + y = z.Add(z.Mul(w.Div(x))) + } else { + y = z + } + if j&2 == 2 { + y = NewFromFloat(-1.0).Div(y) + } + if sign { + y = y.Neg() + } + return y +} diff --git a/vendor/github.com/shopspring/decimal/rounding.go b/vendor/github.com/shopspring/decimal/rounding.go new file mode 100644 index 0000000..d4b0cd0 --- /dev/null +++ b/vendor/github.com/shopspring/decimal/rounding.go @@ -0,0 +1,160 @@ +// Copyright 2009 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Multiprecision decimal numbers. +// For floating-point formatting only; not general purpose. +// Only operations are assign and (binary) left/right shift. +// Can do binary floating point in multiprecision decimal precisely +// because 2 divides 10; cannot do decimal floating point +// in multiprecision binary precisely. + +package decimal + +type floatInfo struct { + mantbits uint + expbits uint + bias int +} + +var float32info = floatInfo{23, 8, -127} +var float64info = floatInfo{52, 11, -1023} + +// roundShortest rounds d (= mant * 2^exp) to the shortest number of digits +// that will let the original floating point value be precisely reconstructed. +func roundShortest(d *decimal, mant uint64, exp int, flt *floatInfo) { + // If mantissa is zero, the number is zero; stop now. + if mant == 0 { + d.nd = 0 + return + } + + // Compute upper and lower such that any decimal number + // between upper and lower (possibly inclusive) + // will round to the original floating point number. + + // We may see at once that the number is already shortest. + // + // Suppose d is not denormal, so that 2^exp <= d < 10^dp. + // The closest shorter number is at least 10^(dp-nd) away. + // The lower/upper bounds computed below are at distance + // at most 2^(exp-mantbits). + // + // So the number is already shortest if 10^(dp-nd) > 2^(exp-mantbits), + // or equivalently log2(10)*(dp-nd) > exp-mantbits. + // It is true if 332/100*(dp-nd) >= exp-mantbits (log2(10) > 3.32). + minexp := flt.bias + 1 // minimum possible exponent + if exp > minexp && 332*(d.dp-d.nd) >= 100*(exp-int(flt.mantbits)) { + // The number is already shortest. + return + } + + // d = mant << (exp - mantbits) + // Next highest floating point number is mant+1 << exp-mantbits. + // Our upper bound is halfway between, mant*2+1 << exp-mantbits-1. + upper := new(decimal) + upper.Assign(mant*2 + 1) + upper.Shift(exp - int(flt.mantbits) - 1) + + // d = mant << (exp - mantbits) + // Next lowest floating point number is mant-1 << exp-mantbits, + // unless mant-1 drops the significant bit and exp is not the minimum exp, + // in which case the next lowest is mant*2-1 << exp-mantbits-1. + // Either way, call it mantlo << explo-mantbits. + // Our lower bound is halfway between, mantlo*2+1 << explo-mantbits-1. + var mantlo uint64 + var explo int + if mant > 1<= d.nd { + break + } + li := ui - upper.dp + lower.dp + l := byte('0') // lower digit + if li >= 0 && li < lower.nd { + l = lower.d[li] + } + m := byte('0') // middle digit + if mi >= 0 { + m = d.d[mi] + } + u := byte('0') // upper digit + if ui < upper.nd { + u = upper.d[ui] + } + + // Okay to round down (truncate) if lower has a different digit + // or if lower is inclusive and is exactly the result of rounding + // down (i.e., and we have reached the final digit of lower). + okdown := l != m || inclusive && li+1 == lower.nd + + switch { + case upperdelta == 0 && m+1 < u: + // Example: + // m = 12345xxx + // u = 12347xxx + upperdelta = 2 + case upperdelta == 0 && m != u: + // Example: + // m = 12345xxx + // u = 12346xxx + upperdelta = 1 + case upperdelta == 1 && (m != '9' || u != '0'): + // Example: + // m = 1234598x + // u = 1234600x + upperdelta = 2 + } + // Okay to round up if upper has a different digit and either upper + // is inclusive or upper is bigger than the result of rounding up. + okup := upperdelta > 0 && (inclusive || upperdelta > 1 || ui+1 < upper.nd) + + // If it's okay to do either, then round to the nearest one. + // If it's okay to do only one, do it. + switch { + case okdown && okup: + d.Round(mi + 1) + return + case okdown: + d.RoundDown(mi + 1) + return + case okup: + d.RoundUp(mi + 1) + return + } + } +} diff --git a/vendor/github.com/spf13/cast/.gitignore b/vendor/github.com/spf13/cast/.gitignore new file mode 100644 index 0000000..53053a8 --- /dev/null +++ b/vendor/github.com/spf13/cast/.gitignore @@ -0,0 +1,25 @@ +# Compiled Object files, Static and Dynamic libs (Shared Objects) +*.o +*.a +*.so + +# Folders +_obj +_test + +# Architecture specific extensions/prefixes +*.[568vq] +[568vq].out + +*.cgo1.go +*.cgo2.c +_cgo_defun.c +_cgo_gotypes.go +_cgo_export.* + +_testmain.go + +*.exe +*.test + +*.bench diff --git a/vendor/github.com/spf13/cast/LICENSE b/vendor/github.com/spf13/cast/LICENSE new file mode 100644 index 0000000..4527efb --- /dev/null +++ b/vendor/github.com/spf13/cast/LICENSE @@ -0,0 +1,21 @@ +The MIT License (MIT) + +Copyright (c) 2014 Steve Francia + +Permission is hereby granted, free of charge, to any person obtaining a copy +of this software and associated documentation files (the "Software"), to deal +in the Software without restriction, including without limitation the rights +to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +copies of the Software, and to permit persons to whom the Software is +furnished to do so, subject to the following conditions: + +The above copyright notice and this permission notice shall be included in all +copies or substantial portions of the Software. + +THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE +SOFTWARE. \ No newline at end of file diff --git a/vendor/github.com/spf13/cast/Makefile b/vendor/github.com/spf13/cast/Makefile new file mode 100644 index 0000000..f01a5db --- /dev/null +++ b/vendor/github.com/spf13/cast/Makefile @@ -0,0 +1,40 @@ +GOVERSION := $(shell go version | cut -d ' ' -f 3 | cut -d '.' -f 2) + +.PHONY: check fmt lint test test-race vet test-cover-html help +.DEFAULT_GOAL := help + +check: test-race fmt vet lint ## Run tests and linters + +test: ## Run tests + go test ./... + +test-race: ## Run tests with race detector + go test -race ./... + +fmt: ## Run gofmt linter +ifeq "$(GOVERSION)" "12" + @for d in `go list` ; do \ + if [ "`gofmt -l -s $$GOPATH/src/$$d | tee /dev/stderr`" ]; then \ + echo "^ improperly formatted go files" && echo && exit 1; \ + fi \ + done +endif + +lint: ## Run golint linter + @for d in `go list` ; do \ + if [ "`golint $$d | tee /dev/stderr`" ]; then \ + echo "^ golint errors!" && echo && exit 1; \ + fi \ + done + +vet: ## Run go vet linter + @if [ "`go vet | tee /dev/stderr`" ]; then \ + echo "^ go vet errors!" && echo && exit 1; \ + fi + +test-cover-html: ## Generate test coverage report + go test -coverprofile=coverage.out -covermode=count + go tool cover -func=coverage.out + +help: + @grep -E '^[a-zA-Z0-9_-]+:.*?## .*$$' $(MAKEFILE_LIST) | sort | awk 'BEGIN {FS = ":.*?## "}; {printf "\033[36m%-30s\033[0m %s\n", $$1, $$2}' diff --git a/vendor/github.com/spf13/cast/README.md b/vendor/github.com/spf13/cast/README.md new file mode 100644 index 0000000..120a573 --- /dev/null +++ b/vendor/github.com/spf13/cast/README.md @@ -0,0 +1,75 @@ +cast +==== +[![GoDoc](https://godoc.org/github.com/spf13/cast?status.svg)](https://godoc.org/github.com/spf13/cast) +[![Build Status](https://github.com/spf13/cast/actions/workflows/go.yml/badge.svg)](https://github.com/spf13/cast/actions/workflows/go.yml) +[![Go Report Card](https://goreportcard.com/badge/github.com/spf13/cast)](https://goreportcard.com/report/github.com/spf13/cast) + +Easy and safe casting from one type to another in Go + +Don’t Panic! ... Cast + +## What is Cast? + +Cast is a library to convert between different go types in a consistent and easy way. + +Cast provides simple functions to easily convert a number to a string, an +interface into a bool, etc. Cast does this intelligently when an obvious +conversion is possible. It doesn’t make any attempts to guess what you meant, +for example you can only convert a string to an int when it is a string +representation of an int such as “8”. Cast was developed for use in +[Hugo](http://hugo.spf13.com), a website engine which uses YAML, TOML or JSON +for meta data. + +## Why use Cast? + +When working with dynamic data in Go you often need to cast or convert the data +from one type into another. Cast goes beyond just using type assertion (though +it uses that when possible) to provide a very straightforward and convenient +library. + +If you are working with interfaces to handle things like dynamic content +you’ll need an easy way to convert an interface into a given type. This +is the library for you. + +If you are taking in data from YAML, TOML or JSON or other formats which lack +full types, then Cast is the library for you. + +## Usage + +Cast provides a handful of To_____ methods. These methods will always return +the desired type. **If input is provided that will not convert to that type, the +0 or nil value for that type will be returned**. + +Cast also provides identical methods To_____E. These return the same result as +the To_____ methods, plus an additional error which tells you if it successfully +converted. Using these methods you can tell the difference between when the +input matched the zero value or when the conversion failed and the zero value +was returned. + +The following examples are merely a sample of what is available. Please review +the code for a complete set. + +### Example ‘ToString’: + + cast.ToString("mayonegg") // "mayonegg" + cast.ToString(8) // "8" + cast.ToString(8.31) // "8.31" + cast.ToString([]byte("one time")) // "one time" + cast.ToString(nil) // "" + + var foo interface{} = "one more time" + cast.ToString(foo) // "one more time" + + +### Example ‘ToInt’: + + cast.ToInt(8) // 8 + cast.ToInt(8.31) // 8 + cast.ToInt("8") // 8 + cast.ToInt(true) // 1 + cast.ToInt(false) // 0 + + var eight interface{} = 8 + cast.ToInt(eight) // 8 + cast.ToInt(nil) // 0 + diff --git a/vendor/github.com/spf13/cast/cast.go b/vendor/github.com/spf13/cast/cast.go new file mode 100644 index 0000000..0cfe941 --- /dev/null +++ b/vendor/github.com/spf13/cast/cast.go @@ -0,0 +1,176 @@ +// Copyright © 2014 Steve Francia . +// +// Use of this source code is governed by an MIT-style +// license that can be found in the LICENSE file. + +// Package cast provides easy and safe casting in Go. +package cast + +import "time" + +// ToBool casts an interface to a bool type. +func ToBool(i interface{}) bool { + v, _ := ToBoolE(i) + return v +} + +// ToTime casts an interface to a time.Time type. +func ToTime(i interface{}) time.Time { + v, _ := ToTimeE(i) + return v +} + +func ToTimeInDefaultLocation(i interface{}, location *time.Location) time.Time { + v, _ := ToTimeInDefaultLocationE(i, location) + return v +} + +// ToDuration casts an interface to a time.Duration type. +func ToDuration(i interface{}) time.Duration { + v, _ := ToDurationE(i) + return v +} + +// ToFloat64 casts an interface to a float64 type. +func ToFloat64(i interface{}) float64 { + v, _ := ToFloat64E(i) + return v +} + +// ToFloat32 casts an interface to a float32 type. +func ToFloat32(i interface{}) float32 { + v, _ := ToFloat32E(i) + return v +} + +// ToInt64 casts an interface to an int64 type. +func ToInt64(i interface{}) int64 { + v, _ := ToInt64E(i) + return v +} + +// ToInt32 casts an interface to an int32 type. +func ToInt32(i interface{}) int32 { + v, _ := ToInt32E(i) + return v +} + +// ToInt16 casts an interface to an int16 type. +func ToInt16(i interface{}) int16 { + v, _ := ToInt16E(i) + return v +} + +// ToInt8 casts an interface to an int8 type. +func ToInt8(i interface{}) int8 { + v, _ := ToInt8E(i) + return v +} + +// ToInt casts an interface to an int type. +func ToInt(i interface{}) int { + v, _ := ToIntE(i) + return v +} + +// ToUint casts an interface to a uint type. +func ToUint(i interface{}) uint { + v, _ := ToUintE(i) + return v +} + +// ToUint64 casts an interface to a uint64 type. +func ToUint64(i interface{}) uint64 { + v, _ := ToUint64E(i) + return v +} + +// ToUint32 casts an interface to a uint32 type. +func ToUint32(i interface{}) uint32 { + v, _ := ToUint32E(i) + return v +} + +// ToUint16 casts an interface to a uint16 type. +func ToUint16(i interface{}) uint16 { + v, _ := ToUint16E(i) + return v +} + +// ToUint8 casts an interface to a uint8 type. +func ToUint8(i interface{}) uint8 { + v, _ := ToUint8E(i) + return v +} + +// ToString casts an interface to a string type. +func ToString(i interface{}) string { + v, _ := ToStringE(i) + return v +} + +// ToStringMapString casts an interface to a map[string]string type. +func ToStringMapString(i interface{}) map[string]string { + v, _ := ToStringMapStringE(i) + return v +} + +// ToStringMapStringSlice casts an interface to a map[string][]string type. +func ToStringMapStringSlice(i interface{}) map[string][]string { + v, _ := ToStringMapStringSliceE(i) + return v +} + +// ToStringMapBool casts an interface to a map[string]bool type. +func ToStringMapBool(i interface{}) map[string]bool { + v, _ := ToStringMapBoolE(i) + return v +} + +// ToStringMapInt casts an interface to a map[string]int type. +func ToStringMapInt(i interface{}) map[string]int { + v, _ := ToStringMapIntE(i) + return v +} + +// ToStringMapInt64 casts an interface to a map[string]int64 type. +func ToStringMapInt64(i interface{}) map[string]int64 { + v, _ := ToStringMapInt64E(i) + return v +} + +// ToStringMap casts an interface to a map[string]interface{} type. +func ToStringMap(i interface{}) map[string]interface{} { + v, _ := ToStringMapE(i) + return v +} + +// ToSlice casts an interface to a []interface{} type. +func ToSlice(i interface{}) []interface{} { + v, _ := ToSliceE(i) + return v +} + +// ToBoolSlice casts an interface to a []bool type. +func ToBoolSlice(i interface{}) []bool { + v, _ := ToBoolSliceE(i) + return v +} + +// ToStringSlice casts an interface to a []string type. +func ToStringSlice(i interface{}) []string { + v, _ := ToStringSliceE(i) + return v +} + +// ToIntSlice casts an interface to a []int type. +func ToIntSlice(i interface{}) []int { + v, _ := ToIntSliceE(i) + return v +} + +// ToDurationSlice casts an interface to a []time.Duration type. +func ToDurationSlice(i interface{}) []time.Duration { + v, _ := ToDurationSliceE(i) + return v +} diff --git a/vendor/github.com/spf13/cast/caste.go b/vendor/github.com/spf13/cast/caste.go new file mode 100644 index 0000000..514d759 --- /dev/null +++ b/vendor/github.com/spf13/cast/caste.go @@ -0,0 +1,1476 @@ +// Copyright © 2014 Steve Francia . +// +// Use of this source code is governed by an MIT-style +// license that can be found in the LICENSE file. + +package cast + +import ( + "encoding/json" + "errors" + "fmt" + "html/template" + "reflect" + "strconv" + "strings" + "time" +) + +var errNegativeNotAllowed = errors.New("unable to cast negative value") + +// ToTimeE casts an interface to a time.Time type. +func ToTimeE(i interface{}) (tim time.Time, err error) { + return ToTimeInDefaultLocationE(i, time.UTC) +} + +// ToTimeInDefaultLocationE casts an empty interface to time.Time, +// interpreting inputs without a timezone to be in the given location, +// or the local timezone if nil. +func ToTimeInDefaultLocationE(i interface{}, location *time.Location) (tim time.Time, err error) { + i = indirect(i) + + switch v := i.(type) { + case time.Time: + return v, nil + case string: + return StringToDateInDefaultLocation(v, location) + case json.Number: + s, err1 := ToInt64E(v) + if err1 != nil { + return time.Time{}, fmt.Errorf("unable to cast %#v of type %T to Time", i, i) + } + return time.Unix(s, 0), nil + case int: + return time.Unix(int64(v), 0), nil + case int64: + return time.Unix(v, 0), nil + case int32: + return time.Unix(int64(v), 0), nil + case uint: + return time.Unix(int64(v), 0), nil + case uint64: + return time.Unix(int64(v), 0), nil + case uint32: + return time.Unix(int64(v), 0), nil + default: + return time.Time{}, fmt.Errorf("unable to cast %#v of type %T to Time", i, i) + } +} + +// ToDurationE casts an interface to a time.Duration type. +func ToDurationE(i interface{}) (d time.Duration, err error) { + i = indirect(i) + + switch s := i.(type) { + case time.Duration: + return s, nil + case int, int64, int32, int16, int8, uint, uint64, uint32, uint16, uint8: + d = time.Duration(ToInt64(s)) + return + case float32, float64: + d = time.Duration(ToFloat64(s)) + return + case string: + if strings.ContainsAny(s, "nsuµmh") { + d, err = time.ParseDuration(s) + } else { + d, err = time.ParseDuration(s + "ns") + } + return + case json.Number: + var v float64 + v, err = s.Float64() + d = time.Duration(v) + return + default: + err = fmt.Errorf("unable to cast %#v of type %T to Duration", i, i) + return + } +} + +// ToBoolE casts an interface to a bool type. +func ToBoolE(i interface{}) (bool, error) { + i = indirect(i) + + switch b := i.(type) { + case bool: + return b, nil + case nil: + return false, nil + case int: + if i.(int) != 0 { + return true, nil + } + return false, nil + case string: + return strconv.ParseBool(i.(string)) + case json.Number: + v, err := ToInt64E(b) + if err == nil { + return v != 0, nil + } + return false, fmt.Errorf("unable to cast %#v of type %T to bool", i, i) + default: + return false, fmt.Errorf("unable to cast %#v of type %T to bool", i, i) + } +} + +// ToFloat64E casts an interface to a float64 type. +func ToFloat64E(i interface{}) (float64, error) { + i = indirect(i) + + intv, ok := toInt(i) + if ok { + return float64(intv), nil + } + + switch s := i.(type) { + case float64: + return s, nil + case float32: + return float64(s), nil + case int64: + return float64(s), nil + case int32: + return float64(s), nil + case int16: + return float64(s), nil + case int8: + return float64(s), nil + case uint: + return float64(s), nil + case uint64: + return float64(s), nil + case uint32: + return float64(s), nil + case uint16: + return float64(s), nil + case uint8: + return float64(s), nil + case string: + v, err := strconv.ParseFloat(s, 64) + if err == nil { + return v, nil + } + return 0, fmt.Errorf("unable to cast %#v of type %T to float64", i, i) + case json.Number: + v, err := s.Float64() + if err == nil { + return v, nil + } + return 0, fmt.Errorf("unable to cast %#v of type %T to float64", i, i) + case bool: + if s { + return 1, nil + } + return 0, nil + case nil: + return 0, nil + default: + return 0, fmt.Errorf("unable to cast %#v of type %T to float64", i, i) + } +} + +// ToFloat32E casts an interface to a float32 type. +func ToFloat32E(i interface{}) (float32, error) { + i = indirect(i) + + intv, ok := toInt(i) + if ok { + return float32(intv), nil + } + + switch s := i.(type) { + case float64: + return float32(s), nil + case float32: + return s, nil + case int64: + return float32(s), nil + case int32: + return float32(s), nil + case int16: + return float32(s), nil + case int8: + return float32(s), nil + case uint: + return float32(s), nil + case uint64: + return float32(s), nil + case uint32: + return float32(s), nil + case uint16: + return float32(s), nil + case uint8: + return float32(s), nil + case string: + v, err := strconv.ParseFloat(s, 32) + if err == nil { + return float32(v), nil + } + return 0, fmt.Errorf("unable to cast %#v of type %T to float32", i, i) + case json.Number: + v, err := s.Float64() + if err == nil { + return float32(v), nil + } + return 0, fmt.Errorf("unable to cast %#v of type %T to float32", i, i) + case bool: + if s { + return 1, nil + } + return 0, nil + case nil: + return 0, nil + default: + return 0, fmt.Errorf("unable to cast %#v of type %T to float32", i, i) + } +} + +// ToInt64E casts an interface to an int64 type. +func ToInt64E(i interface{}) (int64, error) { + i = indirect(i) + + intv, ok := toInt(i) + if ok { + return int64(intv), nil + } + + switch s := i.(type) { + case int64: + return s, nil + case int32: + return int64(s), nil + case int16: + return int64(s), nil + case int8: + return int64(s), nil + case uint: + return int64(s), nil + case uint64: + return int64(s), nil + case uint32: + return int64(s), nil + case uint16: + return int64(s), nil + case uint8: + return int64(s), nil + case float64: + return int64(s), nil + case float32: + return int64(s), nil + case string: + v, err := strconv.ParseInt(trimZeroDecimal(s), 0, 0) + if err == nil { + return v, nil + } + return 0, fmt.Errorf("unable to cast %#v of type %T to int64", i, i) + case json.Number: + return ToInt64E(string(s)) + case bool: + if s { + return 1, nil + } + return 0, nil + case nil: + return 0, nil + default: + return 0, fmt.Errorf("unable to cast %#v of type %T to int64", i, i) + } +} + +// ToInt32E casts an interface to an int32 type. +func ToInt32E(i interface{}) (int32, error) { + i = indirect(i) + + intv, ok := toInt(i) + if ok { + return int32(intv), nil + } + + switch s := i.(type) { + case int64: + return int32(s), nil + case int32: + return s, nil + case int16: + return int32(s), nil + case int8: + return int32(s), nil + case uint: + return int32(s), nil + case uint64: + return int32(s), nil + case uint32: + return int32(s), nil + case uint16: + return int32(s), nil + case uint8: + return int32(s), nil + case float64: + return int32(s), nil + case float32: + return int32(s), nil + case string: + v, err := strconv.ParseInt(trimZeroDecimal(s), 0, 0) + if err == nil { + return int32(v), nil + } + return 0, fmt.Errorf("unable to cast %#v of type %T to int32", i, i) + case json.Number: + return ToInt32E(string(s)) + case bool: + if s { + return 1, nil + } + return 0, nil + case nil: + return 0, nil + default: + return 0, fmt.Errorf("unable to cast %#v of type %T to int32", i, i) + } +} + +// ToInt16E casts an interface to an int16 type. +func ToInt16E(i interface{}) (int16, error) { + i = indirect(i) + + intv, ok := toInt(i) + if ok { + return int16(intv), nil + } + + switch s := i.(type) { + case int64: + return int16(s), nil + case int32: + return int16(s), nil + case int16: + return s, nil + case int8: + return int16(s), nil + case uint: + return int16(s), nil + case uint64: + return int16(s), nil + case uint32: + return int16(s), nil + case uint16: + return int16(s), nil + case uint8: + return int16(s), nil + case float64: + return int16(s), nil + case float32: + return int16(s), nil + case string: + v, err := strconv.ParseInt(trimZeroDecimal(s), 0, 0) + if err == nil { + return int16(v), nil + } + return 0, fmt.Errorf("unable to cast %#v of type %T to int16", i, i) + case json.Number: + return ToInt16E(string(s)) + case bool: + if s { + return 1, nil + } + return 0, nil + case nil: + return 0, nil + default: + return 0, fmt.Errorf("unable to cast %#v of type %T to int16", i, i) + } +} + +// ToInt8E casts an interface to an int8 type. +func ToInt8E(i interface{}) (int8, error) { + i = indirect(i) + + intv, ok := toInt(i) + if ok { + return int8(intv), nil + } + + switch s := i.(type) { + case int64: + return int8(s), nil + case int32: + return int8(s), nil + case int16: + return int8(s), nil + case int8: + return s, nil + case uint: + return int8(s), nil + case uint64: + return int8(s), nil + case uint32: + return int8(s), nil + case uint16: + return int8(s), nil + case uint8: + return int8(s), nil + case float64: + return int8(s), nil + case float32: + return int8(s), nil + case string: + v, err := strconv.ParseInt(trimZeroDecimal(s), 0, 0) + if err == nil { + return int8(v), nil + } + return 0, fmt.Errorf("unable to cast %#v of type %T to int8", i, i) + case json.Number: + return ToInt8E(string(s)) + case bool: + if s { + return 1, nil + } + return 0, nil + case nil: + return 0, nil + default: + return 0, fmt.Errorf("unable to cast %#v of type %T to int8", i, i) + } +} + +// ToIntE casts an interface to an int type. +func ToIntE(i interface{}) (int, error) { + i = indirect(i) + + intv, ok := toInt(i) + if ok { + return intv, nil + } + + switch s := i.(type) { + case int64: + return int(s), nil + case int32: + return int(s), nil + case int16: + return int(s), nil + case int8: + return int(s), nil + case uint: + return int(s), nil + case uint64: + return int(s), nil + case uint32: + return int(s), nil + case uint16: + return int(s), nil + case uint8: + return int(s), nil + case float64: + return int(s), nil + case float32: + return int(s), nil + case string: + v, err := strconv.ParseInt(trimZeroDecimal(s), 0, 0) + if err == nil { + return int(v), nil + } + return 0, fmt.Errorf("unable to cast %#v of type %T to int64", i, i) + case json.Number: + return ToIntE(string(s)) + case bool: + if s { + return 1, nil + } + return 0, nil + case nil: + return 0, nil + default: + return 0, fmt.Errorf("unable to cast %#v of type %T to int", i, i) + } +} + +// ToUintE casts an interface to a uint type. +func ToUintE(i interface{}) (uint, error) { + i = indirect(i) + + intv, ok := toInt(i) + if ok { + if intv < 0 { + return 0, errNegativeNotAllowed + } + return uint(intv), nil + } + + switch s := i.(type) { + case string: + v, err := strconv.ParseInt(trimZeroDecimal(s), 0, 0) + if err == nil { + if v < 0 { + return 0, errNegativeNotAllowed + } + return uint(v), nil + } + return 0, fmt.Errorf("unable to cast %#v of type %T to uint", i, i) + case json.Number: + return ToUintE(string(s)) + case int64: + if s < 0 { + return 0, errNegativeNotAllowed + } + return uint(s), nil + case int32: + if s < 0 { + return 0, errNegativeNotAllowed + } + return uint(s), nil + case int16: + if s < 0 { + return 0, errNegativeNotAllowed + } + return uint(s), nil + case int8: + if s < 0 { + return 0, errNegativeNotAllowed + } + return uint(s), nil + case uint: + return s, nil + case uint64: + return uint(s), nil + case uint32: + return uint(s), nil + case uint16: + return uint(s), nil + case uint8: + return uint(s), nil + case float64: + if s < 0 { + return 0, errNegativeNotAllowed + } + return uint(s), nil + case float32: + if s < 0 { + return 0, errNegativeNotAllowed + } + return uint(s), nil + case bool: + if s { + return 1, nil + } + return 0, nil + case nil: + return 0, nil + default: + return 0, fmt.Errorf("unable to cast %#v of type %T to uint", i, i) + } +} + +// ToUint64E casts an interface to a uint64 type. +func ToUint64E(i interface{}) (uint64, error) { + i = indirect(i) + + intv, ok := toInt(i) + if ok { + if intv < 0 { + return 0, errNegativeNotAllowed + } + return uint64(intv), nil + } + + switch s := i.(type) { + case string: + v, err := strconv.ParseInt(trimZeroDecimal(s), 0, 0) + if err == nil { + if v < 0 { + return 0, errNegativeNotAllowed + } + return uint64(v), nil + } + return 0, fmt.Errorf("unable to cast %#v of type %T to uint64", i, i) + case json.Number: + return ToUint64E(string(s)) + case int64: + if s < 0 { + return 0, errNegativeNotAllowed + } + return uint64(s), nil + case int32: + if s < 0 { + return 0, errNegativeNotAllowed + } + return uint64(s), nil + case int16: + if s < 0 { + return 0, errNegativeNotAllowed + } + return uint64(s), nil + case int8: + if s < 0 { + return 0, errNegativeNotAllowed + } + return uint64(s), nil + case uint: + return uint64(s), nil + case uint64: + return s, nil + case uint32: + return uint64(s), nil + case uint16: + return uint64(s), nil + case uint8: + return uint64(s), nil + case float32: + if s < 0 { + return 0, errNegativeNotAllowed + } + return uint64(s), nil + case float64: + if s < 0 { + return 0, errNegativeNotAllowed + } + return uint64(s), nil + case bool: + if s { + return 1, nil + } + return 0, nil + case nil: + return 0, nil + default: + return 0, fmt.Errorf("unable to cast %#v of type %T to uint64", i, i) + } +} + +// ToUint32E casts an interface to a uint32 type. +func ToUint32E(i interface{}) (uint32, error) { + i = indirect(i) + + intv, ok := toInt(i) + if ok { + if intv < 0 { + return 0, errNegativeNotAllowed + } + return uint32(intv), nil + } + + switch s := i.(type) { + case string: + v, err := strconv.ParseInt(trimZeroDecimal(s), 0, 0) + if err == nil { + if v < 0 { + return 0, errNegativeNotAllowed + } + return uint32(v), nil + } + return 0, fmt.Errorf("unable to cast %#v of type %T to uint32", i, i) + case json.Number: + return ToUint32E(string(s)) + case int64: + if s < 0 { + return 0, errNegativeNotAllowed + } + return uint32(s), nil + case int32: + if s < 0 { + return 0, errNegativeNotAllowed + } + return uint32(s), nil + case int16: + if s < 0 { + return 0, errNegativeNotAllowed + } + return uint32(s), nil + case int8: + if s < 0 { + return 0, errNegativeNotAllowed + } + return uint32(s), nil + case uint: + return uint32(s), nil + case uint64: + return uint32(s), nil + case uint32: + return s, nil + case uint16: + return uint32(s), nil + case uint8: + return uint32(s), nil + case float64: + if s < 0 { + return 0, errNegativeNotAllowed + } + return uint32(s), nil + case float32: + if s < 0 { + return 0, errNegativeNotAllowed + } + return uint32(s), nil + case bool: + if s { + return 1, nil + } + return 0, nil + case nil: + return 0, nil + default: + return 0, fmt.Errorf("unable to cast %#v of type %T to uint32", i, i) + } +} + +// ToUint16E casts an interface to a uint16 type. +func ToUint16E(i interface{}) (uint16, error) { + i = indirect(i) + + intv, ok := toInt(i) + if ok { + if intv < 0 { + return 0, errNegativeNotAllowed + } + return uint16(intv), nil + } + + switch s := i.(type) { + case string: + v, err := strconv.ParseInt(trimZeroDecimal(s), 0, 0) + if err == nil { + if v < 0 { + return 0, errNegativeNotAllowed + } + return uint16(v), nil + } + return 0, fmt.Errorf("unable to cast %#v of type %T to uint16", i, i) + case json.Number: + return ToUint16E(string(s)) + case int64: + if s < 0 { + return 0, errNegativeNotAllowed + } + return uint16(s), nil + case int32: + if s < 0 { + return 0, errNegativeNotAllowed + } + return uint16(s), nil + case int16: + if s < 0 { + return 0, errNegativeNotAllowed + } + return uint16(s), nil + case int8: + if s < 0 { + return 0, errNegativeNotAllowed + } + return uint16(s), nil + case uint: + return uint16(s), nil + case uint64: + return uint16(s), nil + case uint32: + return uint16(s), nil + case uint16: + return s, nil + case uint8: + return uint16(s), nil + case float64: + if s < 0 { + return 0, errNegativeNotAllowed + } + return uint16(s), nil + case float32: + if s < 0 { + return 0, errNegativeNotAllowed + } + return uint16(s), nil + case bool: + if s { + return 1, nil + } + return 0, nil + case nil: + return 0, nil + default: + return 0, fmt.Errorf("unable to cast %#v of type %T to uint16", i, i) + } +} + +// ToUint8E casts an interface to a uint type. +func ToUint8E(i interface{}) (uint8, error) { + i = indirect(i) + + intv, ok := toInt(i) + if ok { + if intv < 0 { + return 0, errNegativeNotAllowed + } + return uint8(intv), nil + } + + switch s := i.(type) { + case string: + v, err := strconv.ParseInt(trimZeroDecimal(s), 0, 0) + if err == nil { + if v < 0 { + return 0, errNegativeNotAllowed + } + return uint8(v), nil + } + return 0, fmt.Errorf("unable to cast %#v of type %T to uint8", i, i) + case json.Number: + return ToUint8E(string(s)) + case int64: + if s < 0 { + return 0, errNegativeNotAllowed + } + return uint8(s), nil + case int32: + if s < 0 { + return 0, errNegativeNotAllowed + } + return uint8(s), nil + case int16: + if s < 0 { + return 0, errNegativeNotAllowed + } + return uint8(s), nil + case int8: + if s < 0 { + return 0, errNegativeNotAllowed + } + return uint8(s), nil + case uint: + return uint8(s), nil + case uint64: + return uint8(s), nil + case uint32: + return uint8(s), nil + case uint16: + return uint8(s), nil + case uint8: + return s, nil + case float64: + if s < 0 { + return 0, errNegativeNotAllowed + } + return uint8(s), nil + case float32: + if s < 0 { + return 0, errNegativeNotAllowed + } + return uint8(s), nil + case bool: + if s { + return 1, nil + } + return 0, nil + case nil: + return 0, nil + default: + return 0, fmt.Errorf("unable to cast %#v of type %T to uint8", i, i) + } +} + +// From html/template/content.go +// Copyright 2011 The Go Authors. All rights reserved. +// indirect returns the value, after dereferencing as many times +// as necessary to reach the base type (or nil). +func indirect(a interface{}) interface{} { + if a == nil { + return nil + } + if t := reflect.TypeOf(a); t.Kind() != reflect.Ptr { + // Avoid creating a reflect.Value if it's not a pointer. + return a + } + v := reflect.ValueOf(a) + for v.Kind() == reflect.Ptr && !v.IsNil() { + v = v.Elem() + } + return v.Interface() +} + +// From html/template/content.go +// Copyright 2011 The Go Authors. All rights reserved. +// indirectToStringerOrError returns the value, after dereferencing as many times +// as necessary to reach the base type (or nil) or an implementation of fmt.Stringer +// or error, +func indirectToStringerOrError(a interface{}) interface{} { + if a == nil { + return nil + } + + var errorType = reflect.TypeOf((*error)(nil)).Elem() + var fmtStringerType = reflect.TypeOf((*fmt.Stringer)(nil)).Elem() + + v := reflect.ValueOf(a) + for !v.Type().Implements(fmtStringerType) && !v.Type().Implements(errorType) && v.Kind() == reflect.Ptr && !v.IsNil() { + v = v.Elem() + } + return v.Interface() +} + +// ToStringE casts an interface to a string type. +func ToStringE(i interface{}) (string, error) { + i = indirectToStringerOrError(i) + + switch s := i.(type) { + case string: + return s, nil + case bool: + return strconv.FormatBool(s), nil + case float64: + return strconv.FormatFloat(s, 'f', -1, 64), nil + case float32: + return strconv.FormatFloat(float64(s), 'f', -1, 32), nil + case int: + return strconv.Itoa(s), nil + case int64: + return strconv.FormatInt(s, 10), nil + case int32: + return strconv.Itoa(int(s)), nil + case int16: + return strconv.FormatInt(int64(s), 10), nil + case int8: + return strconv.FormatInt(int64(s), 10), nil + case uint: + return strconv.FormatUint(uint64(s), 10), nil + case uint64: + return strconv.FormatUint(uint64(s), 10), nil + case uint32: + return strconv.FormatUint(uint64(s), 10), nil + case uint16: + return strconv.FormatUint(uint64(s), 10), nil + case uint8: + return strconv.FormatUint(uint64(s), 10), nil + case json.Number: + return s.String(), nil + case []byte: + return string(s), nil + case template.HTML: + return string(s), nil + case template.URL: + return string(s), nil + case template.JS: + return string(s), nil + case template.CSS: + return string(s), nil + case template.HTMLAttr: + return string(s), nil + case nil: + return "", nil + case fmt.Stringer: + return s.String(), nil + case error: + return s.Error(), nil + default: + return "", fmt.Errorf("unable to cast %#v of type %T to string", i, i) + } +} + +// ToStringMapStringE casts an interface to a map[string]string type. +func ToStringMapStringE(i interface{}) (map[string]string, error) { + var m = map[string]string{} + + switch v := i.(type) { + case map[string]string: + return v, nil + case map[string]interface{}: + for k, val := range v { + m[ToString(k)] = ToString(val) + } + return m, nil + case map[interface{}]string: + for k, val := range v { + m[ToString(k)] = ToString(val) + } + return m, nil + case map[interface{}]interface{}: + for k, val := range v { + m[ToString(k)] = ToString(val) + } + return m, nil + case string: + err := jsonStringToObject(v, &m) + return m, err + default: + return m, fmt.Errorf("unable to cast %#v of type %T to map[string]string", i, i) + } +} + +// ToStringMapStringSliceE casts an interface to a map[string][]string type. +func ToStringMapStringSliceE(i interface{}) (map[string][]string, error) { + var m = map[string][]string{} + + switch v := i.(type) { + case map[string][]string: + return v, nil + case map[string][]interface{}: + for k, val := range v { + m[ToString(k)] = ToStringSlice(val) + } + return m, nil + case map[string]string: + for k, val := range v { + m[ToString(k)] = []string{val} + } + case map[string]interface{}: + for k, val := range v { + switch vt := val.(type) { + case []interface{}: + m[ToString(k)] = ToStringSlice(vt) + case []string: + m[ToString(k)] = vt + default: + m[ToString(k)] = []string{ToString(val)} + } + } + return m, nil + case map[interface{}][]string: + for k, val := range v { + m[ToString(k)] = ToStringSlice(val) + } + return m, nil + case map[interface{}]string: + for k, val := range v { + m[ToString(k)] = ToStringSlice(val) + } + return m, nil + case map[interface{}][]interface{}: + for k, val := range v { + m[ToString(k)] = ToStringSlice(val) + } + return m, nil + case map[interface{}]interface{}: + for k, val := range v { + key, err := ToStringE(k) + if err != nil { + return m, fmt.Errorf("unable to cast %#v of type %T to map[string][]string", i, i) + } + value, err := ToStringSliceE(val) + if err != nil { + return m, fmt.Errorf("unable to cast %#v of type %T to map[string][]string", i, i) + } + m[key] = value + } + case string: + err := jsonStringToObject(v, &m) + return m, err + default: + return m, fmt.Errorf("unable to cast %#v of type %T to map[string][]string", i, i) + } + return m, nil +} + +// ToStringMapBoolE casts an interface to a map[string]bool type. +func ToStringMapBoolE(i interface{}) (map[string]bool, error) { + var m = map[string]bool{} + + switch v := i.(type) { + case map[interface{}]interface{}: + for k, val := range v { + m[ToString(k)] = ToBool(val) + } + return m, nil + case map[string]interface{}: + for k, val := range v { + m[ToString(k)] = ToBool(val) + } + return m, nil + case map[string]bool: + return v, nil + case string: + err := jsonStringToObject(v, &m) + return m, err + default: + return m, fmt.Errorf("unable to cast %#v of type %T to map[string]bool", i, i) + } +} + +// ToStringMapE casts an interface to a map[string]interface{} type. +func ToStringMapE(i interface{}) (map[string]interface{}, error) { + var m = map[string]interface{}{} + + switch v := i.(type) { + case map[interface{}]interface{}: + for k, val := range v { + m[ToString(k)] = val + } + return m, nil + case map[string]interface{}: + return v, nil + case string: + err := jsonStringToObject(v, &m) + return m, err + default: + return m, fmt.Errorf("unable to cast %#v of type %T to map[string]interface{}", i, i) + } +} + +// ToStringMapIntE casts an interface to a map[string]int{} type. +func ToStringMapIntE(i interface{}) (map[string]int, error) { + var m = map[string]int{} + if i == nil { + return m, fmt.Errorf("unable to cast %#v of type %T to map[string]int", i, i) + } + + switch v := i.(type) { + case map[interface{}]interface{}: + for k, val := range v { + m[ToString(k)] = ToInt(val) + } + return m, nil + case map[string]interface{}: + for k, val := range v { + m[k] = ToInt(val) + } + return m, nil + case map[string]int: + return v, nil + case string: + err := jsonStringToObject(v, &m) + return m, err + } + + if reflect.TypeOf(i).Kind() != reflect.Map { + return m, fmt.Errorf("unable to cast %#v of type %T to map[string]int", i, i) + } + + mVal := reflect.ValueOf(m) + v := reflect.ValueOf(i) + for _, keyVal := range v.MapKeys() { + val, err := ToIntE(v.MapIndex(keyVal).Interface()) + if err != nil { + return m, fmt.Errorf("unable to cast %#v of type %T to map[string]int", i, i) + } + mVal.SetMapIndex(keyVal, reflect.ValueOf(val)) + } + return m, nil +} + +// ToStringMapInt64E casts an interface to a map[string]int64{} type. +func ToStringMapInt64E(i interface{}) (map[string]int64, error) { + var m = map[string]int64{} + if i == nil { + return m, fmt.Errorf("unable to cast %#v of type %T to map[string]int64", i, i) + } + + switch v := i.(type) { + case map[interface{}]interface{}: + for k, val := range v { + m[ToString(k)] = ToInt64(val) + } + return m, nil + case map[string]interface{}: + for k, val := range v { + m[k] = ToInt64(val) + } + return m, nil + case map[string]int64: + return v, nil + case string: + err := jsonStringToObject(v, &m) + return m, err + } + + if reflect.TypeOf(i).Kind() != reflect.Map { + return m, fmt.Errorf("unable to cast %#v of type %T to map[string]int64", i, i) + } + mVal := reflect.ValueOf(m) + v := reflect.ValueOf(i) + for _, keyVal := range v.MapKeys() { + val, err := ToInt64E(v.MapIndex(keyVal).Interface()) + if err != nil { + return m, fmt.Errorf("unable to cast %#v of type %T to map[string]int64", i, i) + } + mVal.SetMapIndex(keyVal, reflect.ValueOf(val)) + } + return m, nil +} + +// ToSliceE casts an interface to a []interface{} type. +func ToSliceE(i interface{}) ([]interface{}, error) { + var s []interface{} + + switch v := i.(type) { + case []interface{}: + return append(s, v...), nil + case []map[string]interface{}: + for _, u := range v { + s = append(s, u) + } + return s, nil + default: + return s, fmt.Errorf("unable to cast %#v of type %T to []interface{}", i, i) + } +} + +// ToBoolSliceE casts an interface to a []bool type. +func ToBoolSliceE(i interface{}) ([]bool, error) { + if i == nil { + return []bool{}, fmt.Errorf("unable to cast %#v of type %T to []bool", i, i) + } + + switch v := i.(type) { + case []bool: + return v, nil + } + + kind := reflect.TypeOf(i).Kind() + switch kind { + case reflect.Slice, reflect.Array: + s := reflect.ValueOf(i) + a := make([]bool, s.Len()) + for j := 0; j < s.Len(); j++ { + val, err := ToBoolE(s.Index(j).Interface()) + if err != nil { + return []bool{}, fmt.Errorf("unable to cast %#v of type %T to []bool", i, i) + } + a[j] = val + } + return a, nil + default: + return []bool{}, fmt.Errorf("unable to cast %#v of type %T to []bool", i, i) + } +} + +// ToStringSliceE casts an interface to a []string type. +func ToStringSliceE(i interface{}) ([]string, error) { + var a []string + + switch v := i.(type) { + case []interface{}: + for _, u := range v { + a = append(a, ToString(u)) + } + return a, nil + case []string: + return v, nil + case []int8: + for _, u := range v { + a = append(a, ToString(u)) + } + return a, nil + case []int: + for _, u := range v { + a = append(a, ToString(u)) + } + return a, nil + case []int32: + for _, u := range v { + a = append(a, ToString(u)) + } + return a, nil + case []int64: + for _, u := range v { + a = append(a, ToString(u)) + } + return a, nil + case []float32: + for _, u := range v { + a = append(a, ToString(u)) + } + return a, nil + case []float64: + for _, u := range v { + a = append(a, ToString(u)) + } + return a, nil + case string: + return strings.Fields(v), nil + case []error: + for _, err := range i.([]error) { + a = append(a, err.Error()) + } + return a, nil + case interface{}: + str, err := ToStringE(v) + if err != nil { + return a, fmt.Errorf("unable to cast %#v of type %T to []string", i, i) + } + return []string{str}, nil + default: + return a, fmt.Errorf("unable to cast %#v of type %T to []string", i, i) + } +} + +// ToIntSliceE casts an interface to a []int type. +func ToIntSliceE(i interface{}) ([]int, error) { + if i == nil { + return []int{}, fmt.Errorf("unable to cast %#v of type %T to []int", i, i) + } + + switch v := i.(type) { + case []int: + return v, nil + } + + kind := reflect.TypeOf(i).Kind() + switch kind { + case reflect.Slice, reflect.Array: + s := reflect.ValueOf(i) + a := make([]int, s.Len()) + for j := 0; j < s.Len(); j++ { + val, err := ToIntE(s.Index(j).Interface()) + if err != nil { + return []int{}, fmt.Errorf("unable to cast %#v of type %T to []int", i, i) + } + a[j] = val + } + return a, nil + default: + return []int{}, fmt.Errorf("unable to cast %#v of type %T to []int", i, i) + } +} + +// ToDurationSliceE casts an interface to a []time.Duration type. +func ToDurationSliceE(i interface{}) ([]time.Duration, error) { + if i == nil { + return []time.Duration{}, fmt.Errorf("unable to cast %#v of type %T to []time.Duration", i, i) + } + + switch v := i.(type) { + case []time.Duration: + return v, nil + } + + kind := reflect.TypeOf(i).Kind() + switch kind { + case reflect.Slice, reflect.Array: + s := reflect.ValueOf(i) + a := make([]time.Duration, s.Len()) + for j := 0; j < s.Len(); j++ { + val, err := ToDurationE(s.Index(j).Interface()) + if err != nil { + return []time.Duration{}, fmt.Errorf("unable to cast %#v of type %T to []time.Duration", i, i) + } + a[j] = val + } + return a, nil + default: + return []time.Duration{}, fmt.Errorf("unable to cast %#v of type %T to []time.Duration", i, i) + } +} + +// StringToDate attempts to parse a string into a time.Time type using a +// predefined list of formats. If no suitable format is found, an error is +// returned. +func StringToDate(s string) (time.Time, error) { + return parseDateWith(s, time.UTC, timeFormats) +} + +// StringToDateInDefaultLocation casts an empty interface to a time.Time, +// interpreting inputs without a timezone to be in the given location, +// or the local timezone if nil. +func StringToDateInDefaultLocation(s string, location *time.Location) (time.Time, error) { + return parseDateWith(s, location, timeFormats) +} + +type timeFormatType int + +const ( + timeFormatNoTimezone timeFormatType = iota + timeFormatNamedTimezone + timeFormatNumericTimezone + timeFormatNumericAndNamedTimezone + timeFormatTimeOnly +) + +type timeFormat struct { + format string + typ timeFormatType +} + +func (f timeFormat) hasTimezone() bool { + // We don't include the formats with only named timezones, see + // https://github.com/golang/go/issues/19694#issuecomment-289103522 + return f.typ >= timeFormatNumericTimezone && f.typ <= timeFormatNumericAndNamedTimezone +} + +var ( + timeFormats = []timeFormat{ + {time.RFC3339, timeFormatNumericTimezone}, + {"2006-01-02T15:04:05", timeFormatNoTimezone}, // iso8601 without timezone + {time.RFC1123Z, timeFormatNumericTimezone}, + {time.RFC1123, timeFormatNamedTimezone}, + {time.RFC822Z, timeFormatNumericTimezone}, + {time.RFC822, timeFormatNamedTimezone}, + {time.RFC850, timeFormatNamedTimezone}, + {"2006-01-02 15:04:05.999999999 -0700 MST", timeFormatNumericAndNamedTimezone}, // Time.String() + {"2006-01-02T15:04:05-0700", timeFormatNumericTimezone}, // RFC3339 without timezone hh:mm colon + {"2006-01-02 15:04:05Z0700", timeFormatNumericTimezone}, // RFC3339 without T or timezone hh:mm colon + {"2006-01-02 15:04:05", timeFormatNoTimezone}, + {time.ANSIC, timeFormatNoTimezone}, + {time.UnixDate, timeFormatNamedTimezone}, + {time.RubyDate, timeFormatNumericTimezone}, + {"2006-01-02 15:04:05Z07:00", timeFormatNumericTimezone}, + {"2006-01-02", timeFormatNoTimezone}, + {"02 Jan 2006", timeFormatNoTimezone}, + {"2006-01-02 15:04:05 -07:00", timeFormatNumericTimezone}, + {"2006-01-02 15:04:05 -0700", timeFormatNumericTimezone}, + {time.Kitchen, timeFormatTimeOnly}, + {time.Stamp, timeFormatTimeOnly}, + {time.StampMilli, timeFormatTimeOnly}, + {time.StampMicro, timeFormatTimeOnly}, + {time.StampNano, timeFormatTimeOnly}, + } +) + +func parseDateWith(s string, location *time.Location, formats []timeFormat) (d time.Time, e error) { + + for _, format := range formats { + if d, e = time.Parse(format.format, s); e == nil { + + // Some time formats have a zone name, but no offset, so it gets + // put in that zone name (not the default one passed in to us), but + // without that zone's offset. So set the location manually. + if format.typ <= timeFormatNamedTimezone { + if location == nil { + location = time.Local + } + year, month, day := d.Date() + hour, min, sec := d.Clock() + d = time.Date(year, month, day, hour, min, sec, d.Nanosecond(), location) + } + + return + } + } + return d, fmt.Errorf("unable to parse date: %s", s) +} + +// jsonStringToObject attempts to unmarshall a string as JSON into +// the object passed as pointer. +func jsonStringToObject(s string, v interface{}) error { + data := []byte(s) + return json.Unmarshal(data, v) +} + +// toInt returns the int value of v if v or v's underlying type +// is an int. +// Note that this will return false for int64 etc. types. +func toInt(v interface{}) (int, bool) { + switch v := v.(type) { + case int: + return v, true + case time.Weekday: + return int(v), true + case time.Month: + return int(v), true + default: + return 0, false + } +} + +func trimZeroDecimal(s string) string { + var foundZero bool + for i := len(s); i > 0; i-- { + switch s[i-1] { + case '.': + if foundZero { + return s[:i-1] + } + case '0': + foundZero = true + default: + return s + } + } + return s +} diff --git a/vendor/github.com/spf13/cast/timeformattype_string.go b/vendor/github.com/spf13/cast/timeformattype_string.go new file mode 100644 index 0000000..1524fc8 --- /dev/null +++ b/vendor/github.com/spf13/cast/timeformattype_string.go @@ -0,0 +1,27 @@ +// Code generated by "stringer -type timeFormatType"; DO NOT EDIT. + +package cast + +import "strconv" + +func _() { + // An "invalid array index" compiler error signifies that the constant values have changed. + // Re-run the stringer command to generate them again. + var x [1]struct{} + _ = x[timeFormatNoTimezone-0] + _ = x[timeFormatNamedTimezone-1] + _ = x[timeFormatNumericTimezone-2] + _ = x[timeFormatNumericAndNamedTimezone-3] + _ = x[timeFormatTimeOnly-4] +} + +const _timeFormatType_name = "timeFormatNoTimezonetimeFormatNamedTimezonetimeFormatNumericTimezonetimeFormatNumericAndNamedTimezonetimeFormatTimeOnly" + +var _timeFormatType_index = [...]uint8{0, 20, 43, 68, 101, 119} + +func (i timeFormatType) String() string { + if i < 0 || i >= timeFormatType(len(_timeFormatType_index)-1) { + return "timeFormatType(" + strconv.FormatInt(int64(i), 10) + ")" + } + return _timeFormatType_name[_timeFormatType_index[i]:_timeFormatType_index[i+1]] +} diff --git a/vendor/golang.org/x/crypto/bcrypt/base64.go b/vendor/golang.org/x/crypto/bcrypt/base64.go new file mode 100644 index 0000000..fc31160 --- /dev/null +++ b/vendor/golang.org/x/crypto/bcrypt/base64.go @@ -0,0 +1,35 @@ +// Copyright 2011 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package bcrypt + +import "encoding/base64" + +const alphabet = "./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789" + +var bcEncoding = base64.NewEncoding(alphabet) + +func base64Encode(src []byte) []byte { + n := bcEncoding.EncodedLen(len(src)) + dst := make([]byte, n) + bcEncoding.Encode(dst, src) + for dst[n-1] == '=' { + n-- + } + return dst[:n] +} + +func base64Decode(src []byte) ([]byte, error) { + numOfEquals := 4 - (len(src) % 4) + for i := 0; i < numOfEquals; i++ { + src = append(src, '=') + } + + dst := make([]byte, bcEncoding.DecodedLen(len(src))) + n, err := bcEncoding.Decode(dst, src) + if err != nil { + return nil, err + } + return dst[:n], nil +} diff --git a/vendor/golang.org/x/crypto/bcrypt/bcrypt.go b/vendor/golang.org/x/crypto/bcrypt/bcrypt.go new file mode 100644 index 0000000..aeb73f8 --- /dev/null +++ b/vendor/golang.org/x/crypto/bcrypt/bcrypt.go @@ -0,0 +1,295 @@ +// Copyright 2011 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package bcrypt implements Provos and Mazières's bcrypt adaptive hashing +// algorithm. See http://www.usenix.org/event/usenix99/provos/provos.pdf +package bcrypt // import "golang.org/x/crypto/bcrypt" + +// The code is a port of Provos and Mazières's C implementation. +import ( + "crypto/rand" + "crypto/subtle" + "errors" + "fmt" + "io" + "strconv" + + "golang.org/x/crypto/blowfish" +) + +const ( + MinCost int = 4 // the minimum allowable cost as passed in to GenerateFromPassword + MaxCost int = 31 // the maximum allowable cost as passed in to GenerateFromPassword + DefaultCost int = 10 // the cost that will actually be set if a cost below MinCost is passed into GenerateFromPassword +) + +// The error returned from CompareHashAndPassword when a password and hash do +// not match. +var ErrMismatchedHashAndPassword = errors.New("crypto/bcrypt: hashedPassword is not the hash of the given password") + +// The error returned from CompareHashAndPassword when a hash is too short to +// be a bcrypt hash. +var ErrHashTooShort = errors.New("crypto/bcrypt: hashedSecret too short to be a bcrypted password") + +// The error returned from CompareHashAndPassword when a hash was created with +// a bcrypt algorithm newer than this implementation. +type HashVersionTooNewError byte + +func (hv HashVersionTooNewError) Error() string { + return fmt.Sprintf("crypto/bcrypt: bcrypt algorithm version '%c' requested is newer than current version '%c'", byte(hv), majorVersion) +} + +// The error returned from CompareHashAndPassword when a hash starts with something other than '$' +type InvalidHashPrefixError byte + +func (ih InvalidHashPrefixError) Error() string { + return fmt.Sprintf("crypto/bcrypt: bcrypt hashes must start with '$', but hashedSecret started with '%c'", byte(ih)) +} + +type InvalidCostError int + +func (ic InvalidCostError) Error() string { + return fmt.Sprintf("crypto/bcrypt: cost %d is outside allowed range (%d,%d)", int(ic), int(MinCost), int(MaxCost)) +} + +const ( + majorVersion = '2' + minorVersion = 'a' + maxSaltSize = 16 + maxCryptedHashSize = 23 + encodedSaltSize = 22 + encodedHashSize = 31 + minHashSize = 59 +) + +// magicCipherData is an IV for the 64 Blowfish encryption calls in +// bcrypt(). It's the string "OrpheanBeholderScryDoubt" in big-endian bytes. +var magicCipherData = []byte{ + 0x4f, 0x72, 0x70, 0x68, + 0x65, 0x61, 0x6e, 0x42, + 0x65, 0x68, 0x6f, 0x6c, + 0x64, 0x65, 0x72, 0x53, + 0x63, 0x72, 0x79, 0x44, + 0x6f, 0x75, 0x62, 0x74, +} + +type hashed struct { + hash []byte + salt []byte + cost int // allowed range is MinCost to MaxCost + major byte + minor byte +} + +// GenerateFromPassword returns the bcrypt hash of the password at the given +// cost. If the cost given is less than MinCost, the cost will be set to +// DefaultCost, instead. Use CompareHashAndPassword, as defined in this package, +// to compare the returned hashed password with its cleartext version. +func GenerateFromPassword(password []byte, cost int) ([]byte, error) { + p, err := newFromPassword(password, cost) + if err != nil { + return nil, err + } + return p.Hash(), nil +} + +// CompareHashAndPassword compares a bcrypt hashed password with its possible +// plaintext equivalent. Returns nil on success, or an error on failure. +func CompareHashAndPassword(hashedPassword, password []byte) error { + p, err := newFromHash(hashedPassword) + if err != nil { + return err + } + + otherHash, err := bcrypt(password, p.cost, p.salt) + if err != nil { + return err + } + + otherP := &hashed{otherHash, p.salt, p.cost, p.major, p.minor} + if subtle.ConstantTimeCompare(p.Hash(), otherP.Hash()) == 1 { + return nil + } + + return ErrMismatchedHashAndPassword +} + +// Cost returns the hashing cost used to create the given hashed +// password. When, in the future, the hashing cost of a password system needs +// to be increased in order to adjust for greater computational power, this +// function allows one to establish which passwords need to be updated. +func Cost(hashedPassword []byte) (int, error) { + p, err := newFromHash(hashedPassword) + if err != nil { + return 0, err + } + return p.cost, nil +} + +func newFromPassword(password []byte, cost int) (*hashed, error) { + if cost < MinCost { + cost = DefaultCost + } + p := new(hashed) + p.major = majorVersion + p.minor = minorVersion + + err := checkCost(cost) + if err != nil { + return nil, err + } + p.cost = cost + + unencodedSalt := make([]byte, maxSaltSize) + _, err = io.ReadFull(rand.Reader, unencodedSalt) + if err != nil { + return nil, err + } + + p.salt = base64Encode(unencodedSalt) + hash, err := bcrypt(password, p.cost, p.salt) + if err != nil { + return nil, err + } + p.hash = hash + return p, err +} + +func newFromHash(hashedSecret []byte) (*hashed, error) { + if len(hashedSecret) < minHashSize { + return nil, ErrHashTooShort + } + p := new(hashed) + n, err := p.decodeVersion(hashedSecret) + if err != nil { + return nil, err + } + hashedSecret = hashedSecret[n:] + n, err = p.decodeCost(hashedSecret) + if err != nil { + return nil, err + } + hashedSecret = hashedSecret[n:] + + // The "+2" is here because we'll have to append at most 2 '=' to the salt + // when base64 decoding it in expensiveBlowfishSetup(). + p.salt = make([]byte, encodedSaltSize, encodedSaltSize+2) + copy(p.salt, hashedSecret[:encodedSaltSize]) + + hashedSecret = hashedSecret[encodedSaltSize:] + p.hash = make([]byte, len(hashedSecret)) + copy(p.hash, hashedSecret) + + return p, nil +} + +func bcrypt(password []byte, cost int, salt []byte) ([]byte, error) { + cipherData := make([]byte, len(magicCipherData)) + copy(cipherData, magicCipherData) + + c, err := expensiveBlowfishSetup(password, uint32(cost), salt) + if err != nil { + return nil, err + } + + for i := 0; i < 24; i += 8 { + for j := 0; j < 64; j++ { + c.Encrypt(cipherData[i:i+8], cipherData[i:i+8]) + } + } + + // Bug compatibility with C bcrypt implementations. We only encode 23 of + // the 24 bytes encrypted. + hsh := base64Encode(cipherData[:maxCryptedHashSize]) + return hsh, nil +} + +func expensiveBlowfishSetup(key []byte, cost uint32, salt []byte) (*blowfish.Cipher, error) { + csalt, err := base64Decode(salt) + if err != nil { + return nil, err + } + + // Bug compatibility with C bcrypt implementations. They use the trailing + // NULL in the key string during expansion. + // We copy the key to prevent changing the underlying array. + ckey := append(key[:len(key):len(key)], 0) + + c, err := blowfish.NewSaltedCipher(ckey, csalt) + if err != nil { + return nil, err + } + + var i, rounds uint64 + rounds = 1 << cost + for i = 0; i < rounds; i++ { + blowfish.ExpandKey(ckey, c) + blowfish.ExpandKey(csalt, c) + } + + return c, nil +} + +func (p *hashed) Hash() []byte { + arr := make([]byte, 60) + arr[0] = '$' + arr[1] = p.major + n := 2 + if p.minor != 0 { + arr[2] = p.minor + n = 3 + } + arr[n] = '$' + n++ + copy(arr[n:], []byte(fmt.Sprintf("%02d", p.cost))) + n += 2 + arr[n] = '$' + n++ + copy(arr[n:], p.salt) + n += encodedSaltSize + copy(arr[n:], p.hash) + n += encodedHashSize + return arr[:n] +} + +func (p *hashed) decodeVersion(sbytes []byte) (int, error) { + if sbytes[0] != '$' { + return -1, InvalidHashPrefixError(sbytes[0]) + } + if sbytes[1] > majorVersion { + return -1, HashVersionTooNewError(sbytes[1]) + } + p.major = sbytes[1] + n := 3 + if sbytes[2] != '$' { + p.minor = sbytes[2] + n++ + } + return n, nil +} + +// sbytes should begin where decodeVersion left off. +func (p *hashed) decodeCost(sbytes []byte) (int, error) { + cost, err := strconv.Atoi(string(sbytes[0:2])) + if err != nil { + return -1, err + } + err = checkCost(cost) + if err != nil { + return -1, err + } + p.cost = cost + return 3, nil +} + +func (p *hashed) String() string { + return fmt.Sprintf("&{hash: %#v, salt: %#v, cost: %d, major: %c, minor: %c}", string(p.hash), p.salt, p.cost, p.major, p.minor) +} + +func checkCost(cost int) error { + if cost < MinCost || cost > MaxCost { + return InvalidCostError(cost) + } + return nil +} diff --git a/vendor/golang.org/x/crypto/blowfish/block.go b/vendor/golang.org/x/crypto/blowfish/block.go new file mode 100644 index 0000000..9d80f19 --- /dev/null +++ b/vendor/golang.org/x/crypto/blowfish/block.go @@ -0,0 +1,159 @@ +// Copyright 2010 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package blowfish + +// getNextWord returns the next big-endian uint32 value from the byte slice +// at the given position in a circular manner, updating the position. +func getNextWord(b []byte, pos *int) uint32 { + var w uint32 + j := *pos + for i := 0; i < 4; i++ { + w = w<<8 | uint32(b[j]) + j++ + if j >= len(b) { + j = 0 + } + } + *pos = j + return w +} + +// ExpandKey performs a key expansion on the given *Cipher. Specifically, it +// performs the Blowfish algorithm's key schedule which sets up the *Cipher's +// pi and substitution tables for calls to Encrypt. This is used, primarily, +// by the bcrypt package to reuse the Blowfish key schedule during its +// set up. It's unlikely that you need to use this directly. +func ExpandKey(key []byte, c *Cipher) { + j := 0 + for i := 0; i < 18; i++ { + // Using inlined getNextWord for performance. + var d uint32 + for k := 0; k < 4; k++ { + d = d<<8 | uint32(key[j]) + j++ + if j >= len(key) { + j = 0 + } + } + c.p[i] ^= d + } + + var l, r uint32 + for i := 0; i < 18; i += 2 { + l, r = encryptBlock(l, r, c) + c.p[i], c.p[i+1] = l, r + } + + for i := 0; i < 256; i += 2 { + l, r = encryptBlock(l, r, c) + c.s0[i], c.s0[i+1] = l, r + } + for i := 0; i < 256; i += 2 { + l, r = encryptBlock(l, r, c) + c.s1[i], c.s1[i+1] = l, r + } + for i := 0; i < 256; i += 2 { + l, r = encryptBlock(l, r, c) + c.s2[i], c.s2[i+1] = l, r + } + for i := 0; i < 256; i += 2 { + l, r = encryptBlock(l, r, c) + c.s3[i], c.s3[i+1] = l, r + } +} + +// This is similar to ExpandKey, but folds the salt during the key +// schedule. While ExpandKey is essentially expandKeyWithSalt with an all-zero +// salt passed in, reusing ExpandKey turns out to be a place of inefficiency +// and specializing it here is useful. +func expandKeyWithSalt(key []byte, salt []byte, c *Cipher) { + j := 0 + for i := 0; i < 18; i++ { + c.p[i] ^= getNextWord(key, &j) + } + + j = 0 + var l, r uint32 + for i := 0; i < 18; i += 2 { + l ^= getNextWord(salt, &j) + r ^= getNextWord(salt, &j) + l, r = encryptBlock(l, r, c) + c.p[i], c.p[i+1] = l, r + } + + for i := 0; i < 256; i += 2 { + l ^= getNextWord(salt, &j) + r ^= getNextWord(salt, &j) + l, r = encryptBlock(l, r, c) + c.s0[i], c.s0[i+1] = l, r + } + + for i := 0; i < 256; i += 2 { + l ^= getNextWord(salt, &j) + r ^= getNextWord(salt, &j) + l, r = encryptBlock(l, r, c) + c.s1[i], c.s1[i+1] = l, r + } + + for i := 0; i < 256; i += 2 { + l ^= getNextWord(salt, &j) + r ^= getNextWord(salt, &j) + l, r = encryptBlock(l, r, c) + c.s2[i], c.s2[i+1] = l, r + } + + for i := 0; i < 256; i += 2 { + l ^= getNextWord(salt, &j) + r ^= getNextWord(salt, &j) + l, r = encryptBlock(l, r, c) + c.s3[i], c.s3[i+1] = l, r + } +} + +func encryptBlock(l, r uint32, c *Cipher) (uint32, uint32) { + xl, xr := l, r + xl ^= c.p[0] + xr ^= ((c.s0[byte(xl>>24)] + c.s1[byte(xl>>16)]) ^ c.s2[byte(xl>>8)]) + c.s3[byte(xl)] ^ c.p[1] + xl ^= ((c.s0[byte(xr>>24)] + c.s1[byte(xr>>16)]) ^ c.s2[byte(xr>>8)]) + c.s3[byte(xr)] ^ c.p[2] + xr ^= ((c.s0[byte(xl>>24)] + c.s1[byte(xl>>16)]) ^ c.s2[byte(xl>>8)]) + c.s3[byte(xl)] ^ c.p[3] + xl ^= ((c.s0[byte(xr>>24)] + c.s1[byte(xr>>16)]) ^ c.s2[byte(xr>>8)]) + c.s3[byte(xr)] ^ c.p[4] + xr ^= ((c.s0[byte(xl>>24)] + c.s1[byte(xl>>16)]) ^ c.s2[byte(xl>>8)]) + c.s3[byte(xl)] ^ c.p[5] + xl ^= ((c.s0[byte(xr>>24)] + c.s1[byte(xr>>16)]) ^ c.s2[byte(xr>>8)]) + c.s3[byte(xr)] ^ c.p[6] + xr ^= ((c.s0[byte(xl>>24)] + c.s1[byte(xl>>16)]) ^ c.s2[byte(xl>>8)]) + c.s3[byte(xl)] ^ c.p[7] + xl ^= ((c.s0[byte(xr>>24)] + c.s1[byte(xr>>16)]) ^ c.s2[byte(xr>>8)]) + c.s3[byte(xr)] ^ c.p[8] + xr ^= ((c.s0[byte(xl>>24)] + c.s1[byte(xl>>16)]) ^ c.s2[byte(xl>>8)]) + c.s3[byte(xl)] ^ c.p[9] + xl ^= ((c.s0[byte(xr>>24)] + c.s1[byte(xr>>16)]) ^ c.s2[byte(xr>>8)]) + c.s3[byte(xr)] ^ c.p[10] + xr ^= ((c.s0[byte(xl>>24)] + c.s1[byte(xl>>16)]) ^ c.s2[byte(xl>>8)]) + c.s3[byte(xl)] ^ c.p[11] + xl ^= ((c.s0[byte(xr>>24)] + c.s1[byte(xr>>16)]) ^ c.s2[byte(xr>>8)]) + c.s3[byte(xr)] ^ c.p[12] + xr ^= ((c.s0[byte(xl>>24)] + c.s1[byte(xl>>16)]) ^ c.s2[byte(xl>>8)]) + c.s3[byte(xl)] ^ c.p[13] + xl ^= ((c.s0[byte(xr>>24)] + c.s1[byte(xr>>16)]) ^ c.s2[byte(xr>>8)]) + c.s3[byte(xr)] ^ c.p[14] + xr ^= ((c.s0[byte(xl>>24)] + c.s1[byte(xl>>16)]) ^ c.s2[byte(xl>>8)]) + c.s3[byte(xl)] ^ c.p[15] + xl ^= ((c.s0[byte(xr>>24)] + c.s1[byte(xr>>16)]) ^ c.s2[byte(xr>>8)]) + c.s3[byte(xr)] ^ c.p[16] + xr ^= c.p[17] + return xr, xl +} + +func decryptBlock(l, r uint32, c *Cipher) (uint32, uint32) { + xl, xr := l, r + xl ^= c.p[17] + xr ^= ((c.s0[byte(xl>>24)] + c.s1[byte(xl>>16)]) ^ c.s2[byte(xl>>8)]) + c.s3[byte(xl)] ^ c.p[16] + xl ^= ((c.s0[byte(xr>>24)] + c.s1[byte(xr>>16)]) ^ c.s2[byte(xr>>8)]) + c.s3[byte(xr)] ^ c.p[15] + xr ^= ((c.s0[byte(xl>>24)] + c.s1[byte(xl>>16)]) ^ c.s2[byte(xl>>8)]) + c.s3[byte(xl)] ^ c.p[14] + xl ^= ((c.s0[byte(xr>>24)] + c.s1[byte(xr>>16)]) ^ c.s2[byte(xr>>8)]) + c.s3[byte(xr)] ^ c.p[13] + xr ^= ((c.s0[byte(xl>>24)] + c.s1[byte(xl>>16)]) ^ c.s2[byte(xl>>8)]) + c.s3[byte(xl)] ^ c.p[12] + xl ^= ((c.s0[byte(xr>>24)] + c.s1[byte(xr>>16)]) ^ c.s2[byte(xr>>8)]) + c.s3[byte(xr)] ^ c.p[11] + xr ^= ((c.s0[byte(xl>>24)] + c.s1[byte(xl>>16)]) ^ c.s2[byte(xl>>8)]) + c.s3[byte(xl)] ^ c.p[10] + xl ^= ((c.s0[byte(xr>>24)] + c.s1[byte(xr>>16)]) ^ c.s2[byte(xr>>8)]) + c.s3[byte(xr)] ^ c.p[9] + xr ^= ((c.s0[byte(xl>>24)] + c.s1[byte(xl>>16)]) ^ c.s2[byte(xl>>8)]) + c.s3[byte(xl)] ^ c.p[8] + xl ^= ((c.s0[byte(xr>>24)] + c.s1[byte(xr>>16)]) ^ c.s2[byte(xr>>8)]) + c.s3[byte(xr)] ^ c.p[7] + xr ^= ((c.s0[byte(xl>>24)] + c.s1[byte(xl>>16)]) ^ c.s2[byte(xl>>8)]) + c.s3[byte(xl)] ^ c.p[6] + xl ^= ((c.s0[byte(xr>>24)] + c.s1[byte(xr>>16)]) ^ c.s2[byte(xr>>8)]) + c.s3[byte(xr)] ^ c.p[5] + xr ^= ((c.s0[byte(xl>>24)] + c.s1[byte(xl>>16)]) ^ c.s2[byte(xl>>8)]) + c.s3[byte(xl)] ^ c.p[4] + xl ^= ((c.s0[byte(xr>>24)] + c.s1[byte(xr>>16)]) ^ c.s2[byte(xr>>8)]) + c.s3[byte(xr)] ^ c.p[3] + xr ^= ((c.s0[byte(xl>>24)] + c.s1[byte(xl>>16)]) ^ c.s2[byte(xl>>8)]) + c.s3[byte(xl)] ^ c.p[2] + xl ^= ((c.s0[byte(xr>>24)] + c.s1[byte(xr>>16)]) ^ c.s2[byte(xr>>8)]) + c.s3[byte(xr)] ^ c.p[1] + xr ^= c.p[0] + return xr, xl +} diff --git a/vendor/golang.org/x/crypto/blowfish/cipher.go b/vendor/golang.org/x/crypto/blowfish/cipher.go new file mode 100644 index 0000000..213bf20 --- /dev/null +++ b/vendor/golang.org/x/crypto/blowfish/cipher.go @@ -0,0 +1,99 @@ +// Copyright 2010 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package blowfish implements Bruce Schneier's Blowfish encryption algorithm. +// +// Blowfish is a legacy cipher and its short block size makes it vulnerable to +// birthday bound attacks (see https://sweet32.info). It should only be used +// where compatibility with legacy systems, not security, is the goal. +// +// Deprecated: any new system should use AES (from crypto/aes, if necessary in +// an AEAD mode like crypto/cipher.NewGCM) or XChaCha20-Poly1305 (from +// golang.org/x/crypto/chacha20poly1305). +package blowfish // import "golang.org/x/crypto/blowfish" + +// The code is a port of Bruce Schneier's C implementation. +// See https://www.schneier.com/blowfish.html. + +import "strconv" + +// The Blowfish block size in bytes. +const BlockSize = 8 + +// A Cipher is an instance of Blowfish encryption using a particular key. +type Cipher struct { + p [18]uint32 + s0, s1, s2, s3 [256]uint32 +} + +type KeySizeError int + +func (k KeySizeError) Error() string { + return "crypto/blowfish: invalid key size " + strconv.Itoa(int(k)) +} + +// NewCipher creates and returns a Cipher. +// The key argument should be the Blowfish key, from 1 to 56 bytes. +func NewCipher(key []byte) (*Cipher, error) { + var result Cipher + if k := len(key); k < 1 || k > 56 { + return nil, KeySizeError(k) + } + initCipher(&result) + ExpandKey(key, &result) + return &result, nil +} + +// NewSaltedCipher creates a returns a Cipher that folds a salt into its key +// schedule. For most purposes, NewCipher, instead of NewSaltedCipher, is +// sufficient and desirable. For bcrypt compatibility, the key can be over 56 +// bytes. +func NewSaltedCipher(key, salt []byte) (*Cipher, error) { + if len(salt) == 0 { + return NewCipher(key) + } + var result Cipher + if k := len(key); k < 1 { + return nil, KeySizeError(k) + } + initCipher(&result) + expandKeyWithSalt(key, salt, &result) + return &result, nil +} + +// BlockSize returns the Blowfish block size, 8 bytes. +// It is necessary to satisfy the Block interface in the +// package "crypto/cipher". +func (c *Cipher) BlockSize() int { return BlockSize } + +// Encrypt encrypts the 8-byte buffer src using the key k +// and stores the result in dst. +// Note that for amounts of data larger than a block, +// it is not safe to just call Encrypt on successive blocks; +// instead, use an encryption mode like CBC (see crypto/cipher/cbc.go). +func (c *Cipher) Encrypt(dst, src []byte) { + l := uint32(src[0])<<24 | uint32(src[1])<<16 | uint32(src[2])<<8 | uint32(src[3]) + r := uint32(src[4])<<24 | uint32(src[5])<<16 | uint32(src[6])<<8 | uint32(src[7]) + l, r = encryptBlock(l, r, c) + dst[0], dst[1], dst[2], dst[3] = byte(l>>24), byte(l>>16), byte(l>>8), byte(l) + dst[4], dst[5], dst[6], dst[7] = byte(r>>24), byte(r>>16), byte(r>>8), byte(r) +} + +// Decrypt decrypts the 8-byte buffer src using the key k +// and stores the result in dst. +func (c *Cipher) Decrypt(dst, src []byte) { + l := uint32(src[0])<<24 | uint32(src[1])<<16 | uint32(src[2])<<8 | uint32(src[3]) + r := uint32(src[4])<<24 | uint32(src[5])<<16 | uint32(src[6])<<8 | uint32(src[7]) + l, r = decryptBlock(l, r, c) + dst[0], dst[1], dst[2], dst[3] = byte(l>>24), byte(l>>16), byte(l>>8), byte(l) + dst[4], dst[5], dst[6], dst[7] = byte(r>>24), byte(r>>16), byte(r>>8), byte(r) +} + +func initCipher(c *Cipher) { + copy(c.p[0:], p[0:]) + copy(c.s0[0:], s0[0:]) + copy(c.s1[0:], s1[0:]) + copy(c.s2[0:], s2[0:]) + copy(c.s3[0:], s3[0:]) +} diff --git a/vendor/golang.org/x/crypto/blowfish/const.go b/vendor/golang.org/x/crypto/blowfish/const.go new file mode 100644 index 0000000..d040775 --- /dev/null +++ b/vendor/golang.org/x/crypto/blowfish/const.go @@ -0,0 +1,199 @@ +// Copyright 2010 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// The startup permutation array and substitution boxes. +// They are the hexadecimal digits of PI; see: +// https://www.schneier.com/code/constants.txt. + +package blowfish + +var s0 = [256]uint32{ + 0xd1310ba6, 0x98dfb5ac, 0x2ffd72db, 0xd01adfb7, 0xb8e1afed, 0x6a267e96, + 0xba7c9045, 0xf12c7f99, 0x24a19947, 0xb3916cf7, 0x0801f2e2, 0x858efc16, + 0x636920d8, 0x71574e69, 0xa458fea3, 0xf4933d7e, 0x0d95748f, 0x728eb658, + 0x718bcd58, 0x82154aee, 0x7b54a41d, 0xc25a59b5, 0x9c30d539, 0x2af26013, + 0xc5d1b023, 0x286085f0, 0xca417918, 0xb8db38ef, 0x8e79dcb0, 0x603a180e, + 0x6c9e0e8b, 0xb01e8a3e, 0xd71577c1, 0xbd314b27, 0x78af2fda, 0x55605c60, + 0xe65525f3, 0xaa55ab94, 0x57489862, 0x63e81440, 0x55ca396a, 0x2aab10b6, + 0xb4cc5c34, 0x1141e8ce, 0xa15486af, 0x7c72e993, 0xb3ee1411, 0x636fbc2a, + 0x2ba9c55d, 0x741831f6, 0xce5c3e16, 0x9b87931e, 0xafd6ba33, 0x6c24cf5c, + 0x7a325381, 0x28958677, 0x3b8f4898, 0x6b4bb9af, 0xc4bfe81b, 0x66282193, + 0x61d809cc, 0xfb21a991, 0x487cac60, 0x5dec8032, 0xef845d5d, 0xe98575b1, + 0xdc262302, 0xeb651b88, 0x23893e81, 0xd396acc5, 0x0f6d6ff3, 0x83f44239, + 0x2e0b4482, 0xa4842004, 0x69c8f04a, 0x9e1f9b5e, 0x21c66842, 0xf6e96c9a, + 0x670c9c61, 0xabd388f0, 0x6a51a0d2, 0xd8542f68, 0x960fa728, 0xab5133a3, + 0x6eef0b6c, 0x137a3be4, 0xba3bf050, 0x7efb2a98, 0xa1f1651d, 0x39af0176, + 0x66ca593e, 0x82430e88, 0x8cee8619, 0x456f9fb4, 0x7d84a5c3, 0x3b8b5ebe, + 0xe06f75d8, 0x85c12073, 0x401a449f, 0x56c16aa6, 0x4ed3aa62, 0x363f7706, + 0x1bfedf72, 0x429b023d, 0x37d0d724, 0xd00a1248, 0xdb0fead3, 0x49f1c09b, + 0x075372c9, 0x80991b7b, 0x25d479d8, 0xf6e8def7, 0xe3fe501a, 0xb6794c3b, + 0x976ce0bd, 0x04c006ba, 0xc1a94fb6, 0x409f60c4, 0x5e5c9ec2, 0x196a2463, + 0x68fb6faf, 0x3e6c53b5, 0x1339b2eb, 0x3b52ec6f, 0x6dfc511f, 0x9b30952c, + 0xcc814544, 0xaf5ebd09, 0xbee3d004, 0xde334afd, 0x660f2807, 0x192e4bb3, + 0xc0cba857, 0x45c8740f, 0xd20b5f39, 0xb9d3fbdb, 0x5579c0bd, 0x1a60320a, + 0xd6a100c6, 0x402c7279, 0x679f25fe, 0xfb1fa3cc, 0x8ea5e9f8, 0xdb3222f8, + 0x3c7516df, 0xfd616b15, 0x2f501ec8, 0xad0552ab, 0x323db5fa, 0xfd238760, + 0x53317b48, 0x3e00df82, 0x9e5c57bb, 0xca6f8ca0, 0x1a87562e, 0xdf1769db, + 0xd542a8f6, 0x287effc3, 0xac6732c6, 0x8c4f5573, 0x695b27b0, 0xbbca58c8, + 0xe1ffa35d, 0xb8f011a0, 0x10fa3d98, 0xfd2183b8, 0x4afcb56c, 0x2dd1d35b, + 0x9a53e479, 0xb6f84565, 0xd28e49bc, 0x4bfb9790, 0xe1ddf2da, 0xa4cb7e33, + 0x62fb1341, 0xcee4c6e8, 0xef20cada, 0x36774c01, 0xd07e9efe, 0x2bf11fb4, + 0x95dbda4d, 0xae909198, 0xeaad8e71, 0x6b93d5a0, 0xd08ed1d0, 0xafc725e0, + 0x8e3c5b2f, 0x8e7594b7, 0x8ff6e2fb, 0xf2122b64, 0x8888b812, 0x900df01c, + 0x4fad5ea0, 0x688fc31c, 0xd1cff191, 0xb3a8c1ad, 0x2f2f2218, 0xbe0e1777, + 0xea752dfe, 0x8b021fa1, 0xe5a0cc0f, 0xb56f74e8, 0x18acf3d6, 0xce89e299, + 0xb4a84fe0, 0xfd13e0b7, 0x7cc43b81, 0xd2ada8d9, 0x165fa266, 0x80957705, + 0x93cc7314, 0x211a1477, 0xe6ad2065, 0x77b5fa86, 0xc75442f5, 0xfb9d35cf, + 0xebcdaf0c, 0x7b3e89a0, 0xd6411bd3, 0xae1e7e49, 0x00250e2d, 0x2071b35e, + 0x226800bb, 0x57b8e0af, 0x2464369b, 0xf009b91e, 0x5563911d, 0x59dfa6aa, + 0x78c14389, 0xd95a537f, 0x207d5ba2, 0x02e5b9c5, 0x83260376, 0x6295cfa9, + 0x11c81968, 0x4e734a41, 0xb3472dca, 0x7b14a94a, 0x1b510052, 0x9a532915, + 0xd60f573f, 0xbc9bc6e4, 0x2b60a476, 0x81e67400, 0x08ba6fb5, 0x571be91f, + 0xf296ec6b, 0x2a0dd915, 0xb6636521, 0xe7b9f9b6, 0xff34052e, 0xc5855664, + 0x53b02d5d, 0xa99f8fa1, 0x08ba4799, 0x6e85076a, +} + +var s1 = [256]uint32{ + 0x4b7a70e9, 0xb5b32944, 0xdb75092e, 0xc4192623, 0xad6ea6b0, 0x49a7df7d, + 0x9cee60b8, 0x8fedb266, 0xecaa8c71, 0x699a17ff, 0x5664526c, 0xc2b19ee1, + 0x193602a5, 0x75094c29, 0xa0591340, 0xe4183a3e, 0x3f54989a, 0x5b429d65, + 0x6b8fe4d6, 0x99f73fd6, 0xa1d29c07, 0xefe830f5, 0x4d2d38e6, 0xf0255dc1, + 0x4cdd2086, 0x8470eb26, 0x6382e9c6, 0x021ecc5e, 0x09686b3f, 0x3ebaefc9, + 0x3c971814, 0x6b6a70a1, 0x687f3584, 0x52a0e286, 0xb79c5305, 0xaa500737, + 0x3e07841c, 0x7fdeae5c, 0x8e7d44ec, 0x5716f2b8, 0xb03ada37, 0xf0500c0d, + 0xf01c1f04, 0x0200b3ff, 0xae0cf51a, 0x3cb574b2, 0x25837a58, 0xdc0921bd, + 0xd19113f9, 0x7ca92ff6, 0x94324773, 0x22f54701, 0x3ae5e581, 0x37c2dadc, + 0xc8b57634, 0x9af3dda7, 0xa9446146, 0x0fd0030e, 0xecc8c73e, 0xa4751e41, + 0xe238cd99, 0x3bea0e2f, 0x3280bba1, 0x183eb331, 0x4e548b38, 0x4f6db908, + 0x6f420d03, 0xf60a04bf, 0x2cb81290, 0x24977c79, 0x5679b072, 0xbcaf89af, + 0xde9a771f, 0xd9930810, 0xb38bae12, 0xdccf3f2e, 0x5512721f, 0x2e6b7124, + 0x501adde6, 0x9f84cd87, 0x7a584718, 0x7408da17, 0xbc9f9abc, 0xe94b7d8c, + 0xec7aec3a, 0xdb851dfa, 0x63094366, 0xc464c3d2, 0xef1c1847, 0x3215d908, + 0xdd433b37, 0x24c2ba16, 0x12a14d43, 0x2a65c451, 0x50940002, 0x133ae4dd, + 0x71dff89e, 0x10314e55, 0x81ac77d6, 0x5f11199b, 0x043556f1, 0xd7a3c76b, + 0x3c11183b, 0x5924a509, 0xf28fe6ed, 0x97f1fbfa, 0x9ebabf2c, 0x1e153c6e, + 0x86e34570, 0xeae96fb1, 0x860e5e0a, 0x5a3e2ab3, 0x771fe71c, 0x4e3d06fa, + 0x2965dcb9, 0x99e71d0f, 0x803e89d6, 0x5266c825, 0x2e4cc978, 0x9c10b36a, + 0xc6150eba, 0x94e2ea78, 0xa5fc3c53, 0x1e0a2df4, 0xf2f74ea7, 0x361d2b3d, + 0x1939260f, 0x19c27960, 0x5223a708, 0xf71312b6, 0xebadfe6e, 0xeac31f66, + 0xe3bc4595, 0xa67bc883, 0xb17f37d1, 0x018cff28, 0xc332ddef, 0xbe6c5aa5, + 0x65582185, 0x68ab9802, 0xeecea50f, 0xdb2f953b, 0x2aef7dad, 0x5b6e2f84, + 0x1521b628, 0x29076170, 0xecdd4775, 0x619f1510, 0x13cca830, 0xeb61bd96, + 0x0334fe1e, 0xaa0363cf, 0xb5735c90, 0x4c70a239, 0xd59e9e0b, 0xcbaade14, + 0xeecc86bc, 0x60622ca7, 0x9cab5cab, 0xb2f3846e, 0x648b1eaf, 0x19bdf0ca, + 0xa02369b9, 0x655abb50, 0x40685a32, 0x3c2ab4b3, 0x319ee9d5, 0xc021b8f7, + 0x9b540b19, 0x875fa099, 0x95f7997e, 0x623d7da8, 0xf837889a, 0x97e32d77, + 0x11ed935f, 0x16681281, 0x0e358829, 0xc7e61fd6, 0x96dedfa1, 0x7858ba99, + 0x57f584a5, 0x1b227263, 0x9b83c3ff, 0x1ac24696, 0xcdb30aeb, 0x532e3054, + 0x8fd948e4, 0x6dbc3128, 0x58ebf2ef, 0x34c6ffea, 0xfe28ed61, 0xee7c3c73, + 0x5d4a14d9, 0xe864b7e3, 0x42105d14, 0x203e13e0, 0x45eee2b6, 0xa3aaabea, + 0xdb6c4f15, 0xfacb4fd0, 0xc742f442, 0xef6abbb5, 0x654f3b1d, 0x41cd2105, + 0xd81e799e, 0x86854dc7, 0xe44b476a, 0x3d816250, 0xcf62a1f2, 0x5b8d2646, + 0xfc8883a0, 0xc1c7b6a3, 0x7f1524c3, 0x69cb7492, 0x47848a0b, 0x5692b285, + 0x095bbf00, 0xad19489d, 0x1462b174, 0x23820e00, 0x58428d2a, 0x0c55f5ea, + 0x1dadf43e, 0x233f7061, 0x3372f092, 0x8d937e41, 0xd65fecf1, 0x6c223bdb, + 0x7cde3759, 0xcbee7460, 0x4085f2a7, 0xce77326e, 0xa6078084, 0x19f8509e, + 0xe8efd855, 0x61d99735, 0xa969a7aa, 0xc50c06c2, 0x5a04abfc, 0x800bcadc, + 0x9e447a2e, 0xc3453484, 0xfdd56705, 0x0e1e9ec9, 0xdb73dbd3, 0x105588cd, + 0x675fda79, 0xe3674340, 0xc5c43465, 0x713e38d8, 0x3d28f89e, 0xf16dff20, + 0x153e21e7, 0x8fb03d4a, 0xe6e39f2b, 0xdb83adf7, +} + +var s2 = [256]uint32{ + 0xe93d5a68, 0x948140f7, 0xf64c261c, 0x94692934, 0x411520f7, 0x7602d4f7, + 0xbcf46b2e, 0xd4a20068, 0xd4082471, 0x3320f46a, 0x43b7d4b7, 0x500061af, + 0x1e39f62e, 0x97244546, 0x14214f74, 0xbf8b8840, 0x4d95fc1d, 0x96b591af, + 0x70f4ddd3, 0x66a02f45, 0xbfbc09ec, 0x03bd9785, 0x7fac6dd0, 0x31cb8504, + 0x96eb27b3, 0x55fd3941, 0xda2547e6, 0xabca0a9a, 0x28507825, 0x530429f4, + 0x0a2c86da, 0xe9b66dfb, 0x68dc1462, 0xd7486900, 0x680ec0a4, 0x27a18dee, + 0x4f3ffea2, 0xe887ad8c, 0xb58ce006, 0x7af4d6b6, 0xaace1e7c, 0xd3375fec, + 0xce78a399, 0x406b2a42, 0x20fe9e35, 0xd9f385b9, 0xee39d7ab, 0x3b124e8b, + 0x1dc9faf7, 0x4b6d1856, 0x26a36631, 0xeae397b2, 0x3a6efa74, 0xdd5b4332, + 0x6841e7f7, 0xca7820fb, 0xfb0af54e, 0xd8feb397, 0x454056ac, 0xba489527, + 0x55533a3a, 0x20838d87, 0xfe6ba9b7, 0xd096954b, 0x55a867bc, 0xa1159a58, + 0xcca92963, 0x99e1db33, 0xa62a4a56, 0x3f3125f9, 0x5ef47e1c, 0x9029317c, + 0xfdf8e802, 0x04272f70, 0x80bb155c, 0x05282ce3, 0x95c11548, 0xe4c66d22, + 0x48c1133f, 0xc70f86dc, 0x07f9c9ee, 0x41041f0f, 0x404779a4, 0x5d886e17, + 0x325f51eb, 0xd59bc0d1, 0xf2bcc18f, 0x41113564, 0x257b7834, 0x602a9c60, + 0xdff8e8a3, 0x1f636c1b, 0x0e12b4c2, 0x02e1329e, 0xaf664fd1, 0xcad18115, + 0x6b2395e0, 0x333e92e1, 0x3b240b62, 0xeebeb922, 0x85b2a20e, 0xe6ba0d99, + 0xde720c8c, 0x2da2f728, 0xd0127845, 0x95b794fd, 0x647d0862, 0xe7ccf5f0, + 0x5449a36f, 0x877d48fa, 0xc39dfd27, 0xf33e8d1e, 0x0a476341, 0x992eff74, + 0x3a6f6eab, 0xf4f8fd37, 0xa812dc60, 0xa1ebddf8, 0x991be14c, 0xdb6e6b0d, + 0xc67b5510, 0x6d672c37, 0x2765d43b, 0xdcd0e804, 0xf1290dc7, 0xcc00ffa3, + 0xb5390f92, 0x690fed0b, 0x667b9ffb, 0xcedb7d9c, 0xa091cf0b, 0xd9155ea3, + 0xbb132f88, 0x515bad24, 0x7b9479bf, 0x763bd6eb, 0x37392eb3, 0xcc115979, + 0x8026e297, 0xf42e312d, 0x6842ada7, 0xc66a2b3b, 0x12754ccc, 0x782ef11c, + 0x6a124237, 0xb79251e7, 0x06a1bbe6, 0x4bfb6350, 0x1a6b1018, 0x11caedfa, + 0x3d25bdd8, 0xe2e1c3c9, 0x44421659, 0x0a121386, 0xd90cec6e, 0xd5abea2a, + 0x64af674e, 0xda86a85f, 0xbebfe988, 0x64e4c3fe, 0x9dbc8057, 0xf0f7c086, + 0x60787bf8, 0x6003604d, 0xd1fd8346, 0xf6381fb0, 0x7745ae04, 0xd736fccc, + 0x83426b33, 0xf01eab71, 0xb0804187, 0x3c005e5f, 0x77a057be, 0xbde8ae24, + 0x55464299, 0xbf582e61, 0x4e58f48f, 0xf2ddfda2, 0xf474ef38, 0x8789bdc2, + 0x5366f9c3, 0xc8b38e74, 0xb475f255, 0x46fcd9b9, 0x7aeb2661, 0x8b1ddf84, + 0x846a0e79, 0x915f95e2, 0x466e598e, 0x20b45770, 0x8cd55591, 0xc902de4c, + 0xb90bace1, 0xbb8205d0, 0x11a86248, 0x7574a99e, 0xb77f19b6, 0xe0a9dc09, + 0x662d09a1, 0xc4324633, 0xe85a1f02, 0x09f0be8c, 0x4a99a025, 0x1d6efe10, + 0x1ab93d1d, 0x0ba5a4df, 0xa186f20f, 0x2868f169, 0xdcb7da83, 0x573906fe, + 0xa1e2ce9b, 0x4fcd7f52, 0x50115e01, 0xa70683fa, 0xa002b5c4, 0x0de6d027, + 0x9af88c27, 0x773f8641, 0xc3604c06, 0x61a806b5, 0xf0177a28, 0xc0f586e0, + 0x006058aa, 0x30dc7d62, 0x11e69ed7, 0x2338ea63, 0x53c2dd94, 0xc2c21634, + 0xbbcbee56, 0x90bcb6de, 0xebfc7da1, 0xce591d76, 0x6f05e409, 0x4b7c0188, + 0x39720a3d, 0x7c927c24, 0x86e3725f, 0x724d9db9, 0x1ac15bb4, 0xd39eb8fc, + 0xed545578, 0x08fca5b5, 0xd83d7cd3, 0x4dad0fc4, 0x1e50ef5e, 0xb161e6f8, + 0xa28514d9, 0x6c51133c, 0x6fd5c7e7, 0x56e14ec4, 0x362abfce, 0xddc6c837, + 0xd79a3234, 0x92638212, 0x670efa8e, 0x406000e0, +} + +var s3 = [256]uint32{ + 0x3a39ce37, 0xd3faf5cf, 0xabc27737, 0x5ac52d1b, 0x5cb0679e, 0x4fa33742, + 0xd3822740, 0x99bc9bbe, 0xd5118e9d, 0xbf0f7315, 0xd62d1c7e, 0xc700c47b, + 0xb78c1b6b, 0x21a19045, 0xb26eb1be, 0x6a366eb4, 0x5748ab2f, 0xbc946e79, + 0xc6a376d2, 0x6549c2c8, 0x530ff8ee, 0x468dde7d, 0xd5730a1d, 0x4cd04dc6, + 0x2939bbdb, 0xa9ba4650, 0xac9526e8, 0xbe5ee304, 0xa1fad5f0, 0x6a2d519a, + 0x63ef8ce2, 0x9a86ee22, 0xc089c2b8, 0x43242ef6, 0xa51e03aa, 0x9cf2d0a4, + 0x83c061ba, 0x9be96a4d, 0x8fe51550, 0xba645bd6, 0x2826a2f9, 0xa73a3ae1, + 0x4ba99586, 0xef5562e9, 0xc72fefd3, 0xf752f7da, 0x3f046f69, 0x77fa0a59, + 0x80e4a915, 0x87b08601, 0x9b09e6ad, 0x3b3ee593, 0xe990fd5a, 0x9e34d797, + 0x2cf0b7d9, 0x022b8b51, 0x96d5ac3a, 0x017da67d, 0xd1cf3ed6, 0x7c7d2d28, + 0x1f9f25cf, 0xadf2b89b, 0x5ad6b472, 0x5a88f54c, 0xe029ac71, 0xe019a5e6, + 0x47b0acfd, 0xed93fa9b, 0xe8d3c48d, 0x283b57cc, 0xf8d56629, 0x79132e28, + 0x785f0191, 0xed756055, 0xf7960e44, 0xe3d35e8c, 0x15056dd4, 0x88f46dba, + 0x03a16125, 0x0564f0bd, 0xc3eb9e15, 0x3c9057a2, 0x97271aec, 0xa93a072a, + 0x1b3f6d9b, 0x1e6321f5, 0xf59c66fb, 0x26dcf319, 0x7533d928, 0xb155fdf5, + 0x03563482, 0x8aba3cbb, 0x28517711, 0xc20ad9f8, 0xabcc5167, 0xccad925f, + 0x4de81751, 0x3830dc8e, 0x379d5862, 0x9320f991, 0xea7a90c2, 0xfb3e7bce, + 0x5121ce64, 0x774fbe32, 0xa8b6e37e, 0xc3293d46, 0x48de5369, 0x6413e680, + 0xa2ae0810, 0xdd6db224, 0x69852dfd, 0x09072166, 0xb39a460a, 0x6445c0dd, + 0x586cdecf, 0x1c20c8ae, 0x5bbef7dd, 0x1b588d40, 0xccd2017f, 0x6bb4e3bb, + 0xdda26a7e, 0x3a59ff45, 0x3e350a44, 0xbcb4cdd5, 0x72eacea8, 0xfa6484bb, + 0x8d6612ae, 0xbf3c6f47, 0xd29be463, 0x542f5d9e, 0xaec2771b, 0xf64e6370, + 0x740e0d8d, 0xe75b1357, 0xf8721671, 0xaf537d5d, 0x4040cb08, 0x4eb4e2cc, + 0x34d2466a, 0x0115af84, 0xe1b00428, 0x95983a1d, 0x06b89fb4, 0xce6ea048, + 0x6f3f3b82, 0x3520ab82, 0x011a1d4b, 0x277227f8, 0x611560b1, 0xe7933fdc, + 0xbb3a792b, 0x344525bd, 0xa08839e1, 0x51ce794b, 0x2f32c9b7, 0xa01fbac9, + 0xe01cc87e, 0xbcc7d1f6, 0xcf0111c3, 0xa1e8aac7, 0x1a908749, 0xd44fbd9a, + 0xd0dadecb, 0xd50ada38, 0x0339c32a, 0xc6913667, 0x8df9317c, 0xe0b12b4f, + 0xf79e59b7, 0x43f5bb3a, 0xf2d519ff, 0x27d9459c, 0xbf97222c, 0x15e6fc2a, + 0x0f91fc71, 0x9b941525, 0xfae59361, 0xceb69ceb, 0xc2a86459, 0x12baa8d1, + 0xb6c1075e, 0xe3056a0c, 0x10d25065, 0xcb03a442, 0xe0ec6e0e, 0x1698db3b, + 0x4c98a0be, 0x3278e964, 0x9f1f9532, 0xe0d392df, 0xd3a0342b, 0x8971f21e, + 0x1b0a7441, 0x4ba3348c, 0xc5be7120, 0xc37632d8, 0xdf359f8d, 0x9b992f2e, + 0xe60b6f47, 0x0fe3f11d, 0xe54cda54, 0x1edad891, 0xce6279cf, 0xcd3e7e6f, + 0x1618b166, 0xfd2c1d05, 0x848fd2c5, 0xf6fb2299, 0xf523f357, 0xa6327623, + 0x93a83531, 0x56cccd02, 0xacf08162, 0x5a75ebb5, 0x6e163697, 0x88d273cc, + 0xde966292, 0x81b949d0, 0x4c50901b, 0x71c65614, 0xe6c6c7bd, 0x327a140a, + 0x45e1d006, 0xc3f27b9a, 0xc9aa53fd, 0x62a80f00, 0xbb25bfe2, 0x35bdd2f6, + 0x71126905, 0xb2040222, 0xb6cbcf7c, 0xcd769c2b, 0x53113ec0, 0x1640e3d3, + 0x38abbd60, 0x2547adf0, 0xba38209c, 0xf746ce76, 0x77afa1c5, 0x20756060, + 0x85cbfe4e, 0x8ae88dd8, 0x7aaaf9b0, 0x4cf9aa7e, 0x1948c25c, 0x02fb8a8c, + 0x01c36ae4, 0xd6ebe1f9, 0x90d4f869, 0xa65cdea0, 0x3f09252d, 0xc208e69f, + 0xb74e6132, 0xce77e25b, 0x578fdfe3, 0x3ac372e6, +} + +var p = [18]uint32{ + 0x243f6a88, 0x85a308d3, 0x13198a2e, 0x03707344, 0xa4093822, 0x299f31d0, + 0x082efa98, 0xec4e6c89, 0x452821e6, 0x38d01377, 0xbe5466cf, 0x34e90c6c, + 0xc0ac29b7, 0xc97c50dd, 0x3f84d5b5, 0xb5470917, 0x9216d5d9, 0x8979fb1b, +} diff --git a/vendor/golang.org/x/sys/unix/asm_linux_loong64.s b/vendor/golang.org/x/sys/unix/asm_linux_loong64.s index 6abd48e..5653572 100644 --- a/vendor/golang.org/x/sys/unix/asm_linux_loong64.s +++ b/vendor/golang.org/x/sys/unix/asm_linux_loong64.s @@ -30,7 +30,7 @@ TEXT ·SyscallNoError(SB),NOSPLIT,$0-48 MOVV trap+0(FP), R11 // syscall entry SYSCALL MOVV R4, r1+32(FP) - MOVV R5, r2+40(FP) + MOVV R0, r2+40(FP) // r2 is not used. Always set to 0 JAL runtime·exitsyscall(SB) RET @@ -50,5 +50,5 @@ TEXT ·RawSyscallNoError(SB),NOSPLIT,$0-48 MOVV trap+0(FP), R11 // syscall entry SYSCALL MOVV R4, r1+32(FP) - MOVV R5, r2+40(FP) + MOVV R0, r2+40(FP) // r2 is not used. Always set to 0 RET diff --git a/vendor/golang.org/x/sys/unix/ifreq_linux.go b/vendor/golang.org/x/sys/unix/ifreq_linux.go index 934af31..15721a5 100644 --- a/vendor/golang.org/x/sys/unix/ifreq_linux.go +++ b/vendor/golang.org/x/sys/unix/ifreq_linux.go @@ -8,7 +8,6 @@ package unix import ( - "bytes" "unsafe" ) @@ -45,13 +44,7 @@ func NewIfreq(name string) (*Ifreq, error) { // Name returns the interface name associated with the Ifreq. func (ifr *Ifreq) Name() string { - // BytePtrToString requires a NULL terminator or the program may crash. If - // one is not present, just return the empty string. - if !bytes.Contains(ifr.raw.Ifrn[:], []byte{0x00}) { - return "" - } - - return BytePtrToString(&ifr.raw.Ifrn[0]) + return ByteSliceToString(ifr.raw.Ifrn[:]) } // According to netdevice(7), only AF_INET addresses are returned for numerous diff --git a/vendor/golang.org/x/sys/unix/syscall_aix.go b/vendor/golang.org/x/sys/unix/syscall_aix.go index ad22c33..ac579c6 100644 --- a/vendor/golang.org/x/sys/unix/syscall_aix.go +++ b/vendor/golang.org/x/sys/unix/syscall_aix.go @@ -217,12 +217,12 @@ func Accept(fd int) (nfd int, sa Sockaddr, err error) { return } -func recvmsgRaw(fd int, p, oob []byte, flags int, rsa *RawSockaddrAny) (n, oobn int, recvflags int, err error) { +func recvmsgRaw(fd int, iov []Iovec, oob []byte, flags int, rsa *RawSockaddrAny) (n, oobn int, recvflags int, err error) { // Recvmsg not implemented on AIX return -1, -1, -1, ENOSYS } -func sendmsgN(fd int, p, oob []byte, ptr unsafe.Pointer, salen _Socklen, flags int) (n int, err error) { +func sendmsgN(fd int, iov []Iovec, oob []byte, ptr unsafe.Pointer, salen _Socklen, flags int) (n int, err error) { // SendmsgN not implemented on AIX return -1, ENOSYS } diff --git a/vendor/golang.org/x/sys/unix/syscall_bsd.go b/vendor/golang.org/x/sys/unix/syscall_bsd.go index 9c87c5f..c437fc5 100644 --- a/vendor/golang.org/x/sys/unix/syscall_bsd.go +++ b/vendor/golang.org/x/sys/unix/syscall_bsd.go @@ -325,27 +325,26 @@ func GetsockoptString(fd, level, opt int) (string, error) { //sys sendto(s int, buf []byte, flags int, to unsafe.Pointer, addrlen _Socklen) (err error) //sys recvmsg(s int, msg *Msghdr, flags int) (n int, err error) -func recvmsgRaw(fd int, p, oob []byte, flags int, rsa *RawSockaddrAny) (n, oobn int, recvflags int, err error) { +func recvmsgRaw(fd int, iov []Iovec, oob []byte, flags int, rsa *RawSockaddrAny) (n, oobn int, recvflags int, err error) { var msg Msghdr msg.Name = (*byte)(unsafe.Pointer(rsa)) msg.Namelen = uint32(SizeofSockaddrAny) - var iov Iovec - if len(p) > 0 { - iov.Base = (*byte)(unsafe.Pointer(&p[0])) - iov.SetLen(len(p)) - } var dummy byte if len(oob) > 0 { // receive at least one normal byte - if len(p) == 0 { - iov.Base = &dummy - iov.SetLen(1) + if emptyIovecs(iov) { + var iova [1]Iovec + iova[0].Base = &dummy + iova[0].SetLen(1) + iov = iova[:] } msg.Control = (*byte)(unsafe.Pointer(&oob[0])) msg.SetControllen(len(oob)) } - msg.Iov = &iov - msg.Iovlen = 1 + if len(iov) > 0 { + msg.Iov = &iov[0] + msg.SetIovlen(len(iov)) + } if n, err = recvmsg(fd, &msg, flags); err != nil { return } @@ -356,31 +355,32 @@ func recvmsgRaw(fd int, p, oob []byte, flags int, rsa *RawSockaddrAny) (n, oobn //sys sendmsg(s int, msg *Msghdr, flags int) (n int, err error) -func sendmsgN(fd int, p, oob []byte, ptr unsafe.Pointer, salen _Socklen, flags int) (n int, err error) { +func sendmsgN(fd int, iov []Iovec, oob []byte, ptr unsafe.Pointer, salen _Socklen, flags int) (n int, err error) { var msg Msghdr msg.Name = (*byte)(unsafe.Pointer(ptr)) msg.Namelen = uint32(salen) - var iov Iovec - if len(p) > 0 { - iov.Base = (*byte)(unsafe.Pointer(&p[0])) - iov.SetLen(len(p)) - } var dummy byte + var empty bool if len(oob) > 0 { // send at least one normal byte - if len(p) == 0 { - iov.Base = &dummy - iov.SetLen(1) + empty := emptyIovecs(iov) + if empty { + var iova [1]Iovec + iova[0].Base = &dummy + iova[0].SetLen(1) + iov = iova[:] } msg.Control = (*byte)(unsafe.Pointer(&oob[0])) msg.SetControllen(len(oob)) } - msg.Iov = &iov - msg.Iovlen = 1 + if len(iov) > 0 { + msg.Iov = &iov[0] + msg.SetIovlen(len(iov)) + } if n, err = sendmsg(fd, &msg, flags); err != nil { return 0, err } - if len(oob) > 0 && len(p) == 0 { + if len(oob) > 0 && empty { n = 0 } return n, nil diff --git a/vendor/golang.org/x/sys/unix/syscall_darwin.go b/vendor/golang.org/x/sys/unix/syscall_darwin.go index 09a25c6..4f87f16 100644 --- a/vendor/golang.org/x/sys/unix/syscall_darwin.go +++ b/vendor/golang.org/x/sys/unix/syscall_darwin.go @@ -393,6 +393,13 @@ func GetsockoptXucred(fd, level, opt int) (*Xucred, error) { return x, err } +func GetsockoptTCPConnectionInfo(fd, level, opt int) (*TCPConnectionInfo, error) { + var value TCPConnectionInfo + vallen := _Socklen(SizeofTCPConnectionInfo) + err := getsockopt(fd, level, opt, unsafe.Pointer(&value), &vallen) + return &value, err +} + func SysctlKinfoProc(name string, args ...int) (*KinfoProc, error) { mib, err := sysctlmib(name, args...) if err != nil { @@ -504,6 +511,7 @@ func SysctlKinfoProcSlice(name string, args ...int) ([]KinfoProc, error) { //sys Mkdirat(dirfd int, path string, mode uint32) (err error) //sys Mkfifo(path string, mode uint32) (err error) //sys Mknod(path string, mode uint32, dev int) (err error) +//sys Mount(fsType string, dir string, flags int, data unsafe.Pointer) (err error) //sys Open(path string, mode int, perm uint32) (fd int, err error) //sys Openat(dirfd int, path string, mode int, perm uint32) (fd int, err error) //sys Pathconf(path string, name int) (val int, err error) @@ -572,7 +580,6 @@ func SysctlKinfoProcSlice(name string, args ...int) ([]KinfoProc, error) { // Nfssvc // Getfh // Quotactl -// Mount // Csops // Waitid // Add_profil diff --git a/vendor/golang.org/x/sys/unix/syscall_illumos.go b/vendor/golang.org/x/sys/unix/syscall_illumos.go index 8d5f294..e48244a 100644 --- a/vendor/golang.org/x/sys/unix/syscall_illumos.go +++ b/vendor/golang.org/x/sys/unix/syscall_illumos.go @@ -20,10 +20,9 @@ func bytes2iovec(bs [][]byte) []Iovec { for i, b := range bs { iovecs[i].SetLen(len(b)) if len(b) > 0 { - // somehow Iovec.Base on illumos is (*int8), not (*byte) - iovecs[i].Base = (*int8)(unsafe.Pointer(&b[0])) + iovecs[i].Base = &b[0] } else { - iovecs[i].Base = (*int8)(unsafe.Pointer(&_zero)) + iovecs[i].Base = (*byte)(unsafe.Pointer(&_zero)) } } return iovecs diff --git a/vendor/golang.org/x/sys/unix/syscall_linux.go b/vendor/golang.org/x/sys/unix/syscall_linux.go index c8d2032..5e4a94f 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux.go @@ -1499,18 +1499,13 @@ func KeyctlRestrictKeyring(ringid int, keyType string, restriction string) error //sys keyctlRestrictKeyringByType(cmd int, arg2 int, keyType string, restriction string) (err error) = SYS_KEYCTL //sys keyctlRestrictKeyring(cmd int, arg2 int) (err error) = SYS_KEYCTL -func recvmsgRaw(fd int, p, oob []byte, flags int, rsa *RawSockaddrAny) (n, oobn int, recvflags int, err error) { +func recvmsgRaw(fd int, iov []Iovec, oob []byte, flags int, rsa *RawSockaddrAny) (n, oobn int, recvflags int, err error) { var msg Msghdr msg.Name = (*byte)(unsafe.Pointer(rsa)) msg.Namelen = uint32(SizeofSockaddrAny) - var iov Iovec - if len(p) > 0 { - iov.Base = &p[0] - iov.SetLen(len(p)) - } var dummy byte if len(oob) > 0 { - if len(p) == 0 { + if emptyIovecs(iov) { var sockType int sockType, err = GetsockoptInt(fd, SOL_SOCKET, SO_TYPE) if err != nil { @@ -1518,15 +1513,19 @@ func recvmsgRaw(fd int, p, oob []byte, flags int, rsa *RawSockaddrAny) (n, oobn } // receive at least one normal byte if sockType != SOCK_DGRAM { - iov.Base = &dummy - iov.SetLen(1) + var iova [1]Iovec + iova[0].Base = &dummy + iova[0].SetLen(1) + iov = iova[:] } } msg.Control = &oob[0] msg.SetControllen(len(oob)) } - msg.Iov = &iov - msg.Iovlen = 1 + if len(iov) > 0 { + msg.Iov = &iov[0] + msg.SetIovlen(len(iov)) + } if n, err = recvmsg(fd, &msg, flags); err != nil { return } @@ -1535,18 +1534,15 @@ func recvmsgRaw(fd int, p, oob []byte, flags int, rsa *RawSockaddrAny) (n, oobn return } -func sendmsgN(fd int, p, oob []byte, ptr unsafe.Pointer, salen _Socklen, flags int) (n int, err error) { +func sendmsgN(fd int, iov []Iovec, oob []byte, ptr unsafe.Pointer, salen _Socklen, flags int) (n int, err error) { var msg Msghdr msg.Name = (*byte)(ptr) msg.Namelen = uint32(salen) - var iov Iovec - if len(p) > 0 { - iov.Base = &p[0] - iov.SetLen(len(p)) - } var dummy byte + var empty bool if len(oob) > 0 { - if len(p) == 0 { + empty := emptyIovecs(iov) + if empty { var sockType int sockType, err = GetsockoptInt(fd, SOL_SOCKET, SO_TYPE) if err != nil { @@ -1554,19 +1550,22 @@ func sendmsgN(fd int, p, oob []byte, ptr unsafe.Pointer, salen _Socklen, flags i } // send at least one normal byte if sockType != SOCK_DGRAM { - iov.Base = &dummy - iov.SetLen(1) + var iova [1]Iovec + iova[0].Base = &dummy + iova[0].SetLen(1) } } msg.Control = &oob[0] msg.SetControllen(len(oob)) } - msg.Iov = &iov - msg.Iovlen = 1 + if len(iov) > 0 { + msg.Iov = &iov[0] + msg.SetIovlen(len(iov)) + } if n, err = sendmsg(fd, &msg, flags); err != nil { return 0, err } - if len(oob) > 0 && len(p) == 0 { + if len(oob) > 0 && empty { n = 0 } return n, nil diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go b/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go index 28ba7b8..0b69c3e 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go @@ -12,8 +12,6 @@ import "unsafe" //sys EpollWait(epfd int, events []EpollEvent, msec int) (n int, err error) = SYS_EPOLL_PWAIT //sys Fadvise(fd int, offset int64, length int64, advice int) (err error) = SYS_FADVISE64 //sys Fchown(fd int, uid int, gid int) (err error) -//sys Fstat(fd int, stat *Stat_t) (err error) -//sys Fstatat(fd int, path string, stat *Stat_t, flags int) (err error) //sys Fstatfs(fd int, buf *Statfs_t) (err error) //sys Ftruncate(fd int, length int64) (err error) //sysnb Getegid() (egid int) @@ -43,6 +41,43 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err //sys Shutdown(fd int, how int) (err error) //sys Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) +func timespecFromStatxTimestamp(x StatxTimestamp) Timespec { + return Timespec{ + Sec: x.Sec, + Nsec: int64(x.Nsec), + } +} + +func Fstatat(fd int, path string, stat *Stat_t, flags int) error { + var r Statx_t + // Do it the glibc way, add AT_NO_AUTOMOUNT. + if err := Statx(fd, path, AT_NO_AUTOMOUNT|flags, STATX_BASIC_STATS, &r); err != nil { + return err + } + + stat.Dev = Mkdev(r.Dev_major, r.Dev_minor) + stat.Ino = r.Ino + stat.Mode = uint32(r.Mode) + stat.Nlink = r.Nlink + stat.Uid = r.Uid + stat.Gid = r.Gid + stat.Rdev = Mkdev(r.Rdev_major, r.Rdev_minor) + // hope we don't get to process files so large to overflow these size + // fields... + stat.Size = int64(r.Size) + stat.Blksize = int32(r.Blksize) + stat.Blocks = int64(r.Blocks) + stat.Atim = timespecFromStatxTimestamp(r.Atime) + stat.Mtim = timespecFromStatxTimestamp(r.Mtime) + stat.Ctim = timespecFromStatxTimestamp(r.Ctime) + + return nil +} + +func Fstat(fd int, stat *Stat_t) (err error) { + return Fstatat(fd, "", stat, AT_EMPTY_PATH) +} + func Stat(path string, stat *Stat_t) (err error) { return Fstatat(AT_FDCWD, path, stat, 0) } diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go b/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go index 8ff7adb..925a748 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go @@ -22,6 +22,7 @@ import "unsafe" //sysnb Getrlimit(resource int, rlim *Rlimit) (err error) //sysnb Getuid() (uid int) //sys Listen(s int, n int) (err error) +//sys MemfdSecret(flags int) (fd int, err error) //sys pread(fd int, p []byte, offset int64) (n int, err error) = SYS_PREAD64 //sys pwrite(fd int, p []byte, offset int64) (n int, err error) = SYS_PWRITE64 //sys Seek(fd int, offset int64, whence int) (off int64, err error) = SYS_LSEEK diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd_mips64.go b/vendor/golang.org/x/sys/unix/syscall_openbsd_mips64.go index 30f2853..1378489 100644 --- a/vendor/golang.org/x/sys/unix/syscall_openbsd_mips64.go +++ b/vendor/golang.org/x/sys/unix/syscall_openbsd_mips64.go @@ -26,6 +26,10 @@ func (msghdr *Msghdr) SetControllen(length int) { msghdr.Controllen = uint32(length) } +func (msghdr *Msghdr) SetIovlen(length int) { + msghdr.Iovlen = uint32(length) +} + func (cmsg *Cmsghdr) SetLen(length int) { cmsg.Len = uint32(length) } diff --git a/vendor/golang.org/x/sys/unix/syscall_solaris.go b/vendor/golang.org/x/sys/unix/syscall_solaris.go index 5c2003c..b5ec457 100644 --- a/vendor/golang.org/x/sys/unix/syscall_solaris.go +++ b/vendor/golang.org/x/sys/unix/syscall_solaris.go @@ -451,26 +451,25 @@ func Accept(fd int) (nfd int, sa Sockaddr, err error) { //sys recvmsg(s int, msg *Msghdr, flags int) (n int, err error) = libsocket.__xnet_recvmsg -func recvmsgRaw(fd int, p, oob []byte, flags int, rsa *RawSockaddrAny) (n, oobn int, recvflags int, err error) { +func recvmsgRaw(fd int, iov []Iovec, oob []byte, flags int, rsa *RawSockaddrAny) (n, oobn int, recvflags int, err error) { var msg Msghdr msg.Name = (*byte)(unsafe.Pointer(rsa)) msg.Namelen = uint32(SizeofSockaddrAny) - var iov Iovec - if len(p) > 0 { - iov.Base = (*int8)(unsafe.Pointer(&p[0])) - iov.SetLen(len(p)) - } - var dummy int8 + var dummy byte if len(oob) > 0 { // receive at least one normal byte - if len(p) == 0 { - iov.Base = &dummy - iov.SetLen(1) + if emptyIovecs(iov) { + var iova [1]Iovec + iova[0].Base = &dummy + iova[0].SetLen(1) + iov = iova[:] } msg.Accrightslen = int32(len(oob)) } - msg.Iov = &iov - msg.Iovlen = 1 + if len(iov) > 0 { + msg.Iov = &iov[0] + msg.SetIovlen(len(iov)) + } if n, err = recvmsg(fd, &msg, flags); n == -1 { return } @@ -480,30 +479,31 @@ func recvmsgRaw(fd int, p, oob []byte, flags int, rsa *RawSockaddrAny) (n, oobn //sys sendmsg(s int, msg *Msghdr, flags int) (n int, err error) = libsocket.__xnet_sendmsg -func sendmsgN(fd int, p, oob []byte, ptr unsafe.Pointer, salen _Socklen, flags int) (n int, err error) { +func sendmsgN(fd int, iov []Iovec, oob []byte, ptr unsafe.Pointer, salen _Socklen, flags int) (n int, err error) { var msg Msghdr msg.Name = (*byte)(unsafe.Pointer(ptr)) msg.Namelen = uint32(salen) - var iov Iovec - if len(p) > 0 { - iov.Base = (*int8)(unsafe.Pointer(&p[0])) - iov.SetLen(len(p)) - } - var dummy int8 + var dummy byte + var empty bool if len(oob) > 0 { // send at least one normal byte - if len(p) == 0 { - iov.Base = &dummy - iov.SetLen(1) + empty = emptyIovecs(iov) + if empty { + var iova [1]Iovec + iova[0].Base = &dummy + iova[0].SetLen(1) + iov = iova[:] } msg.Accrightslen = int32(len(oob)) } - msg.Iov = &iov - msg.Iovlen = 1 + if len(iov) > 0 { + msg.Iov = &iov[0] + msg.SetIovlen(len(iov)) + } if n, err = sendmsg(fd, &msg, flags); err != nil { return 0, err } - if len(oob) > 0 && len(p) == 0 { + if len(oob) > 0 && empty { n = 0 } return n, nil @@ -618,6 +618,7 @@ func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err e //sys Getpriority(which int, who int) (n int, err error) //sysnb Getrlimit(which int, lim *Rlimit) (err error) //sysnb Getrusage(who int, rusage *Rusage) (err error) +//sysnb Getsid(pid int) (sid int, err error) //sysnb Gettimeofday(tv *Timeval) (err error) //sysnb Getuid() (uid int) //sys Kill(pid int, signum syscall.Signal) (err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_unix.go b/vendor/golang.org/x/sys/unix/syscall_unix.go index 70508af..1ff5060 100644 --- a/vendor/golang.org/x/sys/unix/syscall_unix.go +++ b/vendor/golang.org/x/sys/unix/syscall_unix.go @@ -338,8 +338,13 @@ func Recvfrom(fd int, p []byte, flags int) (n int, from Sockaddr, err error) { } func Recvmsg(fd int, p, oob []byte, flags int) (n, oobn int, recvflags int, from Sockaddr, err error) { + var iov [1]Iovec + if len(p) > 0 { + iov[0].Base = &p[0] + iov[0].SetLen(len(p)) + } var rsa RawSockaddrAny - n, oobn, recvflags, err = recvmsgRaw(fd, p, oob, flags, &rsa) + n, oobn, recvflags, err = recvmsgRaw(fd, iov[:], oob, flags, &rsa) // source address is only specified if the socket is unconnected if rsa.Addr.Family != AF_UNSPEC { from, err = anyToSockaddr(fd, &rsa) @@ -347,12 +352,67 @@ func Recvmsg(fd int, p, oob []byte, flags int) (n, oobn int, recvflags int, from return } +// RecvmsgBuffers receives a message from a socket using the recvmsg +// system call. The flags are passed to recvmsg. Any non-control data +// read is scattered into the buffers slices. The results are: +// - n is the number of non-control data read into bufs +// - oobn is the number of control data read into oob; this may be interpreted using [ParseSocketControlMessage] +// - recvflags is flags returned by recvmsg +// - from is the address of the sender +func RecvmsgBuffers(fd int, buffers [][]byte, oob []byte, flags int) (n, oobn int, recvflags int, from Sockaddr, err error) { + iov := make([]Iovec, len(buffers)) + for i := range buffers { + if len(buffers[i]) > 0 { + iov[i].Base = &buffers[i][0] + iov[i].SetLen(len(buffers[i])) + } else { + iov[i].Base = (*byte)(unsafe.Pointer(&_zero)) + } + } + var rsa RawSockaddrAny + n, oobn, recvflags, err = recvmsgRaw(fd, iov, oob, flags, &rsa) + if err == nil && rsa.Addr.Family != AF_UNSPEC { + from, err = anyToSockaddr(fd, &rsa) + } + return +} + func Sendmsg(fd int, p, oob []byte, to Sockaddr, flags int) (err error) { _, err = SendmsgN(fd, p, oob, to, flags) return } func SendmsgN(fd int, p, oob []byte, to Sockaddr, flags int) (n int, err error) { + var iov [1]Iovec + if len(p) > 0 { + iov[0].Base = &p[0] + iov[0].SetLen(len(p)) + } + var ptr unsafe.Pointer + var salen _Socklen + if to != nil { + ptr, salen, err = to.sockaddr() + if err != nil { + return 0, err + } + } + return sendmsgN(fd, iov[:], oob, ptr, salen, flags) +} + +// SendmsgBuffers sends a message on a socket to an address using the sendmsg +// system call. The flags are passed to sendmsg. Any non-control data written +// is gathered from buffers. The function returns the number of bytes written +// to the socket. +func SendmsgBuffers(fd int, buffers [][]byte, oob []byte, to Sockaddr, flags int) (n int, err error) { + iov := make([]Iovec, len(buffers)) + for i := range buffers { + if len(buffers[i]) > 0 { + iov[i].Base = &buffers[i][0] + iov[i].SetLen(len(buffers[i])) + } else { + iov[i].Base = (*byte)(unsafe.Pointer(&_zero)) + } + } var ptr unsafe.Pointer var salen _Socklen if to != nil { @@ -361,7 +421,7 @@ func SendmsgN(fd int, p, oob []byte, to Sockaddr, flags int) (n int, err error) return 0, err } } - return sendmsgN(fd, p, oob, ptr, salen, flags) + return sendmsgN(fd, iov, oob, ptr, salen, flags) } func Send(s int, buf []byte, flags int) (err error) { @@ -484,3 +544,13 @@ func Lutimes(path string, tv []Timeval) error { } return UtimesNanoAt(AT_FDCWD, path, ts, AT_SYMLINK_NOFOLLOW) } + +// emptyIovec reports whether there are no bytes in the slice of Iovec. +func emptyIovecs(iov []Iovec) bool { + for i := range iov { + if iov[i].Len > 0 { + return false + } + } + return true +} diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux.go b/vendor/golang.org/x/sys/unix/zerrors_linux.go index c0a43f8..dfa9bd9 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux.go @@ -184,6 +184,7 @@ const ( BPF_F_ALLOW_MULTI = 0x2 BPF_F_ALLOW_OVERRIDE = 0x1 BPF_F_ANY_ALIGNMENT = 0x2 + BPF_F_KPROBE_MULTI_RETURN = 0x1 BPF_F_QUERY_EFFECTIVE = 0x1 BPF_F_REPLACE = 0x4 BPF_F_SLEEPABLE = 0x10 @@ -191,6 +192,8 @@ const ( BPF_F_TEST_RND_HI32 = 0x4 BPF_F_TEST_RUN_ON_CPU = 0x1 BPF_F_TEST_STATE_FREQ = 0x8 + BPF_F_TEST_XDP_LIVE_FRAMES = 0x2 + BPF_F_XDP_HAS_FRAGS = 0x20 BPF_H = 0x8 BPF_IMM = 0x0 BPF_IND = 0x40 @@ -517,9 +520,9 @@ const ( DM_UUID_FLAG = 0x4000 DM_UUID_LEN = 0x81 DM_VERSION = 0xc138fd00 - DM_VERSION_EXTRA = "-ioctl (2021-03-22)" + DM_VERSION_EXTRA = "-ioctl (2022-02-22)" DM_VERSION_MAJOR = 0x4 - DM_VERSION_MINOR = 0x2d + DM_VERSION_MINOR = 0x2e DM_VERSION_PATCHLEVEL = 0x0 DT_BLK = 0x6 DT_CHR = 0x2 @@ -712,6 +715,7 @@ const ( ETH_P_EDSA = 0xdada ETH_P_ERSPAN = 0x88be ETH_P_ERSPAN2 = 0x22eb + ETH_P_ETHERCAT = 0x88a4 ETH_P_FCOE = 0x8906 ETH_P_FIP = 0x8914 ETH_P_HDLC = 0x19 @@ -749,6 +753,7 @@ const ( ETH_P_PPP_MP = 0x8 ETH_P_PPP_SES = 0x8864 ETH_P_PREAUTH = 0x88c7 + ETH_P_PROFINET = 0x8892 ETH_P_PRP = 0x88fb ETH_P_PUP = 0x200 ETH_P_PUPAT = 0x201 @@ -837,6 +842,7 @@ const ( FAN_FS_ERROR = 0x8000 FAN_MARK_ADD = 0x1 FAN_MARK_DONT_FOLLOW = 0x4 + FAN_MARK_EVICTABLE = 0x200 FAN_MARK_FILESYSTEM = 0x100 FAN_MARK_FLUSH = 0x80 FAN_MARK_IGNORED_MASK = 0x20 @@ -1055,7 +1061,7 @@ const ( IFA_F_STABLE_PRIVACY = 0x800 IFA_F_TEMPORARY = 0x1 IFA_F_TENTATIVE = 0x40 - IFA_MAX = 0xa + IFA_MAX = 0xb IFF_ALLMULTI = 0x200 IFF_ATTACH_QUEUE = 0x200 IFF_AUTOMEDIA = 0x4000 @@ -1403,6 +1409,7 @@ const ( LANDLOCK_ACCESS_FS_MAKE_SYM = 0x1000 LANDLOCK_ACCESS_FS_READ_DIR = 0x8 LANDLOCK_ACCESS_FS_READ_FILE = 0x4 + LANDLOCK_ACCESS_FS_REFER = 0x2000 LANDLOCK_ACCESS_FS_REMOVE_DIR = 0x10 LANDLOCK_ACCESS_FS_REMOVE_FILE = 0x20 LANDLOCK_ACCESS_FS_WRITE_FILE = 0x2 @@ -1758,6 +1765,7 @@ const ( NLM_F_ACK_TLVS = 0x200 NLM_F_APPEND = 0x800 NLM_F_ATOMIC = 0x400 + NLM_F_BULK = 0x200 NLM_F_CAPPED = 0x100 NLM_F_CREATE = 0x400 NLM_F_DUMP = 0x300 @@ -2075,6 +2083,11 @@ const ( PR_SET_UNALIGN = 0x6 PR_SET_VMA = 0x53564d41 PR_SET_VMA_ANON_NAME = 0x0 + PR_SME_GET_VL = 0x40 + PR_SME_SET_VL = 0x3f + PR_SME_SET_VL_ONEXEC = 0x40000 + PR_SME_VL_INHERIT = 0x20000 + PR_SME_VL_LEN_MASK = 0xffff PR_SPEC_DISABLE = 0x4 PR_SPEC_DISABLE_NOEXEC = 0x10 PR_SPEC_ENABLE = 0x2 @@ -2227,8 +2240,9 @@ const ( RTC_FEATURE_ALARM = 0x0 RTC_FEATURE_ALARM_RES_2S = 0x3 RTC_FEATURE_ALARM_RES_MINUTE = 0x1 + RTC_FEATURE_ALARM_WAKEUP_ONLY = 0x7 RTC_FEATURE_BACKUP_SWITCH_MODE = 0x6 - RTC_FEATURE_CNT = 0x7 + RTC_FEATURE_CNT = 0x8 RTC_FEATURE_CORRECTION = 0x5 RTC_FEATURE_NEED_WEEK_DAY = 0x2 RTC_FEATURE_UPDATE_INTERRUPT = 0x4 @@ -2302,6 +2316,7 @@ const ( RTM_DELRULE = 0x21 RTM_DELTCLASS = 0x29 RTM_DELTFILTER = 0x2d + RTM_DELTUNNEL = 0x79 RTM_DELVLAN = 0x71 RTM_F_CLONED = 0x200 RTM_F_EQUALIZE = 0x400 @@ -2334,8 +2349,9 @@ const ( RTM_GETSTATS = 0x5e RTM_GETTCLASS = 0x2a RTM_GETTFILTER = 0x2e + RTM_GETTUNNEL = 0x7a RTM_GETVLAN = 0x72 - RTM_MAX = 0x77 + RTM_MAX = 0x7b RTM_NEWACTION = 0x30 RTM_NEWADDR = 0x14 RTM_NEWADDRLABEL = 0x48 @@ -2359,11 +2375,13 @@ const ( RTM_NEWSTATS = 0x5c RTM_NEWTCLASS = 0x28 RTM_NEWTFILTER = 0x2c - RTM_NR_FAMILIES = 0x1a - RTM_NR_MSGTYPES = 0x68 + RTM_NEWTUNNEL = 0x78 + RTM_NR_FAMILIES = 0x1b + RTM_NR_MSGTYPES = 0x6c RTM_SETDCB = 0x4f RTM_SETLINK = 0x13 RTM_SETNEIGHTBL = 0x43 + RTM_SETSTATS = 0x5f RTNH_ALIGNTO = 0x4 RTNH_COMPARE_MASK = 0x59 RTNH_F_DEAD = 0x1 @@ -2544,6 +2562,9 @@ const ( SOCK_RDM = 0x4 SOCK_SEQPACKET = 0x5 SOCK_SNDBUF_LOCK = 0x1 + SOCK_TXREHASH_DEFAULT = 0xff + SOCK_TXREHASH_DISABLED = 0x0 + SOCK_TXREHASH_ENABLED = 0x1 SOL_AAL = 0x109 SOL_ALG = 0x117 SOL_ATM = 0x108 @@ -2559,6 +2580,8 @@ const ( SOL_IUCV = 0x115 SOL_KCM = 0x119 SOL_LLC = 0x10c + SOL_MCTP = 0x11d + SOL_MPTCP = 0x11c SOL_NETBEUI = 0x10b SOL_NETLINK = 0x10e SOL_NFC = 0x118 @@ -2674,7 +2697,7 @@ const ( TASKSTATS_GENL_NAME = "TASKSTATS" TASKSTATS_GENL_VERSION = 0x1 TASKSTATS_TYPE_MAX = 0x6 - TASKSTATS_VERSION = 0xb + TASKSTATS_VERSION = 0xd TCIFLUSH = 0x0 TCIOFF = 0x2 TCIOFLUSH = 0x2 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_386.go b/vendor/golang.org/x/sys/unix/zerrors_linux_386.go index 234fd4a..274e2da 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_386.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_386.go @@ -5,7 +5,7 @@ // +build 386,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include -m32 /build/unix/_const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include -m32 _const.go package unix @@ -326,6 +326,7 @@ const ( SO_RCVBUF = 0x8 SO_RCVBUFFORCE = 0x21 SO_RCVLOWAT = 0x12 + SO_RCVMARK = 0x4b SO_RCVTIMEO = 0x14 SO_RCVTIMEO_NEW = 0x42 SO_RCVTIMEO_OLD = 0x14 @@ -350,6 +351,7 @@ const ( SO_TIMESTAMPNS_NEW = 0x40 SO_TIMESTAMPNS_OLD = 0x23 SO_TIMESTAMP_NEW = 0x3f + SO_TXREHASH = 0x4a SO_TXTIME = 0x3d SO_TYPE = 0x3 SO_WIFI_STATUS = 0x29 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go index 58619b7..95b6eee 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go @@ -5,7 +5,7 @@ // +build amd64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include -m64 /build/unix/_const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include -m64 _const.go package unix @@ -327,6 +327,7 @@ const ( SO_RCVBUF = 0x8 SO_RCVBUFFORCE = 0x21 SO_RCVLOWAT = 0x12 + SO_RCVMARK = 0x4b SO_RCVTIMEO = 0x14 SO_RCVTIMEO_NEW = 0x42 SO_RCVTIMEO_OLD = 0x14 @@ -351,6 +352,7 @@ const ( SO_TIMESTAMPNS_NEW = 0x40 SO_TIMESTAMPNS_OLD = 0x23 SO_TIMESTAMP_NEW = 0x3f + SO_TXREHASH = 0x4a SO_TXTIME = 0x3d SO_TYPE = 0x3 SO_WIFI_STATUS = 0x29 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go b/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go index 3a64ff5..918cd13 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go @@ -5,7 +5,7 @@ // +build arm,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/_const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include _const.go package unix @@ -333,6 +333,7 @@ const ( SO_RCVBUF = 0x8 SO_RCVBUFFORCE = 0x21 SO_RCVLOWAT = 0x12 + SO_RCVMARK = 0x4b SO_RCVTIMEO = 0x14 SO_RCVTIMEO_NEW = 0x42 SO_RCVTIMEO_OLD = 0x14 @@ -357,6 +358,7 @@ const ( SO_TIMESTAMPNS_NEW = 0x40 SO_TIMESTAMPNS_OLD = 0x23 SO_TIMESTAMP_NEW = 0x3f + SO_TXREHASH = 0x4a SO_TXTIME = 0x3d SO_TYPE = 0x3 SO_WIFI_STATUS = 0x29 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go index abe0b92..3907dc5 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go @@ -5,7 +5,7 @@ // +build arm64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include -fsigned-char /build/unix/_const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include -fsigned-char _const.go package unix @@ -323,6 +323,7 @@ const ( SO_RCVBUF = 0x8 SO_RCVBUFFORCE = 0x21 SO_RCVLOWAT = 0x12 + SO_RCVMARK = 0x4b SO_RCVTIMEO = 0x14 SO_RCVTIMEO_NEW = 0x42 SO_RCVTIMEO_OLD = 0x14 @@ -347,6 +348,7 @@ const ( SO_TIMESTAMPNS_NEW = 0x40 SO_TIMESTAMPNS_OLD = 0x23 SO_TIMESTAMP_NEW = 0x3f + SO_TXREHASH = 0x4a SO_TXTIME = 0x3d SO_TYPE = 0x3 SO_WIFI_STATUS = 0x29 @@ -511,6 +513,7 @@ const ( WORDSIZE = 0x40 XCASE = 0x4 XTABS = 0x1800 + ZA_MAGIC = 0x54366345 _HIDIOCGRAWNAME = 0x80804804 _HIDIOCGRAWPHYS = 0x80404805 _HIDIOCGRAWUNIQ = 0x80404808 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go index ebc5f32..03d5c10 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go @@ -5,7 +5,7 @@ // +build loong64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/_const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include _const.go package unix @@ -109,8 +109,6 @@ const ( IUCLC = 0x200 IXOFF = 0x1000 IXON = 0x400 - LASX_CTX_MAGIC = 0x41535801 - LSX_CTX_MAGIC = 0x53580001 MAP_ANON = 0x20 MAP_ANONYMOUS = 0x20 MAP_DENYWRITE = 0x800 @@ -319,6 +317,7 @@ const ( SO_RCVBUF = 0x8 SO_RCVBUFFORCE = 0x21 SO_RCVLOWAT = 0x12 + SO_RCVMARK = 0x4b SO_RCVTIMEO = 0x14 SO_RCVTIMEO_NEW = 0x42 SO_RCVTIMEO_OLD = 0x14 @@ -343,6 +342,7 @@ const ( SO_TIMESTAMPNS_NEW = 0x40 SO_TIMESTAMPNS_OLD = 0x23 SO_TIMESTAMP_NEW = 0x3f + SO_TXREHASH = 0x4a SO_TXTIME = 0x3d SO_TYPE = 0x3 SO_WIFI_STATUS = 0x29 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go index 14d7a84..bd794e0 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go @@ -5,7 +5,7 @@ // +build mips,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/_const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include _const.go package unix @@ -326,6 +326,7 @@ const ( SO_RCVBUF = 0x1002 SO_RCVBUFFORCE = 0x21 SO_RCVLOWAT = 0x1004 + SO_RCVMARK = 0x4b SO_RCVTIMEO = 0x1006 SO_RCVTIMEO_NEW = 0x42 SO_RCVTIMEO_OLD = 0x1006 @@ -351,6 +352,7 @@ const ( SO_TIMESTAMPNS_NEW = 0x40 SO_TIMESTAMPNS_OLD = 0x23 SO_TIMESTAMP_NEW = 0x3f + SO_TXREHASH = 0x4a SO_TXTIME = 0x3d SO_TYPE = 0x1008 SO_WIFI_STATUS = 0x29 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go index 99e7c4a..6c741b0 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go @@ -5,7 +5,7 @@ // +build mips64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/_const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include _const.go package unix @@ -326,6 +326,7 @@ const ( SO_RCVBUF = 0x1002 SO_RCVBUFFORCE = 0x21 SO_RCVLOWAT = 0x1004 + SO_RCVMARK = 0x4b SO_RCVTIMEO = 0x1006 SO_RCVTIMEO_NEW = 0x42 SO_RCVTIMEO_OLD = 0x1006 @@ -351,6 +352,7 @@ const ( SO_TIMESTAMPNS_NEW = 0x40 SO_TIMESTAMPNS_OLD = 0x23 SO_TIMESTAMP_NEW = 0x3f + SO_TXREHASH = 0x4a SO_TXTIME = 0x3d SO_TYPE = 0x1008 SO_WIFI_STATUS = 0x29 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go index 496364c..807b8cd 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go @@ -5,7 +5,7 @@ // +build mips64le,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/_const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include _const.go package unix @@ -326,6 +326,7 @@ const ( SO_RCVBUF = 0x1002 SO_RCVBUFFORCE = 0x21 SO_RCVLOWAT = 0x1004 + SO_RCVMARK = 0x4b SO_RCVTIMEO = 0x1006 SO_RCVTIMEO_NEW = 0x42 SO_RCVTIMEO_OLD = 0x1006 @@ -351,6 +352,7 @@ const ( SO_TIMESTAMPNS_NEW = 0x40 SO_TIMESTAMPNS_OLD = 0x23 SO_TIMESTAMP_NEW = 0x3f + SO_TXREHASH = 0x4a SO_TXTIME = 0x3d SO_TYPE = 0x1008 SO_WIFI_STATUS = 0x29 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go index 3e40830..a39e4f5 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go @@ -5,7 +5,7 @@ // +build mipsle,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/_const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include _const.go package unix @@ -326,6 +326,7 @@ const ( SO_RCVBUF = 0x1002 SO_RCVBUFFORCE = 0x21 SO_RCVLOWAT = 0x1004 + SO_RCVMARK = 0x4b SO_RCVTIMEO = 0x1006 SO_RCVTIMEO_NEW = 0x42 SO_RCVTIMEO_OLD = 0x1006 @@ -351,6 +352,7 @@ const ( SO_TIMESTAMPNS_NEW = 0x40 SO_TIMESTAMPNS_OLD = 0x23 SO_TIMESTAMP_NEW = 0x3f + SO_TXREHASH = 0x4a SO_TXTIME = 0x3d SO_TYPE = 0x1008 SO_WIFI_STATUS = 0x29 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go index 1151a7d..c0fcda8 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go @@ -5,7 +5,7 @@ // +build ppc,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/_const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include _const.go package unix @@ -381,6 +381,7 @@ const ( SO_RCVBUF = 0x8 SO_RCVBUFFORCE = 0x21 SO_RCVLOWAT = 0x10 + SO_RCVMARK = 0x4b SO_RCVTIMEO = 0x12 SO_RCVTIMEO_NEW = 0x42 SO_RCVTIMEO_OLD = 0x12 @@ -405,6 +406,7 @@ const ( SO_TIMESTAMPNS_NEW = 0x40 SO_TIMESTAMPNS_OLD = 0x23 SO_TIMESTAMP_NEW = 0x3f + SO_TXREHASH = 0x4a SO_TXTIME = 0x3d SO_TYPE = 0x3 SO_WIFI_STATUS = 0x29 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go index ed17f24..f3b7240 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go @@ -5,7 +5,7 @@ // +build ppc64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/_const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include _const.go package unix @@ -385,6 +385,7 @@ const ( SO_RCVBUF = 0x8 SO_RCVBUFFORCE = 0x21 SO_RCVLOWAT = 0x10 + SO_RCVMARK = 0x4b SO_RCVTIMEO = 0x12 SO_RCVTIMEO_NEW = 0x42 SO_RCVTIMEO_OLD = 0x12 @@ -409,6 +410,7 @@ const ( SO_TIMESTAMPNS_NEW = 0x40 SO_TIMESTAMPNS_OLD = 0x23 SO_TIMESTAMP_NEW = 0x3f + SO_TXREHASH = 0x4a SO_TXTIME = 0x3d SO_TYPE = 0x3 SO_WIFI_STATUS = 0x29 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go index d84a37c..72f2a45 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go @@ -5,7 +5,7 @@ // +build ppc64le,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/_const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include _const.go package unix @@ -385,6 +385,7 @@ const ( SO_RCVBUF = 0x8 SO_RCVBUFFORCE = 0x21 SO_RCVLOWAT = 0x10 + SO_RCVMARK = 0x4b SO_RCVTIMEO = 0x12 SO_RCVTIMEO_NEW = 0x42 SO_RCVTIMEO_OLD = 0x12 @@ -409,6 +410,7 @@ const ( SO_TIMESTAMPNS_NEW = 0x40 SO_TIMESTAMPNS_OLD = 0x23 SO_TIMESTAMP_NEW = 0x3f + SO_TXREHASH = 0x4a SO_TXTIME = 0x3d SO_TYPE = 0x3 SO_WIFI_STATUS = 0x29 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go index 5cafba8..45b214b 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go @@ -5,7 +5,7 @@ // +build riscv64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/_const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include _const.go package unix @@ -314,6 +314,7 @@ const ( SO_RCVBUF = 0x8 SO_RCVBUFFORCE = 0x21 SO_RCVLOWAT = 0x12 + SO_RCVMARK = 0x4b SO_RCVTIMEO = 0x14 SO_RCVTIMEO_NEW = 0x42 SO_RCVTIMEO_OLD = 0x14 @@ -338,6 +339,7 @@ const ( SO_TIMESTAMPNS_NEW = 0x40 SO_TIMESTAMPNS_OLD = 0x23 SO_TIMESTAMP_NEW = 0x3f + SO_TXREHASH = 0x4a SO_TXTIME = 0x3d SO_TYPE = 0x3 SO_WIFI_STATUS = 0x29 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go b/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go index 6d122da..1897f20 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go @@ -5,7 +5,7 @@ // +build s390x,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include -fsigned-char /build/unix/_const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include -fsigned-char _const.go package unix @@ -389,6 +389,7 @@ const ( SO_RCVBUF = 0x8 SO_RCVBUFFORCE = 0x21 SO_RCVLOWAT = 0x12 + SO_RCVMARK = 0x4b SO_RCVTIMEO = 0x14 SO_RCVTIMEO_NEW = 0x42 SO_RCVTIMEO_OLD = 0x14 @@ -413,6 +414,7 @@ const ( SO_TIMESTAMPNS_NEW = 0x40 SO_TIMESTAMPNS_OLD = 0x23 SO_TIMESTAMP_NEW = 0x3f + SO_TXREHASH = 0x4a SO_TXTIME = 0x3d SO_TYPE = 0x3 SO_WIFI_STATUS = 0x29 diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go index 6bd19e5..1fb7a39 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go @@ -5,7 +5,7 @@ // +build sparc64,linux // Code generated by cmd/cgo -godefs; DO NOT EDIT. -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/_const.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include _const.go package unix @@ -380,6 +380,7 @@ const ( SO_RCVBUF = 0x1002 SO_RCVBUFFORCE = 0x100b SO_RCVLOWAT = 0x800 + SO_RCVMARK = 0x54 SO_RCVTIMEO = 0x2000 SO_RCVTIMEO_NEW = 0x44 SO_RCVTIMEO_OLD = 0x2000 @@ -404,6 +405,7 @@ const ( SO_TIMESTAMPNS_NEW = 0x42 SO_TIMESTAMPNS_OLD = 0x21 SO_TIMESTAMP_NEW = 0x46 + SO_TXREHASH = 0x53 SO_TXTIME = 0x3f SO_TYPE = 0x1008 SO_WIFI_STATUS = 0x25 diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go index 8793765..467deed 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go @@ -1643,6 +1643,30 @@ var libc_mknod_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func Mount(fsType string, dir string, flags int, data unsafe.Pointer) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(fsType) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(dir) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_mount_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), uintptr(flags), uintptr(data), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mount_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mount mount "/usr/lib/libSystem.B.dylib" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Open(path string, mode int, perm uint32) (fd int, err error) { var _p0 *byte _p0, err = BytePtrFromString(path) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s index 8da90cf..7e308a4 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s @@ -600,6 +600,12 @@ TEXT libc_mknod_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_mknod_trampoline_addr(SB), RODATA, $8 DATA ·libc_mknod_trampoline_addr(SB)/8, $libc_mknod_trampoline<>(SB) +TEXT libc_mount_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mount(SB) + +GLOBL ·libc_mount_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mount_trampoline_addr(SB)/8, $libc_mount_trampoline<>(SB) + TEXT libc_open_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_open(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go index f47eedd..35938d3 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go @@ -1643,6 +1643,30 @@ var libc_mknod_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func Mount(fsType string, dir string, flags int, data unsafe.Pointer) (err error) { + var _p0 *byte + _p0, err = BytePtrFromString(fsType) + if err != nil { + return + } + var _p1 *byte + _p1, err = BytePtrFromString(dir) + if err != nil { + return + } + _, _, e1 := syscall_syscall6(libc_mount_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), uintptr(flags), uintptr(data), 0, 0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_mount_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_mount mount "/usr/lib/libSystem.B.dylib" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Open(path string, mode int, perm uint32) (fd int, err error) { var _p0 *byte _p0, err = BytePtrFromString(path) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s index 4d26f7d..b09e5bb 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s @@ -600,6 +600,12 @@ TEXT libc_mknod_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_mknod_trampoline_addr(SB), RODATA, $8 DATA ·libc_mknod_trampoline_addr(SB)/8, $libc_mknod_trampoline<>(SB) +TEXT libc_mount_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_mount(SB) + +GLOBL ·libc_mount_trampoline_addr(SB), RODATA, $8 +DATA ·libc_mount_trampoline_addr(SB)/8, $libc_mount_trampoline<>(SB) + TEXT libc_open_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_open(SB) diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_loong64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_loong64.go index 8cdfbe7..523f2ba 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_loong64.go @@ -83,31 +83,6 @@ func Fchown(fd int, uid int, gid int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func Fstat(fd int, stat *Stat_t) (err error) { - _, _, e1 := Syscall(SYS_FSTAT, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - -func Fstatat(fd int, path string, stat *Stat_t, flags int) (err error) { - var _p0 *byte - _p0, err = BytePtrFromString(path) - if err != nil { - return - } - _, _, e1 := Syscall6(SYS_FSTATAT, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), uintptr(flags), 0, 0) - if e1 != 0 { - err = errnoErr(e1) - } - return -} - -// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT - func Fstatfs(fd int, buf *Statfs_t) (err error) { _, _, e1 := Syscall(SYS_FSTATFS, uintptr(fd), uintptr(unsafe.Pointer(buf)), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go index a1a9bcb..1239cc2 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go @@ -180,6 +180,17 @@ func Listen(s int, n int) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func MemfdSecret(flags int) (fd int, err error) { + r0, _, e1 := Syscall(SYS_MEMFD_SECRET, uintptr(flags), 0, 0) + fd = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func pread(fd int, p []byte, offset int64) (n int, err error) { var _p0 unsafe.Pointer if len(p) > 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go index d12f4fb..fdf53f8 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go @@ -66,6 +66,7 @@ import ( //go:cgo_import_dynamic libc_getpriority getpriority "libc.so" //go:cgo_import_dynamic libc_getrlimit getrlimit "libc.so" //go:cgo_import_dynamic libc_getrusage getrusage "libc.so" +//go:cgo_import_dynamic libc_getsid getsid "libc.so" //go:cgo_import_dynamic libc_gettimeofday gettimeofday "libc.so" //go:cgo_import_dynamic libc_getuid getuid "libc.so" //go:cgo_import_dynamic libc_kill kill "libc.so" @@ -202,6 +203,7 @@ import ( //go:linkname procGetpriority libc_getpriority //go:linkname procGetrlimit libc_getrlimit //go:linkname procGetrusage libc_getrusage +//go:linkname procGetsid libc_getsid //go:linkname procGettimeofday libc_gettimeofday //go:linkname procGetuid libc_getuid //go:linkname procKill libc_kill @@ -339,6 +341,7 @@ var ( procGetpriority, procGetrlimit, procGetrusage, + procGetsid, procGettimeofday, procGetuid, procKill, @@ -1044,6 +1047,17 @@ func Getrusage(who int, rusage *Rusage) (err error) { // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func Getsid(pid int) (sid int, err error) { + r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procGetsid)), 1, uintptr(pid), 0, 0, 0, 0, 0) + sid = int(r0) + if e1 != 0 { + err = e1 + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Gettimeofday(tv *Timeval) (err error) { _, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procGettimeofday)), 1, uintptr(unsafe.Pointer(tv)), 0, 0, 0, 0, 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_loong64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_loong64.go index e443f9a..44a764c 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_loong64.go @@ -85,8 +85,6 @@ const ( SYS_SPLICE = 76 SYS_TEE = 77 SYS_READLINKAT = 78 - SYS_FSTATAT = 79 - SYS_FSTAT = 80 SYS_SYNC = 81 SYS_FSYNC = 82 SYS_FDATASYNC = 83 diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go index c3a5af8..3a9c96b 100644 --- a/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go @@ -309,6 +309,7 @@ const ( SYS_LANDLOCK_CREATE_RULESET = 444 SYS_LANDLOCK_ADD_RULE = 445 SYS_LANDLOCK_RESTRICT_SELF = 446 + SYS_MEMFD_SECRET = 447 SYS_PROCESS_MRELEASE = 448 SYS_FUTEX_WAITV = 449 SYS_SET_MEMPOLICY_HOME_NODE = 450 diff --git a/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go index 885842c..e2a64f0 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go @@ -366,30 +366,57 @@ type ICMPv6Filter struct { Filt [8]uint32 } +type TCPConnectionInfo struct { + State uint8 + Snd_wscale uint8 + Rcv_wscale uint8 + _ uint8 + Options uint32 + Flags uint32 + Rto uint32 + Maxseg uint32 + Snd_ssthresh uint32 + Snd_cwnd uint32 + Snd_wnd uint32 + Snd_sbbytes uint32 + Rcv_wnd uint32 + Rttcur uint32 + Srtt uint32 + Rttvar uint32 + Txpackets uint64 + Txbytes uint64 + Txretransmitbytes uint64 + Rxpackets uint64 + Rxbytes uint64 + Rxoutoforderbytes uint64 + Txretransmitpackets uint64 +} + const ( - SizeofSockaddrInet4 = 0x10 - SizeofSockaddrInet6 = 0x1c - SizeofSockaddrAny = 0x6c - SizeofSockaddrUnix = 0x6a - SizeofSockaddrDatalink = 0x14 - SizeofSockaddrCtl = 0x20 - SizeofSockaddrVM = 0xc - SizeofXvsockpcb = 0xa8 - SizeofXSocket = 0x64 - SizeofXSockbuf = 0x18 - SizeofXVSockPgen = 0x20 - SizeofXucred = 0x4c - SizeofLinger = 0x8 - SizeofIovec = 0x10 - SizeofIPMreq = 0x8 - SizeofIPMreqn = 0xc - SizeofIPv6Mreq = 0x14 - SizeofMsghdr = 0x30 - SizeofCmsghdr = 0xc - SizeofInet4Pktinfo = 0xc - SizeofInet6Pktinfo = 0x14 - SizeofIPv6MTUInfo = 0x20 - SizeofICMPv6Filter = 0x20 + SizeofSockaddrInet4 = 0x10 + SizeofSockaddrInet6 = 0x1c + SizeofSockaddrAny = 0x6c + SizeofSockaddrUnix = 0x6a + SizeofSockaddrDatalink = 0x14 + SizeofSockaddrCtl = 0x20 + SizeofSockaddrVM = 0xc + SizeofXvsockpcb = 0xa8 + SizeofXSocket = 0x64 + SizeofXSockbuf = 0x18 + SizeofXVSockPgen = 0x20 + SizeofXucred = 0x4c + SizeofLinger = 0x8 + SizeofIovec = 0x10 + SizeofIPMreq = 0x8 + SizeofIPMreqn = 0xc + SizeofIPv6Mreq = 0x14 + SizeofMsghdr = 0x30 + SizeofCmsghdr = 0xc + SizeofInet4Pktinfo = 0xc + SizeofInet6Pktinfo = 0x14 + SizeofIPv6MTUInfo = 0x20 + SizeofICMPv6Filter = 0x20 + SizeofTCPConnectionInfo = 0x70 ) const ( diff --git a/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go index b23c023..34aa775 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go @@ -366,30 +366,57 @@ type ICMPv6Filter struct { Filt [8]uint32 } +type TCPConnectionInfo struct { + State uint8 + Snd_wscale uint8 + Rcv_wscale uint8 + _ uint8 + Options uint32 + Flags uint32 + Rto uint32 + Maxseg uint32 + Snd_ssthresh uint32 + Snd_cwnd uint32 + Snd_wnd uint32 + Snd_sbbytes uint32 + Rcv_wnd uint32 + Rttcur uint32 + Srtt uint32 + Rttvar uint32 + Txpackets uint64 + Txbytes uint64 + Txretransmitbytes uint64 + Rxpackets uint64 + Rxbytes uint64 + Rxoutoforderbytes uint64 + Txretransmitpackets uint64 +} + const ( - SizeofSockaddrInet4 = 0x10 - SizeofSockaddrInet6 = 0x1c - SizeofSockaddrAny = 0x6c - SizeofSockaddrUnix = 0x6a - SizeofSockaddrDatalink = 0x14 - SizeofSockaddrCtl = 0x20 - SizeofSockaddrVM = 0xc - SizeofXvsockpcb = 0xa8 - SizeofXSocket = 0x64 - SizeofXSockbuf = 0x18 - SizeofXVSockPgen = 0x20 - SizeofXucred = 0x4c - SizeofLinger = 0x8 - SizeofIovec = 0x10 - SizeofIPMreq = 0x8 - SizeofIPMreqn = 0xc - SizeofIPv6Mreq = 0x14 - SizeofMsghdr = 0x30 - SizeofCmsghdr = 0xc - SizeofInet4Pktinfo = 0xc - SizeofInet6Pktinfo = 0x14 - SizeofIPv6MTUInfo = 0x20 - SizeofICMPv6Filter = 0x20 + SizeofSockaddrInet4 = 0x10 + SizeofSockaddrInet6 = 0x1c + SizeofSockaddrAny = 0x6c + SizeofSockaddrUnix = 0x6a + SizeofSockaddrDatalink = 0x14 + SizeofSockaddrCtl = 0x20 + SizeofSockaddrVM = 0xc + SizeofXvsockpcb = 0xa8 + SizeofXSocket = 0x64 + SizeofXSockbuf = 0x18 + SizeofXVSockPgen = 0x20 + SizeofXucred = 0x4c + SizeofLinger = 0x8 + SizeofIovec = 0x10 + SizeofIPMreq = 0x8 + SizeofIPMreqn = 0xc + SizeofIPv6Mreq = 0x14 + SizeofMsghdr = 0x30 + SizeofCmsghdr = 0xc + SizeofInet4Pktinfo = 0xc + SizeofInet6Pktinfo = 0x14 + SizeofIPv6MTUInfo = 0x20 + SizeofICMPv6Filter = 0x20 + SizeofTCPConnectionInfo = 0x70 ) const ( diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux.go b/vendor/golang.org/x/sys/unix/ztypes_linux.go index 9962d26..e62611e 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux.go @@ -1127,7 +1127,9 @@ const ( PERF_BR_SYSRET = 0x8 PERF_BR_COND_CALL = 0x9 PERF_BR_COND_RET = 0xa - PERF_BR_MAX = 0xb + PERF_BR_ERET = 0xb + PERF_BR_IRQ = 0xc + PERF_BR_MAX = 0xd PERF_SAMPLE_REGS_ABI_NONE = 0x0 PERF_SAMPLE_REGS_ABI_32 = 0x1 PERF_SAMPLE_REGS_ABI_64 = 0x2 @@ -2969,7 +2971,7 @@ const ( DEVLINK_CMD_TRAP_POLICER_NEW = 0x47 DEVLINK_CMD_TRAP_POLICER_DEL = 0x48 DEVLINK_CMD_HEALTH_REPORTER_TEST = 0x49 - DEVLINK_CMD_MAX = 0x4d + DEVLINK_CMD_MAX = 0x51 DEVLINK_PORT_TYPE_NOTSET = 0x0 DEVLINK_PORT_TYPE_AUTO = 0x1 DEVLINK_PORT_TYPE_ETH = 0x2 @@ -3198,7 +3200,7 @@ const ( DEVLINK_ATTR_RATE_NODE_NAME = 0xa8 DEVLINK_ATTR_RATE_PARENT_NODE_NAME = 0xa9 DEVLINK_ATTR_REGION_MAX_SNAPSHOTS = 0xaa - DEVLINK_ATTR_MAX = 0xaa + DEVLINK_ATTR_MAX = 0xae DEVLINK_DPIPE_FIELD_MAPPING_TYPE_NONE = 0x0 DEVLINK_DPIPE_FIELD_MAPPING_TYPE_IFINDEX = 0x1 DEVLINK_DPIPE_MATCH_TYPE_FIELD_EXACT = 0x0 @@ -3638,7 +3640,11 @@ const ( ETHTOOL_A_RINGS_RX_MINI = 0x7 ETHTOOL_A_RINGS_RX_JUMBO = 0x8 ETHTOOL_A_RINGS_TX = 0x9 - ETHTOOL_A_RINGS_MAX = 0xa + ETHTOOL_A_RINGS_RX_BUF_LEN = 0xa + ETHTOOL_A_RINGS_TCP_DATA_SPLIT = 0xb + ETHTOOL_A_RINGS_CQE_SIZE = 0xc + ETHTOOL_A_RINGS_TX_PUSH = 0xd + ETHTOOL_A_RINGS_MAX = 0xd ETHTOOL_A_CHANNELS_UNSPEC = 0x0 ETHTOOL_A_CHANNELS_HEADER = 0x1 ETHTOOL_A_CHANNELS_RX_MAX = 0x2 @@ -4323,7 +4329,7 @@ const ( NL80211_ATTR_MAC_HINT = 0xc8 NL80211_ATTR_MAC_MASK = 0xd7 NL80211_ATTR_MAX_AP_ASSOC_STA = 0xca - NL80211_ATTR_MAX = 0x135 + NL80211_ATTR_MAX = 0x137 NL80211_ATTR_MAX_CRIT_PROT_DURATION = 0xb4 NL80211_ATTR_MAX_CSA_COUNTERS = 0xce NL80211_ATTR_MAX_MATCH_SETS = 0x85 @@ -4549,7 +4555,7 @@ const ( NL80211_BAND_IFTYPE_ATTR_HE_CAP_PHY = 0x3 NL80211_BAND_IFTYPE_ATTR_HE_CAP_PPE = 0x5 NL80211_BAND_IFTYPE_ATTR_IFTYPES = 0x1 - NL80211_BAND_IFTYPE_ATTR_MAX = 0x7 + NL80211_BAND_IFTYPE_ATTR_MAX = 0xb NL80211_BAND_S1GHZ = 0x4 NL80211_BITRATE_ATTR_2GHZ_SHORTPREAMBLE = 0x2 NL80211_BITRATE_ATTR_MAX = 0x2 @@ -4887,7 +4893,7 @@ const ( NL80211_FREQUENCY_ATTR_GO_CONCURRENT = 0xf NL80211_FREQUENCY_ATTR_INDOOR_ONLY = 0xe NL80211_FREQUENCY_ATTR_IR_CONCURRENT = 0xf - NL80211_FREQUENCY_ATTR_MAX = 0x19 + NL80211_FREQUENCY_ATTR_MAX = 0x1b NL80211_FREQUENCY_ATTR_MAX_TX_POWER = 0x6 NL80211_FREQUENCY_ATTR_NO_10MHZ = 0x11 NL80211_FREQUENCY_ATTR_NO_160MHZ = 0xc @@ -5254,7 +5260,7 @@ const ( NL80211_RATE_INFO_HE_RU_ALLOC_52 = 0x1 NL80211_RATE_INFO_HE_RU_ALLOC_996 = 0x5 NL80211_RATE_INFO_HE_RU_ALLOC = 0x11 - NL80211_RATE_INFO_MAX = 0x11 + NL80211_RATE_INFO_MAX = 0x16 NL80211_RATE_INFO_MCS = 0x2 NL80211_RATE_INFO_SHORT_GI = 0x4 NL80211_RATE_INFO_VHT_MCS = 0x6 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_386.go b/vendor/golang.org/x/sys/unix/ztypes_linux_386.go index 5314092..7551af4 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_386.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_386.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include -m32 /build/unix/linux/types.go | go run mkpost.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include -m32 linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build 386 && linux @@ -324,6 +324,13 @@ type Taskstats struct { Ac_btime64 uint64 Compact_count uint64 Compact_delay_total uint64 + Ac_tgid uint32 + _ [4]byte + Ac_tgetime uint64 + Ac_exe_dev uint64 + Ac_exe_inode uint64 + Wpcopy_count uint64 + Wpcopy_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go index b02ab83..3e738ac 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include -m64 /build/unix/linux/types.go | go run mkpost.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include -m64 linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build amd64 && linux @@ -338,6 +338,12 @@ type Taskstats struct { Ac_btime64 uint64 Compact_count uint64 Compact_delay_total uint64 + Ac_tgid uint32 + Ac_tgetime uint64 + Ac_exe_dev uint64 + Ac_exe_inode uint64 + Wpcopy_count uint64 + Wpcopy_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go b/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go index 9e6871d..6183eef 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/linux/types.go | go run mkpost.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm && linux @@ -315,6 +315,13 @@ type Taskstats struct { Ac_btime64 uint64 Compact_count uint64 Compact_delay_total uint64 + Ac_tgid uint32 + _ [4]byte + Ac_tgetime uint64 + Ac_exe_dev uint64 + Ac_exe_inode uint64 + Wpcopy_count uint64 + Wpcopy_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go index b732d12..968cecb 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include -fsigned-char /build/unix/linux/types.go | go run mkpost.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include -fsigned-char linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build arm64 && linux @@ -317,6 +317,12 @@ type Taskstats struct { Ac_btime64 uint64 Compact_count uint64 Compact_delay_total uint64 + Ac_tgid uint32 + Ac_tgetime uint64 + Ac_exe_dev uint64 + Ac_exe_inode uint64 + Wpcopy_count uint64 + Wpcopy_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go index 61fbb24..8fe4c52 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/linux/types.go | go run mkpost.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build loong64 && linux @@ -318,6 +318,12 @@ type Taskstats struct { Ac_btime64 uint64 Compact_count uint64 Compact_delay_total uint64 + Ac_tgid uint32 + Ac_tgetime uint64 + Ac_exe_dev uint64 + Ac_exe_inode uint64 + Wpcopy_count uint64 + Wpcopy_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go index 5310f71..11426a3 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/linux/types.go | go run mkpost.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips && linux @@ -320,6 +320,13 @@ type Taskstats struct { Ac_btime64 uint64 Compact_count uint64 Compact_delay_total uint64 + Ac_tgid uint32 + _ [4]byte + Ac_tgetime uint64 + Ac_exe_dev uint64 + Ac_exe_inode uint64 + Wpcopy_count uint64 + Wpcopy_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go index 219bbb1..ad1c3b3 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/linux/types.go | go run mkpost.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64 && linux @@ -320,6 +320,12 @@ type Taskstats struct { Ac_btime64 uint64 Compact_count uint64 Compact_delay_total uint64 + Ac_tgid uint32 + Ac_tgetime uint64 + Ac_exe_dev uint64 + Ac_exe_inode uint64 + Wpcopy_count uint64 + Wpcopy_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go index be9432d..15fd84e 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/linux/types.go | go run mkpost.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mips64le && linux @@ -320,6 +320,12 @@ type Taskstats struct { Ac_btime64 uint64 Compact_count uint64 Compact_delay_total uint64 + Ac_tgid uint32 + Ac_tgetime uint64 + Ac_exe_dev uint64 + Ac_exe_inode uint64 + Wpcopy_count uint64 + Wpcopy_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go index d0155a4..49c4982 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/linux/types.go | go run mkpost.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build mipsle && linux @@ -320,6 +320,13 @@ type Taskstats struct { Ac_btime64 uint64 Compact_count uint64 Compact_delay_total uint64 + Ac_tgid uint32 + _ [4]byte + Ac_tgetime uint64 + Ac_exe_dev uint64 + Ac_exe_inode uint64 + Wpcopy_count uint64 + Wpcopy_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go index 01c17bc..cd36d0d 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/linux/types.go | go run mkpost.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc && linux @@ -327,6 +327,13 @@ type Taskstats struct { Ac_btime64 uint64 Compact_count uint64 Compact_delay_total uint64 + Ac_tgid uint32 + _ [4]byte + Ac_tgetime uint64 + Ac_exe_dev uint64 + Ac_exe_inode uint64 + Wpcopy_count uint64 + Wpcopy_delay_total uint64 } type cpuMask uint32 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go index 944a9c3..8c6fce0 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/linux/types.go | go run mkpost.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64 && linux @@ -327,6 +327,12 @@ type Taskstats struct { Ac_btime64 uint64 Compact_count uint64 Compact_delay_total uint64 + Ac_tgid uint32 + Ac_tgetime uint64 + Ac_exe_dev uint64 + Ac_exe_inode uint64 + Wpcopy_count uint64 + Wpcopy_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go index 5d2c90e..20910f2 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/linux/types.go | go run mkpost.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build ppc64le && linux @@ -327,6 +327,12 @@ type Taskstats struct { Ac_btime64 uint64 Compact_count uint64 Compact_delay_total uint64 + Ac_tgid uint32 + Ac_tgetime uint64 + Ac_exe_dev uint64 + Ac_exe_inode uint64 + Wpcopy_count uint64 + Wpcopy_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go index e173cb5..71b7b33 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/linux/types.go | go run mkpost.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build riscv64 && linux @@ -345,6 +345,12 @@ type Taskstats struct { Ac_btime64 uint64 Compact_count uint64 Compact_delay_total uint64 + Ac_tgid uint32 + Ac_tgetime uint64 + Ac_exe_dev uint64 + Ac_exe_inode uint64 + Wpcopy_count uint64 + Wpcopy_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go b/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go index 6106715..71184cc 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include -fsigned-char /build/unix/linux/types.go | go run mkpost.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include -fsigned-char linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build s390x && linux @@ -340,6 +340,12 @@ type Taskstats struct { Ac_btime64 uint64 Compact_count uint64 Compact_delay_total uint64 + Ac_tgid uint32 + Ac_tgetime uint64 + Ac_exe_dev uint64 + Ac_exe_inode uint64 + Wpcopy_count uint64 + Wpcopy_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go index ca7b37b..0615628 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go @@ -1,4 +1,4 @@ -// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/linux/types.go | go run mkpost.go +// cgo -godefs -- -Wall -Werror -static -I/tmp/include linux/types.go | go run mkpost.go // Code generated by the command above; see README.md. DO NOT EDIT. //go:build sparc64 && linux @@ -322,6 +322,12 @@ type Taskstats struct { Ac_btime64 uint64 Compact_count uint64 Compact_delay_total uint64 + Ac_tgid uint32 + Ac_tgetime uint64 + Ac_exe_dev uint64 + Ac_exe_inode uint64 + Wpcopy_count uint64 + Wpcopy_delay_total uint64 } type cpuMask uint64 diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_386.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_386.go index baf5fe6..2ed718c 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_386.go +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_386.go @@ -94,10 +94,10 @@ type Statfs_t struct { F_namemax uint32 F_owner uint32 F_ctime uint64 - F_fstypename [16]int8 - F_mntonname [90]int8 - F_mntfromname [90]int8 - F_mntfromspec [90]int8 + F_fstypename [16]byte + F_mntonname [90]byte + F_mntfromname [90]byte + F_mntfromspec [90]byte Pad_cgo_0 [2]byte Mount_info [160]byte } diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_amd64.go index e21ae8e..b4fb97e 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_amd64.go @@ -96,10 +96,10 @@ type Statfs_t struct { F_namemax uint32 F_owner uint32 F_ctime uint64 - F_fstypename [16]int8 - F_mntonname [90]int8 - F_mntfromname [90]int8 - F_mntfromspec [90]int8 + F_fstypename [16]byte + F_mntonname [90]byte + F_mntfromname [90]byte + F_mntfromspec [90]byte _ [2]byte Mount_info [160]byte } diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm.go index f190651..2c46750 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm.go @@ -98,10 +98,10 @@ type Statfs_t struct { F_namemax uint32 F_owner uint32 F_ctime uint64 - F_fstypename [16]int8 - F_mntonname [90]int8 - F_mntfromname [90]int8 - F_mntfromspec [90]int8 + F_fstypename [16]byte + F_mntonname [90]byte + F_mntfromname [90]byte + F_mntfromspec [90]byte _ [2]byte Mount_info [160]byte } diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm64.go index 84747c5..ddee045 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm64.go @@ -94,10 +94,10 @@ type Statfs_t struct { F_namemax uint32 F_owner uint32 F_ctime uint64 - F_fstypename [16]int8 - F_mntonname [90]int8 - F_mntfromname [90]int8 - F_mntfromspec [90]int8 + F_fstypename [16]byte + F_mntonname [90]byte + F_mntfromname [90]byte + F_mntfromspec [90]byte _ [2]byte Mount_info [160]byte } diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_mips64.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_mips64.go index ac5c8b6..eb13d4e 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_mips64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_mips64.go @@ -94,10 +94,10 @@ type Statfs_t struct { F_namemax uint32 F_owner uint32 F_ctime uint64 - F_fstypename [16]int8 - F_mntonname [90]int8 - F_mntfromname [90]int8 - F_mntfromspec [90]int8 + F_fstypename [16]byte + F_mntonname [90]byte + F_mntfromname [90]byte + F_mntfromspec [90]byte _ [2]byte Mount_info [160]byte } diff --git a/vendor/golang.org/x/sys/unix/ztypes_solaris_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_solaris_amd64.go index ad4aad2..c1a9b83 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_solaris_amd64.go +++ b/vendor/golang.org/x/sys/unix/ztypes_solaris_amd64.go @@ -178,7 +178,7 @@ type Linger struct { } type Iovec struct { - Base *int8 + Base *byte Len uint64 } diff --git a/vendor/golang.org/x/text/cases/cases.go b/vendor/golang.org/x/text/cases/cases.go new file mode 100644 index 0000000..752cdf0 --- /dev/null +++ b/vendor/golang.org/x/text/cases/cases.go @@ -0,0 +1,162 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_trieval.go + +// Package cases provides general and language-specific case mappers. +package cases // import "golang.org/x/text/cases" + +import ( + "golang.org/x/text/language" + "golang.org/x/text/transform" +) + +// References: +// - Unicode Reference Manual Chapter 3.13, 4.2, and 5.18. +// - https://www.unicode.org/reports/tr29/ +// - https://www.unicode.org/Public/6.3.0/ucd/CaseFolding.txt +// - https://www.unicode.org/Public/6.3.0/ucd/SpecialCasing.txt +// - https://www.unicode.org/Public/6.3.0/ucd/DerivedCoreProperties.txt +// - https://www.unicode.org/Public/6.3.0/ucd/auxiliary/WordBreakProperty.txt +// - https://www.unicode.org/Public/6.3.0/ucd/auxiliary/WordBreakTest.txt +// - http://userguide.icu-project.org/transforms/casemappings + +// TODO: +// - Case folding +// - Wide and Narrow? +// - Segmenter option for title casing. +// - ASCII fast paths +// - Encode Soft-Dotted property within trie somehow. + +// A Caser transforms given input to a certain case. It implements +// transform.Transformer. +// +// A Caser may be stateful and should therefore not be shared between +// goroutines. +type Caser struct { + t transform.SpanningTransformer +} + +// Bytes returns a new byte slice with the result of converting b to the case +// form implemented by c. +func (c Caser) Bytes(b []byte) []byte { + b, _, _ = transform.Bytes(c.t, b) + return b +} + +// String returns a string with the result of transforming s to the case form +// implemented by c. +func (c Caser) String(s string) string { + s, _, _ = transform.String(c.t, s) + return s +} + +// Reset resets the Caser to be reused for new input after a previous call to +// Transform. +func (c Caser) Reset() { c.t.Reset() } + +// Transform implements the transform.Transformer interface and transforms the +// given input to the case form implemented by c. +func (c Caser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + return c.t.Transform(dst, src, atEOF) +} + +// Span implements the transform.SpanningTransformer interface. +func (c Caser) Span(src []byte, atEOF bool) (n int, err error) { + return c.t.Span(src, atEOF) +} + +// Upper returns a Caser for language-specific uppercasing. +func Upper(t language.Tag, opts ...Option) Caser { + return Caser{makeUpper(t, getOpts(opts...))} +} + +// Lower returns a Caser for language-specific lowercasing. +func Lower(t language.Tag, opts ...Option) Caser { + return Caser{makeLower(t, getOpts(opts...))} +} + +// Title returns a Caser for language-specific title casing. It uses an +// approximation of the default Unicode Word Break algorithm. +func Title(t language.Tag, opts ...Option) Caser { + return Caser{makeTitle(t, getOpts(opts...))} +} + +// Fold returns a Caser that implements Unicode case folding. The returned Caser +// is stateless and safe to use concurrently by multiple goroutines. +// +// Case folding does not normalize the input and may not preserve a normal form. +// Use the collate or search package for more convenient and linguistically +// sound comparisons. Use golang.org/x/text/secure/precis for string comparisons +// where security aspects are a concern. +func Fold(opts ...Option) Caser { + return Caser{makeFold(getOpts(opts...))} +} + +// An Option is used to modify the behavior of a Caser. +type Option func(o options) options + +// TODO: consider these options to take a boolean as well, like FinalSigma. +// The advantage of using this approach is that other providers of a lower-case +// algorithm could set different defaults by prefixing a user-provided slice +// of options with their own. This is handy, for instance, for the precis +// package which would override the default to not handle the Greek final sigma. + +var ( + // NoLower disables the lowercasing of non-leading letters for a title + // caser. + NoLower Option = noLower + + // Compact omits mappings in case folding for characters that would grow the + // input. (Unimplemented.) + Compact Option = compact +) + +// TODO: option to preserve a normal form, if applicable? + +type options struct { + noLower bool + simple bool + + // TODO: segmenter, max ignorable, alternative versions, etc. + + ignoreFinalSigma bool +} + +func getOpts(o ...Option) (res options) { + for _, f := range o { + res = f(res) + } + return +} + +func noLower(o options) options { + o.noLower = true + return o +} + +func compact(o options) options { + o.simple = true + return o +} + +// HandleFinalSigma specifies whether the special handling of Greek final sigma +// should be enabled. Unicode prescribes handling the Greek final sigma for all +// locales, but standards like IDNA and PRECIS override this default. +func HandleFinalSigma(enable bool) Option { + if enable { + return handleFinalSigma + } + return ignoreFinalSigma +} + +func ignoreFinalSigma(o options) options { + o.ignoreFinalSigma = true + return o +} + +func handleFinalSigma(o options) options { + o.ignoreFinalSigma = false + return o +} diff --git a/vendor/golang.org/x/text/cases/context.go b/vendor/golang.org/x/text/cases/context.go new file mode 100644 index 0000000..e9aa9e1 --- /dev/null +++ b/vendor/golang.org/x/text/cases/context.go @@ -0,0 +1,376 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cases + +import "golang.org/x/text/transform" + +// A context is used for iterating over source bytes, fetching case info and +// writing to a destination buffer. +// +// Casing operations may need more than one rune of context to decide how a rune +// should be cased. Casing implementations should call checkpoint on context +// whenever it is known to be safe to return the runes processed so far. +// +// It is recommended for implementations to not allow for more than 30 case +// ignorables as lookahead (analogous to the limit in norm) and to use state if +// unbounded lookahead is needed for cased runes. +type context struct { + dst, src []byte + atEOF bool + + pDst int // pDst points past the last written rune in dst. + pSrc int // pSrc points to the start of the currently scanned rune. + + // checkpoints safe to return in Transform, where nDst <= pDst and nSrc <= pSrc. + nDst, nSrc int + err error + + sz int // size of current rune + info info // case information of currently scanned rune + + // State preserved across calls to Transform. + isMidWord bool // false if next cased letter needs to be title-cased. +} + +func (c *context) Reset() { + c.isMidWord = false +} + +// ret returns the return values for the Transform method. It checks whether +// there were insufficient bytes in src to complete and introduces an error +// accordingly, if necessary. +func (c *context) ret() (nDst, nSrc int, err error) { + if c.err != nil || c.nSrc == len(c.src) { + return c.nDst, c.nSrc, c.err + } + // This point is only reached by mappers if there was no short destination + // buffer. This means that the source buffer was exhausted and that c.sz was + // set to 0 by next. + if c.atEOF && c.pSrc == len(c.src) { + return c.pDst, c.pSrc, nil + } + return c.nDst, c.nSrc, transform.ErrShortSrc +} + +// retSpan returns the return values for the Span method. It checks whether +// there were insufficient bytes in src to complete and introduces an error +// accordingly, if necessary. +func (c *context) retSpan() (n int, err error) { + _, nSrc, err := c.ret() + return nSrc, err +} + +// checkpoint sets the return value buffer points for Transform to the current +// positions. +func (c *context) checkpoint() { + if c.err == nil { + c.nDst, c.nSrc = c.pDst, c.pSrc+c.sz + } +} + +// unreadRune causes the last rune read by next to be reread on the next +// invocation of next. Only one unreadRune may be called after a call to next. +func (c *context) unreadRune() { + c.sz = 0 +} + +func (c *context) next() bool { + c.pSrc += c.sz + if c.pSrc == len(c.src) || c.err != nil { + c.info, c.sz = 0, 0 + return false + } + v, sz := trie.lookup(c.src[c.pSrc:]) + c.info, c.sz = info(v), sz + if c.sz == 0 { + if c.atEOF { + // A zero size means we have an incomplete rune. If we are atEOF, + // this means it is an illegal rune, which we will consume one + // byte at a time. + c.sz = 1 + } else { + c.err = transform.ErrShortSrc + return false + } + } + return true +} + +// writeBytes adds bytes to dst. +func (c *context) writeBytes(b []byte) bool { + if len(c.dst)-c.pDst < len(b) { + c.err = transform.ErrShortDst + return false + } + // This loop is faster than using copy. + for _, ch := range b { + c.dst[c.pDst] = ch + c.pDst++ + } + return true +} + +// writeString writes the given string to dst. +func (c *context) writeString(s string) bool { + if len(c.dst)-c.pDst < len(s) { + c.err = transform.ErrShortDst + return false + } + // This loop is faster than using copy. + for i := 0; i < len(s); i++ { + c.dst[c.pDst] = s[i] + c.pDst++ + } + return true +} + +// copy writes the current rune to dst. +func (c *context) copy() bool { + return c.writeBytes(c.src[c.pSrc : c.pSrc+c.sz]) +} + +// copyXOR copies the current rune to dst and modifies it by applying the XOR +// pattern of the case info. It is the responsibility of the caller to ensure +// that this is a rune with a XOR pattern defined. +func (c *context) copyXOR() bool { + if !c.copy() { + return false + } + if c.info&xorIndexBit == 0 { + // Fast path for 6-bit XOR pattern, which covers most cases. + c.dst[c.pDst-1] ^= byte(c.info >> xorShift) + } else { + // Interpret XOR bits as an index. + // TODO: test performance for unrolling this loop. Verify that we have + // at least two bytes and at most three. + idx := c.info >> xorShift + for p := c.pDst - 1; ; p-- { + c.dst[p] ^= xorData[idx] + idx-- + if xorData[idx] == 0 { + break + } + } + } + return true +} + +// hasPrefix returns true if src[pSrc:] starts with the given string. +func (c *context) hasPrefix(s string) bool { + b := c.src[c.pSrc:] + if len(b) < len(s) { + return false + } + for i, c := range b[:len(s)] { + if c != s[i] { + return false + } + } + return true +} + +// caseType returns an info with only the case bits, normalized to either +// cLower, cUpper, cTitle or cUncased. +func (c *context) caseType() info { + cm := c.info & 0x7 + if cm < 4 { + return cm + } + if cm >= cXORCase { + // xor the last bit of the rune with the case type bits. + b := c.src[c.pSrc+c.sz-1] + return info(b&1) ^ cm&0x3 + } + if cm == cIgnorableCased { + return cLower + } + return cUncased +} + +// lower writes the lowercase version of the current rune to dst. +func lower(c *context) bool { + ct := c.caseType() + if c.info&hasMappingMask == 0 || ct == cLower { + return c.copy() + } + if c.info&exceptionBit == 0 { + return c.copyXOR() + } + e := exceptions[c.info>>exceptionShift:] + offset := 2 + e[0]&lengthMask // size of header + fold string + if nLower := (e[1] >> lengthBits) & lengthMask; nLower != noChange { + return c.writeString(e[offset : offset+nLower]) + } + return c.copy() +} + +func isLower(c *context) bool { + ct := c.caseType() + if c.info&hasMappingMask == 0 || ct == cLower { + return true + } + if c.info&exceptionBit == 0 { + c.err = transform.ErrEndOfSpan + return false + } + e := exceptions[c.info>>exceptionShift:] + if nLower := (e[1] >> lengthBits) & lengthMask; nLower != noChange { + c.err = transform.ErrEndOfSpan + return false + } + return true +} + +// upper writes the uppercase version of the current rune to dst. +func upper(c *context) bool { + ct := c.caseType() + if c.info&hasMappingMask == 0 || ct == cUpper { + return c.copy() + } + if c.info&exceptionBit == 0 { + return c.copyXOR() + } + e := exceptions[c.info>>exceptionShift:] + offset := 2 + e[0]&lengthMask // size of header + fold string + // Get length of first special case mapping. + n := (e[1] >> lengthBits) & lengthMask + if ct == cTitle { + // The first special case mapping is for lower. Set n to the second. + if n == noChange { + n = 0 + } + n, e = e[1]&lengthMask, e[n:] + } + if n != noChange { + return c.writeString(e[offset : offset+n]) + } + return c.copy() +} + +// isUpper writes the isUppercase version of the current rune to dst. +func isUpper(c *context) bool { + ct := c.caseType() + if c.info&hasMappingMask == 0 || ct == cUpper { + return true + } + if c.info&exceptionBit == 0 { + c.err = transform.ErrEndOfSpan + return false + } + e := exceptions[c.info>>exceptionShift:] + // Get length of first special case mapping. + n := (e[1] >> lengthBits) & lengthMask + if ct == cTitle { + n = e[1] & lengthMask + } + if n != noChange { + c.err = transform.ErrEndOfSpan + return false + } + return true +} + +// title writes the title case version of the current rune to dst. +func title(c *context) bool { + ct := c.caseType() + if c.info&hasMappingMask == 0 || ct == cTitle { + return c.copy() + } + if c.info&exceptionBit == 0 { + if ct == cLower { + return c.copyXOR() + } + return c.copy() + } + // Get the exception data. + e := exceptions[c.info>>exceptionShift:] + offset := 2 + e[0]&lengthMask // size of header + fold string + + nFirst := (e[1] >> lengthBits) & lengthMask + if nTitle := e[1] & lengthMask; nTitle != noChange { + if nFirst != noChange { + e = e[nFirst:] + } + return c.writeString(e[offset : offset+nTitle]) + } + if ct == cLower && nFirst != noChange { + // Use the uppercase version instead. + return c.writeString(e[offset : offset+nFirst]) + } + // Already in correct case. + return c.copy() +} + +// isTitle reports whether the current rune is in title case. +func isTitle(c *context) bool { + ct := c.caseType() + if c.info&hasMappingMask == 0 || ct == cTitle { + return true + } + if c.info&exceptionBit == 0 { + if ct == cLower { + c.err = transform.ErrEndOfSpan + return false + } + return true + } + // Get the exception data. + e := exceptions[c.info>>exceptionShift:] + if nTitle := e[1] & lengthMask; nTitle != noChange { + c.err = transform.ErrEndOfSpan + return false + } + nFirst := (e[1] >> lengthBits) & lengthMask + if ct == cLower && nFirst != noChange { + c.err = transform.ErrEndOfSpan + return false + } + return true +} + +// foldFull writes the foldFull version of the current rune to dst. +func foldFull(c *context) bool { + if c.info&hasMappingMask == 0 { + return c.copy() + } + ct := c.caseType() + if c.info&exceptionBit == 0 { + if ct != cLower || c.info&inverseFoldBit != 0 { + return c.copyXOR() + } + return c.copy() + } + e := exceptions[c.info>>exceptionShift:] + n := e[0] & lengthMask + if n == 0 { + if ct == cLower { + return c.copy() + } + n = (e[1] >> lengthBits) & lengthMask + } + return c.writeString(e[2 : 2+n]) +} + +// isFoldFull reports whether the current run is mapped to foldFull +func isFoldFull(c *context) bool { + if c.info&hasMappingMask == 0 { + return true + } + ct := c.caseType() + if c.info&exceptionBit == 0 { + if ct != cLower || c.info&inverseFoldBit != 0 { + c.err = transform.ErrEndOfSpan + return false + } + return true + } + e := exceptions[c.info>>exceptionShift:] + n := e[0] & lengthMask + if n == 0 && ct == cLower { + return true + } + c.err = transform.ErrEndOfSpan + return false +} diff --git a/vendor/golang.org/x/text/cases/fold.go b/vendor/golang.org/x/text/cases/fold.go new file mode 100644 index 0000000..85cc434 --- /dev/null +++ b/vendor/golang.org/x/text/cases/fold.go @@ -0,0 +1,34 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cases + +import "golang.org/x/text/transform" + +type caseFolder struct{ transform.NopResetter } + +// caseFolder implements the Transformer interface for doing case folding. +func (t *caseFolder) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + c := context{dst: dst, src: src, atEOF: atEOF} + for c.next() { + foldFull(&c) + c.checkpoint() + } + return c.ret() +} + +func (t *caseFolder) Span(src []byte, atEOF bool) (n int, err error) { + c := context{src: src, atEOF: atEOF} + for c.next() && isFoldFull(&c) { + c.checkpoint() + } + return c.retSpan() +} + +func makeFold(o options) transform.SpanningTransformer { + // TODO: Special case folding, through option Language, Special/Turkic, or + // both. + // TODO: Implement Compact options. + return &caseFolder{} +} diff --git a/vendor/golang.org/x/text/cases/icu.go b/vendor/golang.org/x/text/cases/icu.go new file mode 100644 index 0000000..2dc84b3 --- /dev/null +++ b/vendor/golang.org/x/text/cases/icu.go @@ -0,0 +1,62 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build icu +// +build icu + +package cases + +// Ideally these functions would be defined in a test file, but go test doesn't +// allow CGO in tests. The build tag should ensure either way that these +// functions will not end up in the package. + +// TODO: Ensure that the correct ICU version is set. + +/* +#cgo LDFLAGS: -licui18n.57 -licuuc.57 +#include +#include +#include +#include +#include +*/ +import "C" + +import "unsafe" + +func doICU(tag, caser, input string) string { + err := C.UErrorCode(0) + loc := C.CString(tag) + cm := C.ucasemap_open(loc, C.uint32_t(0), &err) + + buf := make([]byte, len(input)*4) + dst := (*C.char)(unsafe.Pointer(&buf[0])) + src := C.CString(input) + + cn := C.int32_t(0) + + switch caser { + case "fold": + cn = C.ucasemap_utf8FoldCase(cm, + dst, C.int32_t(len(buf)), + src, C.int32_t(len(input)), + &err) + case "lower": + cn = C.ucasemap_utf8ToLower(cm, + dst, C.int32_t(len(buf)), + src, C.int32_t(len(input)), + &err) + case "upper": + cn = C.ucasemap_utf8ToUpper(cm, + dst, C.int32_t(len(buf)), + src, C.int32_t(len(input)), + &err) + case "title": + cn = C.ucasemap_utf8ToTitle(cm, + dst, C.int32_t(len(buf)), + src, C.int32_t(len(input)), + &err) + } + return string(buf[:cn]) +} diff --git a/vendor/golang.org/x/text/cases/info.go b/vendor/golang.org/x/text/cases/info.go new file mode 100644 index 0000000..87a7c3e --- /dev/null +++ b/vendor/golang.org/x/text/cases/info.go @@ -0,0 +1,82 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cases + +func (c info) cccVal() info { + if c&exceptionBit != 0 { + return info(exceptions[c>>exceptionShift]) & cccMask + } + return c & cccMask +} + +func (c info) cccType() info { + ccc := c.cccVal() + if ccc <= cccZero { + return cccZero + } + return ccc +} + +// TODO: Implement full Unicode breaking algorithm: +// 1) Implement breaking in separate package. +// 2) Use the breaker here. +// 3) Compare table size and performance of using the more generic breaker. +// +// Note that we can extend the current algorithm to be much more accurate. This +// only makes sense, though, if the performance and/or space penalty of using +// the generic breaker is big. Extra data will only be needed for non-cased +// runes, which means there are sufficient bits left in the caseType. +// ICU prohibits breaking in such cases as well. + +// For the purpose of title casing we use an approximation of the Unicode Word +// Breaking algorithm defined in Annex #29: +// https://www.unicode.org/reports/tr29/#Default_Grapheme_Cluster_Table. +// +// For our approximation, we group the Word Break types into the following +// categories, with associated rules: +// +// 1) Letter: +// ALetter, Hebrew_Letter, Numeric, ExtendNumLet, Extend, Format_FE, ZWJ. +// Rule: Never break between consecutive runes of this category. +// +// 2) Mid: +// MidLetter, MidNumLet, Single_Quote. +// (Cf. case-ignorable: MidLetter, MidNumLet, Single_Quote or cat is Mn, +// Me, Cf, Lm or Sk). +// Rule: Don't break between Letter and Mid, but break between two Mids. +// +// 3) Break: +// Any other category: NewLine, MidNum, CR, LF, Double_Quote, Katakana, and +// Other. +// These categories should always result in a break between two cased letters. +// Rule: Always break. +// +// Note 1: the Katakana and MidNum categories can, in esoteric cases, result in +// preventing a break between two cased letters. For now we will ignore this +// (e.g. [ALetter] [ExtendNumLet] [Katakana] [ExtendNumLet] [ALetter] and +// [ALetter] [Numeric] [MidNum] [Numeric] [ALetter].) +// +// Note 2: the rule for Mid is very approximate, but works in most cases. To +// improve, we could store the categories in the trie value and use a FA to +// manage breaks. See TODO comment above. +// +// Note 3: according to the spec, it is possible for the Extend category to +// introduce breaks between other categories grouped in Letter. However, this +// is undesirable for our purposes. ICU prevents breaks in such cases as well. + +// isBreak returns whether this rune should introduce a break. +func (c info) isBreak() bool { + return c.cccVal() == cccBreak +} + +// isLetter returns whether the rune is of break type ALetter, Hebrew_Letter, +// Numeric, ExtendNumLet, or Extend. +func (c info) isLetter() bool { + ccc := c.cccVal() + if ccc == cccZero { + return !c.isCaseIgnorable() + } + return ccc != cccBreak +} diff --git a/vendor/golang.org/x/text/cases/map.go b/vendor/golang.org/x/text/cases/map.go new file mode 100644 index 0000000..0f7c6a1 --- /dev/null +++ b/vendor/golang.org/x/text/cases/map.go @@ -0,0 +1,816 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cases + +// This file contains the definitions of case mappings for all supported +// languages. The rules for the language-specific tailorings were taken and +// modified from the CLDR transform definitions in common/transforms. + +import ( + "strings" + "unicode" + "unicode/utf8" + + "golang.org/x/text/internal" + "golang.org/x/text/language" + "golang.org/x/text/transform" + "golang.org/x/text/unicode/norm" +) + +// A mapFunc takes a context set to the current rune and writes the mapped +// version to the same context. It may advance the context to the next rune. It +// returns whether a checkpoint is possible: whether the pDst bytes written to +// dst so far won't need changing as we see more source bytes. +type mapFunc func(*context) bool + +// A spanFunc takes a context set to the current rune and returns whether this +// rune would be altered when written to the output. It may advance the context +// to the next rune. It returns whether a checkpoint is possible. +type spanFunc func(*context) bool + +// maxIgnorable defines the maximum number of ignorables to consider for +// lookahead operations. +const maxIgnorable = 30 + +// supported lists the language tags for which we have tailorings. +const supported = "und af az el lt nl tr" + +func init() { + tags := []language.Tag{} + for _, s := range strings.Split(supported, " ") { + tags = append(tags, language.MustParse(s)) + } + matcher = internal.NewInheritanceMatcher(tags) + Supported = language.NewCoverage(tags) +} + +var ( + matcher *internal.InheritanceMatcher + + Supported language.Coverage + + // We keep the following lists separate, instead of having a single per- + // language struct, to give the compiler a chance to remove unused code. + + // Some uppercase mappers are stateless, so we can precompute the + // Transformers and save a bit on runtime allocations. + upperFunc = []struct { + upper mapFunc + span spanFunc + }{ + {nil, nil}, // und + {nil, nil}, // af + {aztrUpper(upper), isUpper}, // az + {elUpper, noSpan}, // el + {ltUpper(upper), noSpan}, // lt + {nil, nil}, // nl + {aztrUpper(upper), isUpper}, // tr + } + + undUpper transform.SpanningTransformer = &undUpperCaser{} + undLower transform.SpanningTransformer = &undLowerCaser{} + undLowerIgnoreSigma transform.SpanningTransformer = &undLowerIgnoreSigmaCaser{} + + lowerFunc = []mapFunc{ + nil, // und + nil, // af + aztrLower, // az + nil, // el + ltLower, // lt + nil, // nl + aztrLower, // tr + } + + titleInfos = []struct { + title mapFunc + lower mapFunc + titleSpan spanFunc + rewrite func(*context) + }{ + {title, lower, isTitle, nil}, // und + {title, lower, isTitle, afnlRewrite}, // af + {aztrUpper(title), aztrLower, isTitle, nil}, // az + {title, lower, isTitle, nil}, // el + {ltUpper(title), ltLower, noSpan, nil}, // lt + {nlTitle, lower, nlTitleSpan, afnlRewrite}, // nl + {aztrUpper(title), aztrLower, isTitle, nil}, // tr + } +) + +func makeUpper(t language.Tag, o options) transform.SpanningTransformer { + _, i, _ := matcher.Match(t) + f := upperFunc[i].upper + if f == nil { + return undUpper + } + return &simpleCaser{f: f, span: upperFunc[i].span} +} + +func makeLower(t language.Tag, o options) transform.SpanningTransformer { + _, i, _ := matcher.Match(t) + f := lowerFunc[i] + if f == nil { + if o.ignoreFinalSigma { + return undLowerIgnoreSigma + } + return undLower + } + if o.ignoreFinalSigma { + return &simpleCaser{f: f, span: isLower} + } + return &lowerCaser{ + first: f, + midWord: finalSigma(f), + } +} + +func makeTitle(t language.Tag, o options) transform.SpanningTransformer { + _, i, _ := matcher.Match(t) + x := &titleInfos[i] + lower := x.lower + if o.noLower { + lower = (*context).copy + } else if !o.ignoreFinalSigma { + lower = finalSigma(lower) + } + return &titleCaser{ + title: x.title, + lower: lower, + titleSpan: x.titleSpan, + rewrite: x.rewrite, + } +} + +func noSpan(c *context) bool { + c.err = transform.ErrEndOfSpan + return false +} + +// TODO: consider a similar special case for the fast majority lower case. This +// is a bit more involved so will require some more precise benchmarking to +// justify it. + +type undUpperCaser struct{ transform.NopResetter } + +// undUpperCaser implements the Transformer interface for doing an upper case +// mapping for the root locale (und). It eliminates the need for an allocation +// as it prevents escaping by not using function pointers. +func (t undUpperCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + c := context{dst: dst, src: src, atEOF: atEOF} + for c.next() { + upper(&c) + c.checkpoint() + } + return c.ret() +} + +func (t undUpperCaser) Span(src []byte, atEOF bool) (n int, err error) { + c := context{src: src, atEOF: atEOF} + for c.next() && isUpper(&c) { + c.checkpoint() + } + return c.retSpan() +} + +// undLowerIgnoreSigmaCaser implements the Transformer interface for doing +// a lower case mapping for the root locale (und) ignoring final sigma +// handling. This casing algorithm is used in some performance-critical packages +// like secure/precis and x/net/http/idna, which warrants its special-casing. +type undLowerIgnoreSigmaCaser struct{ transform.NopResetter } + +func (t undLowerIgnoreSigmaCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + c := context{dst: dst, src: src, atEOF: atEOF} + for c.next() && lower(&c) { + c.checkpoint() + } + return c.ret() + +} + +// Span implements a generic lower-casing. This is possible as isLower works +// for all lowercasing variants. All lowercase variants only vary in how they +// transform a non-lowercase letter. They will never change an already lowercase +// letter. In addition, there is no state. +func (t undLowerIgnoreSigmaCaser) Span(src []byte, atEOF bool) (n int, err error) { + c := context{src: src, atEOF: atEOF} + for c.next() && isLower(&c) { + c.checkpoint() + } + return c.retSpan() +} + +type simpleCaser struct { + context + f mapFunc + span spanFunc +} + +// simpleCaser implements the Transformer interface for doing a case operation +// on a rune-by-rune basis. +func (t *simpleCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + c := context{dst: dst, src: src, atEOF: atEOF} + for c.next() && t.f(&c) { + c.checkpoint() + } + return c.ret() +} + +func (t *simpleCaser) Span(src []byte, atEOF bool) (n int, err error) { + c := context{src: src, atEOF: atEOF} + for c.next() && t.span(&c) { + c.checkpoint() + } + return c.retSpan() +} + +// undLowerCaser implements the Transformer interface for doing a lower case +// mapping for the root locale (und) ignoring final sigma handling. This casing +// algorithm is used in some performance-critical packages like secure/precis +// and x/net/http/idna, which warrants its special-casing. +type undLowerCaser struct{ transform.NopResetter } + +func (t undLowerCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + c := context{dst: dst, src: src, atEOF: atEOF} + + for isInterWord := true; c.next(); { + if isInterWord { + if c.info.isCased() { + if !lower(&c) { + break + } + isInterWord = false + } else if !c.copy() { + break + } + } else { + if c.info.isNotCasedAndNotCaseIgnorable() { + if !c.copy() { + break + } + isInterWord = true + } else if !c.hasPrefix("Σ") { + if !lower(&c) { + break + } + } else if !finalSigmaBody(&c) { + break + } + } + c.checkpoint() + } + return c.ret() +} + +func (t undLowerCaser) Span(src []byte, atEOF bool) (n int, err error) { + c := context{src: src, atEOF: atEOF} + for c.next() && isLower(&c) { + c.checkpoint() + } + return c.retSpan() +} + +// lowerCaser implements the Transformer interface. The default Unicode lower +// casing requires different treatment for the first and subsequent characters +// of a word, most notably to handle the Greek final Sigma. +type lowerCaser struct { + undLowerIgnoreSigmaCaser + + context + + first, midWord mapFunc +} + +func (t *lowerCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + t.context = context{dst: dst, src: src, atEOF: atEOF} + c := &t.context + + for isInterWord := true; c.next(); { + if isInterWord { + if c.info.isCased() { + if !t.first(c) { + break + } + isInterWord = false + } else if !c.copy() { + break + } + } else { + if c.info.isNotCasedAndNotCaseIgnorable() { + if !c.copy() { + break + } + isInterWord = true + } else if !t.midWord(c) { + break + } + } + c.checkpoint() + } + return c.ret() +} + +// titleCaser implements the Transformer interface. Title casing algorithms +// distinguish between the first letter of a word and subsequent letters of the +// same word. It uses state to avoid requiring a potentially infinite lookahead. +type titleCaser struct { + context + + // rune mappings used by the actual casing algorithms. + title mapFunc + lower mapFunc + titleSpan spanFunc + + rewrite func(*context) +} + +// Transform implements the standard Unicode title case algorithm as defined in +// Chapter 3 of The Unicode Standard: +// toTitlecase(X): Find the word boundaries in X according to Unicode Standard +// Annex #29, "Unicode Text Segmentation." For each word boundary, find the +// first cased character F following the word boundary. If F exists, map F to +// Titlecase_Mapping(F); then map all characters C between F and the following +// word boundary to Lowercase_Mapping(C). +func (t *titleCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + t.context = context{dst: dst, src: src, atEOF: atEOF, isMidWord: t.isMidWord} + c := &t.context + + if !c.next() { + return c.ret() + } + + for { + p := c.info + if t.rewrite != nil { + t.rewrite(c) + } + + wasMid := p.isMid() + // Break out of this loop on failure to ensure we do not modify the + // state incorrectly. + if p.isCased() { + if !c.isMidWord { + if !t.title(c) { + break + } + c.isMidWord = true + } else if !t.lower(c) { + break + } + } else if !c.copy() { + break + } else if p.isBreak() { + c.isMidWord = false + } + + // As we save the state of the transformer, it is safe to call + // checkpoint after any successful write. + if !(c.isMidWord && wasMid) { + c.checkpoint() + } + + if !c.next() { + break + } + if wasMid && c.info.isMid() { + c.isMidWord = false + } + } + return c.ret() +} + +func (t *titleCaser) Span(src []byte, atEOF bool) (n int, err error) { + t.context = context{src: src, atEOF: atEOF, isMidWord: t.isMidWord} + c := &t.context + + if !c.next() { + return c.retSpan() + } + + for { + p := c.info + if t.rewrite != nil { + t.rewrite(c) + } + + wasMid := p.isMid() + // Break out of this loop on failure to ensure we do not modify the + // state incorrectly. + if p.isCased() { + if !c.isMidWord { + if !t.titleSpan(c) { + break + } + c.isMidWord = true + } else if !isLower(c) { + break + } + } else if p.isBreak() { + c.isMidWord = false + } + // As we save the state of the transformer, it is safe to call + // checkpoint after any successful write. + if !(c.isMidWord && wasMid) { + c.checkpoint() + } + + if !c.next() { + break + } + if wasMid && c.info.isMid() { + c.isMidWord = false + } + } + return c.retSpan() +} + +// finalSigma adds Greek final Sigma handing to another casing function. It +// determines whether a lowercased sigma should be σ or ς, by looking ahead for +// case-ignorables and a cased letters. +func finalSigma(f mapFunc) mapFunc { + return func(c *context) bool { + if !c.hasPrefix("Σ") { + return f(c) + } + return finalSigmaBody(c) + } +} + +func finalSigmaBody(c *context) bool { + // Current rune must be ∑. + + // ::NFD(); + // # 03A3; 03C2; 03A3; 03A3; Final_Sigma; # GREEK CAPITAL LETTER SIGMA + // Σ } [:case-ignorable:]* [:cased:] → σ; + // [:cased:] [:case-ignorable:]* { Σ → ς; + // ::Any-Lower; + // ::NFC(); + + p := c.pDst + c.writeString("ς") + + // TODO: we should do this here, but right now this will never have an + // effect as this is called when the prefix is Sigma, whereas Dutch and + // Afrikaans only test for an apostrophe. + // + // if t.rewrite != nil { + // t.rewrite(c) + // } + + // We need to do one more iteration after maxIgnorable, as a cased + // letter is not an ignorable and may modify the result. + wasMid := false + for i := 0; i < maxIgnorable+1; i++ { + if !c.next() { + return false + } + if !c.info.isCaseIgnorable() { + // All Midword runes are also case ignorable, so we are + // guaranteed to have a letter or word break here. As we are + // unreading the run, there is no need to unset c.isMidWord; + // the title caser will handle this. + if c.info.isCased() { + // p+1 is guaranteed to be in bounds: if writing ς was + // successful, p+1 will contain the second byte of ς. If not, + // this function will have returned after c.next returned false. + c.dst[p+1]++ // ς → σ + } + c.unreadRune() + return true + } + // A case ignorable may also introduce a word break, so we may need + // to continue searching even after detecting a break. + isMid := c.info.isMid() + if (wasMid && isMid) || c.info.isBreak() { + c.isMidWord = false + } + wasMid = isMid + c.copy() + } + return true +} + +// finalSigmaSpan would be the same as isLower. + +// elUpper implements Greek upper casing, which entails removing a predefined +// set of non-blocked modifiers. Note that these accents should not be removed +// for title casing! +// Example: "Οδός" -> "ΟΔΟΣ". +func elUpper(c *context) bool { + // From CLDR: + // [:Greek:] [^[:ccc=Not_Reordered:][:ccc=Above:]]*? { [\u0313\u0314\u0301\u0300\u0306\u0342\u0308\u0304] → ; + // [:Greek:] [^[:ccc=Not_Reordered:][:ccc=Iota_Subscript:]]*? { \u0345 → ; + + r, _ := utf8.DecodeRune(c.src[c.pSrc:]) + oldPDst := c.pDst + if !upper(c) { + return false + } + if !unicode.Is(unicode.Greek, r) { + return true + } + i := 0 + // Take the properties of the uppercased rune that is already written to the + // destination. This saves us the trouble of having to uppercase the + // decomposed rune again. + if b := norm.NFD.Properties(c.dst[oldPDst:]).Decomposition(); b != nil { + // Restore the destination position and process the decomposed rune. + r, sz := utf8.DecodeRune(b) + if r <= 0xFF { // See A.6.1 + return true + } + c.pDst = oldPDst + // Insert the first rune and ignore the modifiers. See A.6.2. + c.writeBytes(b[:sz]) + i = len(b[sz:]) / 2 // Greek modifiers are always of length 2. + } + + for ; i < maxIgnorable && c.next(); i++ { + switch r, _ := utf8.DecodeRune(c.src[c.pSrc:]); r { + // Above and Iota Subscript + case 0x0300, // U+0300 COMBINING GRAVE ACCENT + 0x0301, // U+0301 COMBINING ACUTE ACCENT + 0x0304, // U+0304 COMBINING MACRON + 0x0306, // U+0306 COMBINING BREVE + 0x0308, // U+0308 COMBINING DIAERESIS + 0x0313, // U+0313 COMBINING COMMA ABOVE + 0x0314, // U+0314 COMBINING REVERSED COMMA ABOVE + 0x0342, // U+0342 COMBINING GREEK PERISPOMENI + 0x0345: // U+0345 COMBINING GREEK YPOGEGRAMMENI + // No-op. Gobble the modifier. + + default: + switch v, _ := trie.lookup(c.src[c.pSrc:]); info(v).cccType() { + case cccZero: + c.unreadRune() + return true + + // We don't need to test for IotaSubscript as the only rune that + // qualifies (U+0345) was already excluded in the switch statement + // above. See A.4. + + case cccAbove: + return c.copy() + default: + // Some other modifier. We're still allowed to gobble Greek + // modifiers after this. + c.copy() + } + } + } + return i == maxIgnorable +} + +// TODO: implement elUpperSpan (low-priority: complex and infrequent). + +func ltLower(c *context) bool { + // From CLDR: + // # Introduce an explicit dot above when lowercasing capital I's and J's + // # whenever there are more accents above. + // # (of the accents used in Lithuanian: grave, acute, tilde above, and ogonek) + // # 0049; 0069 0307; 0049; 0049; lt More_Above; # LATIN CAPITAL LETTER I + // # 004A; 006A 0307; 004A; 004A; lt More_Above; # LATIN CAPITAL LETTER J + // # 012E; 012F 0307; 012E; 012E; lt More_Above; # LATIN CAPITAL LETTER I WITH OGONEK + // # 00CC; 0069 0307 0300; 00CC; 00CC; lt; # LATIN CAPITAL LETTER I WITH GRAVE + // # 00CD; 0069 0307 0301; 00CD; 00CD; lt; # LATIN CAPITAL LETTER I WITH ACUTE + // # 0128; 0069 0307 0303; 0128; 0128; lt; # LATIN CAPITAL LETTER I WITH TILDE + // ::NFD(); + // I } [^[:ccc=Not_Reordered:][:ccc=Above:]]* [:ccc=Above:] → i \u0307; + // J } [^[:ccc=Not_Reordered:][:ccc=Above:]]* [:ccc=Above:] → j \u0307; + // I \u0328 (Į) } [^[:ccc=Not_Reordered:][:ccc=Above:]]* [:ccc=Above:] → i \u0328 \u0307; + // I \u0300 (Ì) → i \u0307 \u0300; + // I \u0301 (Í) → i \u0307 \u0301; + // I \u0303 (Ĩ) → i \u0307 \u0303; + // ::Any-Lower(); + // ::NFC(); + + i := 0 + if r := c.src[c.pSrc]; r < utf8.RuneSelf { + lower(c) + if r != 'I' && r != 'J' { + return true + } + } else { + p := norm.NFD.Properties(c.src[c.pSrc:]) + if d := p.Decomposition(); len(d) >= 3 && (d[0] == 'I' || d[0] == 'J') { + // UTF-8 optimization: the decomposition will only have an above + // modifier if the last rune of the decomposition is in [U+300-U+311]. + // In all other cases, a decomposition starting with I is always + // an I followed by modifiers that are not cased themselves. See A.2. + if d[1] == 0xCC && d[2] <= 0x91 { // A.2.4. + if !c.writeBytes(d[:1]) { + return false + } + c.dst[c.pDst-1] += 'a' - 'A' // lower + + // Assumption: modifier never changes on lowercase. See A.1. + // Assumption: all modifiers added have CCC = Above. See A.2.3. + return c.writeString("\u0307") && c.writeBytes(d[1:]) + } + // In all other cases the additional modifiers will have a CCC + // that is less than 230 (Above). We will insert the U+0307, if + // needed, after these modifiers so that a string in FCD form + // will remain so. See A.2.2. + lower(c) + i = 1 + } else { + return lower(c) + } + } + + for ; i < maxIgnorable && c.next(); i++ { + switch c.info.cccType() { + case cccZero: + c.unreadRune() + return true + case cccAbove: + return c.writeString("\u0307") && c.copy() // See A.1. + default: + c.copy() // See A.1. + } + } + return i == maxIgnorable +} + +// ltLowerSpan would be the same as isLower. + +func ltUpper(f mapFunc) mapFunc { + return func(c *context) bool { + // Unicode: + // 0307; 0307; ; ; lt After_Soft_Dotted; # COMBINING DOT ABOVE + // + // From CLDR: + // # Remove \u0307 following soft-dotteds (i, j, and the like), with possible + // # intervening non-230 marks. + // ::NFD(); + // [:Soft_Dotted:] [^[:ccc=Not_Reordered:][:ccc=Above:]]* { \u0307 → ; + // ::Any-Upper(); + // ::NFC(); + + // TODO: See A.5. A soft-dotted rune never has an exception. This would + // allow us to overload the exception bit and encode this property in + // info. Need to measure performance impact of this. + r, _ := utf8.DecodeRune(c.src[c.pSrc:]) + oldPDst := c.pDst + if !f(c) { + return false + } + if !unicode.Is(unicode.Soft_Dotted, r) { + return true + } + + // We don't need to do an NFD normalization, as a soft-dotted rune never + // contains U+0307. See A.3. + + i := 0 + for ; i < maxIgnorable && c.next(); i++ { + switch c.info.cccType() { + case cccZero: + c.unreadRune() + return true + case cccAbove: + if c.hasPrefix("\u0307") { + // We don't do a full NFC, but rather combine runes for + // some of the common cases. (Returning NFC or + // preserving normal form is neither a requirement nor + // a possibility anyway). + if !c.next() { + return false + } + if c.dst[oldPDst] == 'I' && c.pDst == oldPDst+1 && c.src[c.pSrc] == 0xcc { + s := "" + switch c.src[c.pSrc+1] { + case 0x80: // U+0300 COMBINING GRAVE ACCENT + s = "\u00cc" // U+00CC LATIN CAPITAL LETTER I WITH GRAVE + case 0x81: // U+0301 COMBINING ACUTE ACCENT + s = "\u00cd" // U+00CD LATIN CAPITAL LETTER I WITH ACUTE + case 0x83: // U+0303 COMBINING TILDE + s = "\u0128" // U+0128 LATIN CAPITAL LETTER I WITH TILDE + case 0x88: // U+0308 COMBINING DIAERESIS + s = "\u00cf" // U+00CF LATIN CAPITAL LETTER I WITH DIAERESIS + default: + } + if s != "" { + c.pDst = oldPDst + return c.writeString(s) + } + } + } + return c.copy() + default: + c.copy() + } + } + return i == maxIgnorable + } +} + +// TODO: implement ltUpperSpan (low priority: complex and infrequent). + +func aztrUpper(f mapFunc) mapFunc { + return func(c *context) bool { + // i→İ; + if c.src[c.pSrc] == 'i' { + return c.writeString("İ") + } + return f(c) + } +} + +func aztrLower(c *context) (done bool) { + // From CLDR: + // # I and i-dotless; I-dot and i are case pairs in Turkish and Azeri + // # 0130; 0069; 0130; 0130; tr; # LATIN CAPITAL LETTER I WITH DOT ABOVE + // İ→i; + // # When lowercasing, remove dot_above in the sequence I + dot_above, which will turn into i. + // # This matches the behavior of the canonically equivalent I-dot_above + // # 0307; ; 0307; 0307; tr After_I; # COMBINING DOT ABOVE + // # When lowercasing, unless an I is before a dot_above, it turns into a dotless i. + // # 0049; 0131; 0049; 0049; tr Not_Before_Dot; # LATIN CAPITAL LETTER I + // I([^[:ccc=Not_Reordered:][:ccc=Above:]]*)\u0307 → i$1 ; + // I→ı ; + // ::Any-Lower(); + if c.hasPrefix("\u0130") { // İ + return c.writeString("i") + } + if c.src[c.pSrc] != 'I' { + return lower(c) + } + + // We ignore the lower-case I for now, but insert it later when we know + // which form we need. + start := c.pSrc + c.sz + + i := 0 +Loop: + // We check for up to n ignorables before \u0307. As \u0307 is an + // ignorable as well, n is maxIgnorable-1. + for ; i < maxIgnorable && c.next(); i++ { + switch c.info.cccType() { + case cccAbove: + if c.hasPrefix("\u0307") { + return c.writeString("i") && c.writeBytes(c.src[start:c.pSrc]) // ignore U+0307 + } + done = true + break Loop + case cccZero: + c.unreadRune() + done = true + break Loop + default: + // We'll write this rune after we know which starter to use. + } + } + if i == maxIgnorable { + done = true + } + return c.writeString("ı") && c.writeBytes(c.src[start:c.pSrc+c.sz]) && done +} + +// aztrLowerSpan would be the same as isLower. + +func nlTitle(c *context) bool { + // From CLDR: + // # Special titlecasing for Dutch initial "ij". + // ::Any-Title(); + // # Fix up Ij at the beginning of a "word" (per Any-Title, notUAX #29) + // [:^WB=ALetter:] [:WB=Extend:]* [[:WB=MidLetter:][:WB=MidNumLet:]]? { Ij } → IJ ; + if c.src[c.pSrc] != 'I' && c.src[c.pSrc] != 'i' { + return title(c) + } + + if !c.writeString("I") || !c.next() { + return false + } + if c.src[c.pSrc] == 'j' || c.src[c.pSrc] == 'J' { + return c.writeString("J") + } + c.unreadRune() + return true +} + +func nlTitleSpan(c *context) bool { + // From CLDR: + // # Special titlecasing for Dutch initial "ij". + // ::Any-Title(); + // # Fix up Ij at the beginning of a "word" (per Any-Title, notUAX #29) + // [:^WB=ALetter:] [:WB=Extend:]* [[:WB=MidLetter:][:WB=MidNumLet:]]? { Ij } → IJ ; + if c.src[c.pSrc] != 'I' { + return isTitle(c) + } + if !c.next() || c.src[c.pSrc] == 'j' { + return false + } + if c.src[c.pSrc] != 'J' { + c.unreadRune() + } + return true +} + +// Not part of CLDR, but see https://unicode.org/cldr/trac/ticket/7078. +func afnlRewrite(c *context) { + if c.hasPrefix("'") || c.hasPrefix("’") { + c.isMidWord = true + } +} diff --git a/vendor/golang.org/x/text/cases/tables10.0.0.go b/vendor/golang.org/x/text/cases/tables10.0.0.go new file mode 100644 index 0000000..ca99231 --- /dev/null +++ b/vendor/golang.org/x/text/cases/tables10.0.0.go @@ -0,0 +1,2256 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.10 && !go1.13 +// +build go1.10,!go1.13 + +package cases + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "10.0.0" + +var xorData string = "" + // Size: 185 bytes + "\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" + + "\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" + + "\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" + + "\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" + + "\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" + + "\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" + + "\x0b!\x10\x00\x0b!0\x00\x0b(\x04\x00\x03\x04\x1e\x00\x03\x0a\x00\x02:" + + "\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<\x00\x01&\x00\x01*" + + "\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x01\x1e\x00\x01\x22" + +var exceptions string = "" + // Size: 2068 bytes + "\x00\x12\x12μΜΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x09II\x13\x1bʼnʼNʼN\x11" + + "\x09sSS\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ\x10\x12LJLj" + + "\x12\x12njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x1bǰJ̌J̌\x12\x12dzdzDz\x12\x12dzdzDZ\x10" + + "\x12DZDz\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x1bⱾⱾ\x10\x1bⱿⱿ\x10\x1bⱯⱯ\x10\x1bⱭⱭ\x10" + + "\x1bⱰⱰ\x10\x1bꞫꞫ\x10\x1bꞬꞬ\x10\x1bꞍꞍ\x10\x1bꞪꞪ\x10\x1bꞮꞮ\x10\x1bⱢⱢ\x10" + + "\x1bꞭꞭ\x10\x1bⱮⱮ\x10\x1bⱤⱤ\x10\x1bꞱꞱ\x10\x1bꞲꞲ\x10\x1bꞰꞰ2\x12ιΙΙ\x166ΐ" + + "Ϊ́Ϊ́\x166ΰΫ́Ϋ́\x12\x12σΣΣ\x12\x12βΒΒ\x12\x12θΘΘ\x12\x12φΦΦ\x12" + + "\x12πΠΠ\x12\x12κΚΚ\x12\x12ρΡΡ\x12\x12εΕΕ\x14$եւԵՒԵւ\x12\x12вВВ\x12\x12дД" + + "Д\x12\x12оОО\x12\x12сСС\x12\x12тТТ\x12\x12тТТ\x12\x12ъЪЪ\x12\x12ѣѢѢ\x13" + + "\x1bꙋꙊꙊ\x13\x1bẖH̱H̱\x13\x1bẗT̈T̈\x13\x1bẘW̊W̊\x13\x1bẙY̊Y̊\x13\x1ba" + + "ʾAʾAʾ\x13\x1bṡṠṠ\x12\x10ssß\x14$ὐΥ̓Υ̓\x166ὒΥ̓̀Υ̓̀\x166ὔΥ̓́Υ̓́\x166" + + "ὖΥ̓͂Υ̓͂\x15+ἀιἈΙᾈ\x15+ἁιἉΙᾉ\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ" + + "\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ\x15\x1dἀιᾀἈΙ\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ" + + "\x15\x1dἄιᾄἌΙ\x15\x1dἅιᾅἍΙ\x15\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ" + + "\x15+ἢιἪΙᾚ\x15+ἣιἫΙᾛ\x15+ἤιἬΙᾜ\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨ" + + "Ι\x15\x1dἡιᾑἩΙ\x15\x1dἢιᾒἪΙ\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15" + + "\x1dἦιᾖἮΙ\x15\x1dἧιᾗἯΙ\x15+ὠιὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ" + + "\x15+ὥιὭΙᾭ\x15+ὦιὮΙᾮ\x15+ὧιὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ" + + "\x15\x1dὣιᾣὫΙ\x15\x1dὤιᾤὬΙ\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰι" + + "ᾺΙᾺͅ\x14#αιΑΙᾼ\x14$άιΆΙΆͅ\x14$ᾶΑ͂Α͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12" + + "\x12ιΙΙ\x15-ὴιῊΙῊͅ\x14#ηιΗΙῌ\x14$ήιΉΙΉͅ\x14$ῆΗ͂Η͂\x166ῆιΗ͂Ιῌ͂\x14\x1c" + + "ηιῃΗΙ\x166ῒΪ̀Ϊ̀\x166ΐΪ́Ϊ́\x14$ῖΙ͂Ι͂\x166ῗΪ͂Ϊ͂\x166ῢΫ̀Ϋ" + + "̀\x166ΰΫ́Ϋ́\x14$ῤΡ̓Ρ̓\x14$ῦΥ͂Υ͂\x166ῧΫ͂Ϋ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙ" + + "ῼ\x14$ώιΏΙΏͅ\x14$ῶΩ͂Ω͂\x166ῶιΩ͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk" + + "\x12\x10åå\x12\x10ɫɫ\x12\x10ɽɽ\x10\x12ȺȺ\x10\x12ȾȾ\x12\x10ɑɑ\x12\x10ɱɱ" + + "\x12\x10ɐɐ\x12\x10ɒɒ\x12\x10ȿȿ\x12\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ" + + "\x12\x10ɡɡ\x12\x10ɬɬ\x12\x10ɪɪ\x12\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x12ffFF" + + "Ff\x12\x12fiFIFi\x12\x12flFLFl\x13\x1bffiFFIFfi\x13\x1bfflFFLFfl\x12\x12" + + "stSTSt\x12\x12stSTSt\x14$մնՄՆՄն\x14$մեՄԵՄե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄ" + + "ԽՄխ" + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// caseTrie. Total size: 11892 bytes (11.61 KiB). Checksum: c6f15484b7653775. +type caseTrie struct{} + +func newCaseTrie(i int) *caseTrie { + return &caseTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *caseTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 18: + return uint16(caseValues[n<<6+uint32(b)]) + default: + n -= 18 + return uint16(sparse.lookup(n, b)) + } +} + +// caseValues: 20 blocks, 1280 entries, 2560 bytes +// The third block is the zero block. +var caseValues = [1280]uint16{ + // Block 0x0, offset 0x0 + 0x27: 0x0054, + 0x2e: 0x0054, + 0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010, + 0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054, + // Block 0x1, offset 0x40 + 0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013, + 0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013, + 0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013, + 0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013, + 0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013, + 0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012, + 0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012, + 0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012, + 0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012, + 0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112, + 0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713, + 0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313, + 0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653, + 0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x0012, 0xdc: 0x1d53, 0xdd: 0x2c53, + 0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112, + 0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853, + 0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13, + 0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313, + 0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010, + 0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452, + // Block 0x4, offset 0x100 + 0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x02db, 0x105: 0x0359, + 0x106: 0x03da, 0x107: 0x043b, 0x108: 0x04b9, 0x109: 0x053a, 0x10a: 0x059b, 0x10b: 0x0619, + 0x10c: 0x069a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313, + 0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13, + 0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452, + 0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112, + 0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112, + 0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112, + 0x130: 0x06fa, 0x131: 0x07ab, 0x132: 0x0829, 0x133: 0x08aa, 0x134: 0x0113, 0x135: 0x0112, + 0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112, + 0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112, + // Block 0x5, offset 0x140 + 0x140: 0x0a8a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53, + 0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112, + 0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x0b0a, 0x151: 0x0b8a, + 0x152: 0x0c0a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152, + 0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x0c8a, 0x15d: 0x0012, + 0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x0d0a, 0x162: 0x0012, 0x163: 0x2052, + 0x164: 0x0012, 0x165: 0x0d8a, 0x166: 0x0e0a, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652, + 0x16a: 0x0e8a, 0x16b: 0x0f0a, 0x16c: 0x0f8a, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52, + 0x170: 0x0012, 0x171: 0x100a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252, + 0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012, + 0x17c: 0x0012, 0x17d: 0x108a, 0x17e: 0x0012, 0x17f: 0x0012, + // Block 0x6, offset 0x180 + 0x180: 0x3552, 0x181: 0x0012, 0x182: 0x0012, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012, + 0x186: 0x0012, 0x187: 0x110a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52, + 0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012, + 0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0012, 0x196: 0x0012, 0x197: 0x0012, + 0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x118a, + 0x19e: 0x120a, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012, + 0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012, + 0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012, + 0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015, + 0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014, + 0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x128d, + 0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024, + 0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024, + 0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024, + 0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034, + 0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024, + 0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024, + 0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024, + 0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004, + 0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52, + 0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353, + // Block 0x8, offset 0x200 + 0x204: 0x0004, 0x205: 0x0004, + 0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513, + 0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x130a, 0x211: 0x2013, + 0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013, + 0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013, + 0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53, + 0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53, + 0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512, + 0x230: 0x144a, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012, + 0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012, + 0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012, + // Block 0x9, offset 0x240 + 0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x158a, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52, + 0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52, + 0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x160a, 0x251: 0x168a, + 0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x170a, 0x256: 0x178a, 0x257: 0x1812, + 0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112, + 0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112, + 0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112, + 0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112, + 0x270: 0x180a, 0x271: 0x188a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x190a, + 0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112, + 0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053, + // Block 0xa, offset 0x280 + 0x280: 0x0812, 0x281: 0x0812, 0x282: 0x0812, 0x283: 0x0812, 0x284: 0x0812, 0x285: 0x0812, + 0x288: 0x0813, 0x289: 0x0813, 0x28a: 0x0813, 0x28b: 0x0813, + 0x28c: 0x0813, 0x28d: 0x0813, 0x290: 0x239a, 0x291: 0x0812, + 0x292: 0x247a, 0x293: 0x0812, 0x294: 0x25ba, 0x295: 0x0812, 0x296: 0x26fa, 0x297: 0x0812, + 0x299: 0x0813, 0x29b: 0x0813, 0x29d: 0x0813, + 0x29f: 0x0813, 0x2a0: 0x0812, 0x2a1: 0x0812, 0x2a2: 0x0812, 0x2a3: 0x0812, + 0x2a4: 0x0812, 0x2a5: 0x0812, 0x2a6: 0x0812, 0x2a7: 0x0812, 0x2a8: 0x0813, 0x2a9: 0x0813, + 0x2aa: 0x0813, 0x2ab: 0x0813, 0x2ac: 0x0813, 0x2ad: 0x0813, 0x2ae: 0x0813, 0x2af: 0x0813, + 0x2b0: 0x8b52, 0x2b1: 0x8b52, 0x2b2: 0x8e52, 0x2b3: 0x8e52, 0x2b4: 0x9152, 0x2b5: 0x9152, + 0x2b6: 0x9452, 0x2b7: 0x9452, 0x2b8: 0x9752, 0x2b9: 0x9752, 0x2ba: 0x9a52, 0x2bb: 0x9a52, + 0x2bc: 0x4d52, 0x2bd: 0x4d52, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x283a, 0x2c1: 0x292a, 0x2c2: 0x2a1a, 0x2c3: 0x2b0a, 0x2c4: 0x2bfa, 0x2c5: 0x2cea, + 0x2c6: 0x2dda, 0x2c7: 0x2eca, 0x2c8: 0x2fb9, 0x2c9: 0x30a9, 0x2ca: 0x3199, 0x2cb: 0x3289, + 0x2cc: 0x3379, 0x2cd: 0x3469, 0x2ce: 0x3559, 0x2cf: 0x3649, 0x2d0: 0x373a, 0x2d1: 0x382a, + 0x2d2: 0x391a, 0x2d3: 0x3a0a, 0x2d4: 0x3afa, 0x2d5: 0x3bea, 0x2d6: 0x3cda, 0x2d7: 0x3dca, + 0x2d8: 0x3eb9, 0x2d9: 0x3fa9, 0x2da: 0x4099, 0x2db: 0x4189, 0x2dc: 0x4279, 0x2dd: 0x4369, + 0x2de: 0x4459, 0x2df: 0x4549, 0x2e0: 0x463a, 0x2e1: 0x472a, 0x2e2: 0x481a, 0x2e3: 0x490a, + 0x2e4: 0x49fa, 0x2e5: 0x4aea, 0x2e6: 0x4bda, 0x2e7: 0x4cca, 0x2e8: 0x4db9, 0x2e9: 0x4ea9, + 0x2ea: 0x4f99, 0x2eb: 0x5089, 0x2ec: 0x5179, 0x2ed: 0x5269, 0x2ee: 0x5359, 0x2ef: 0x5449, + 0x2f0: 0x0812, 0x2f1: 0x0812, 0x2f2: 0x553a, 0x2f3: 0x564a, 0x2f4: 0x571a, + 0x2f6: 0x57fa, 0x2f7: 0x58da, 0x2f8: 0x0813, 0x2f9: 0x0813, 0x2fa: 0x8b53, 0x2fb: 0x8b53, + 0x2fc: 0x5a19, 0x2fd: 0x0004, 0x2fe: 0x5aea, 0x2ff: 0x0004, + // Block 0xc, offset 0x300 + 0x300: 0x0004, 0x301: 0x0004, 0x302: 0x5b6a, 0x303: 0x5c7a, 0x304: 0x5d4a, + 0x306: 0x5e2a, 0x307: 0x5f0a, 0x308: 0x8e53, 0x309: 0x8e53, 0x30a: 0x9153, 0x30b: 0x9153, + 0x30c: 0x6049, 0x30d: 0x0004, 0x30e: 0x0004, 0x30f: 0x0004, 0x310: 0x0812, 0x311: 0x0812, + 0x312: 0x611a, 0x313: 0x625a, 0x316: 0x639a, 0x317: 0x647a, + 0x318: 0x0813, 0x319: 0x0813, 0x31a: 0x9453, 0x31b: 0x9453, 0x31d: 0x0004, + 0x31e: 0x0004, 0x31f: 0x0004, 0x320: 0x0812, 0x321: 0x0812, 0x322: 0x65ba, 0x323: 0x66fa, + 0x324: 0x683a, 0x325: 0x0912, 0x326: 0x691a, 0x327: 0x69fa, 0x328: 0x0813, 0x329: 0x0813, + 0x32a: 0x9a53, 0x32b: 0x9a53, 0x32c: 0x0913, 0x32d: 0x0004, 0x32e: 0x0004, 0x32f: 0x0004, + 0x332: 0x6b3a, 0x333: 0x6c4a, 0x334: 0x6d1a, + 0x336: 0x6dfa, 0x337: 0x6eda, 0x338: 0x9753, 0x339: 0x9753, 0x33a: 0x4d53, 0x33b: 0x4d53, + 0x33c: 0x7019, 0x33d: 0x0004, 0x33e: 0x0004, + // Block 0xd, offset 0x340 + 0x342: 0x0013, + 0x347: 0x0013, 0x34a: 0x0012, 0x34b: 0x0013, + 0x34c: 0x0013, 0x34d: 0x0013, 0x34e: 0x0012, 0x34f: 0x0012, 0x350: 0x0013, 0x351: 0x0013, + 0x352: 0x0013, 0x353: 0x0012, 0x355: 0x0013, + 0x359: 0x0013, 0x35a: 0x0013, 0x35b: 0x0013, 0x35c: 0x0013, 0x35d: 0x0013, + 0x364: 0x0013, 0x366: 0x70eb, 0x368: 0x0013, + 0x36a: 0x714b, 0x36b: 0x718b, 0x36c: 0x0013, 0x36d: 0x0013, 0x36f: 0x0012, + 0x370: 0x0013, 0x371: 0x0013, 0x372: 0x9d53, 0x373: 0x0013, 0x374: 0x0012, 0x375: 0x0010, + 0x376: 0x0010, 0x377: 0x0010, 0x378: 0x0010, 0x379: 0x0012, + 0x37c: 0x0012, 0x37d: 0x0012, 0x37e: 0x0013, 0x37f: 0x0013, + // Block 0xe, offset 0x380 + 0x380: 0x1a13, 0x381: 0x1a13, 0x382: 0x1e13, 0x383: 0x1e13, 0x384: 0x1a13, 0x385: 0x1a13, + 0x386: 0x2613, 0x387: 0x2613, 0x388: 0x2a13, 0x389: 0x2a13, 0x38a: 0x2e13, 0x38b: 0x2e13, + 0x38c: 0x2a13, 0x38d: 0x2a13, 0x38e: 0x2613, 0x38f: 0x2613, 0x390: 0xa052, 0x391: 0xa052, + 0x392: 0xa352, 0x393: 0xa352, 0x394: 0xa652, 0x395: 0xa652, 0x396: 0xa352, 0x397: 0xa352, + 0x398: 0xa052, 0x399: 0xa052, 0x39a: 0x1a12, 0x39b: 0x1a12, 0x39c: 0x1e12, 0x39d: 0x1e12, + 0x39e: 0x1a12, 0x39f: 0x1a12, 0x3a0: 0x2612, 0x3a1: 0x2612, 0x3a2: 0x2a12, 0x3a3: 0x2a12, + 0x3a4: 0x2e12, 0x3a5: 0x2e12, 0x3a6: 0x2a12, 0x3a7: 0x2a12, 0x3a8: 0x2612, 0x3a9: 0x2612, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x6552, 0x3c1: 0x6552, 0x3c2: 0x6552, 0x3c3: 0x6552, 0x3c4: 0x6552, 0x3c5: 0x6552, + 0x3c6: 0x6552, 0x3c7: 0x6552, 0x3c8: 0x6552, 0x3c9: 0x6552, 0x3ca: 0x6552, 0x3cb: 0x6552, + 0x3cc: 0x6552, 0x3cd: 0x6552, 0x3ce: 0x6552, 0x3cf: 0x6552, 0x3d0: 0xa952, 0x3d1: 0xa952, + 0x3d2: 0xa952, 0x3d3: 0xa952, 0x3d4: 0xa952, 0x3d5: 0xa952, 0x3d6: 0xa952, 0x3d7: 0xa952, + 0x3d8: 0xa952, 0x3d9: 0xa952, 0x3da: 0xa952, 0x3db: 0xa952, 0x3dc: 0xa952, 0x3dd: 0xa952, + 0x3de: 0xa952, 0x3e0: 0x0113, 0x3e1: 0x0112, 0x3e2: 0x71eb, 0x3e3: 0x8853, + 0x3e4: 0x724b, 0x3e5: 0x72aa, 0x3e6: 0x730a, 0x3e7: 0x0f13, 0x3e8: 0x0f12, 0x3e9: 0x0313, + 0x3ea: 0x0312, 0x3eb: 0x0713, 0x3ec: 0x0712, 0x3ed: 0x736b, 0x3ee: 0x73cb, 0x3ef: 0x742b, + 0x3f0: 0x748b, 0x3f1: 0x0012, 0x3f2: 0x0113, 0x3f3: 0x0112, 0x3f4: 0x0012, 0x3f5: 0x0313, + 0x3f6: 0x0312, 0x3f7: 0x0012, 0x3f8: 0x0012, 0x3f9: 0x0012, 0x3fa: 0x0012, 0x3fb: 0x0012, + 0x3fc: 0x0015, 0x3fd: 0x0015, 0x3fe: 0x74eb, 0x3ff: 0x754b, + // Block 0x10, offset 0x400 + 0x400: 0x0113, 0x401: 0x0112, 0x402: 0x0113, 0x403: 0x0112, 0x404: 0x0113, 0x405: 0x0112, + 0x406: 0x0113, 0x407: 0x0112, 0x408: 0x0014, 0x409: 0x0014, 0x40a: 0x0014, 0x40b: 0x0713, + 0x40c: 0x0712, 0x40d: 0x75ab, 0x40e: 0x0012, 0x40f: 0x0010, 0x410: 0x0113, 0x411: 0x0112, + 0x412: 0x0113, 0x413: 0x0112, 0x414: 0x0012, 0x415: 0x0012, 0x416: 0x0113, 0x417: 0x0112, + 0x418: 0x0113, 0x419: 0x0112, 0x41a: 0x0113, 0x41b: 0x0112, 0x41c: 0x0113, 0x41d: 0x0112, + 0x41e: 0x0113, 0x41f: 0x0112, 0x420: 0x0113, 0x421: 0x0112, 0x422: 0x0113, 0x423: 0x0112, + 0x424: 0x0113, 0x425: 0x0112, 0x426: 0x0113, 0x427: 0x0112, 0x428: 0x0113, 0x429: 0x0112, + 0x42a: 0x760b, 0x42b: 0x766b, 0x42c: 0x76cb, 0x42d: 0x772b, 0x42e: 0x778b, + 0x430: 0x77eb, 0x431: 0x784b, 0x432: 0x78ab, 0x433: 0xac53, 0x434: 0x0113, 0x435: 0x0112, + 0x436: 0x0113, 0x437: 0x0112, + // Block 0x11, offset 0x440 + 0x440: 0x790a, 0x441: 0x798a, 0x442: 0x7a0a, 0x443: 0x7a8a, 0x444: 0x7b3a, 0x445: 0x7bea, + 0x446: 0x7c6a, + 0x453: 0x7cea, 0x454: 0x7dca, 0x455: 0x7eaa, 0x456: 0x7f8a, 0x457: 0x806a, + 0x45d: 0x0010, + 0x45e: 0x0034, 0x45f: 0x0010, 0x460: 0x0010, 0x461: 0x0010, 0x462: 0x0010, 0x463: 0x0010, + 0x464: 0x0010, 0x465: 0x0010, 0x466: 0x0010, 0x467: 0x0010, 0x468: 0x0010, + 0x46a: 0x0010, 0x46b: 0x0010, 0x46c: 0x0010, 0x46d: 0x0010, 0x46e: 0x0010, 0x46f: 0x0010, + 0x470: 0x0010, 0x471: 0x0010, 0x472: 0x0010, 0x473: 0x0010, 0x474: 0x0010, 0x475: 0x0010, + 0x476: 0x0010, 0x478: 0x0010, 0x479: 0x0010, 0x47a: 0x0010, 0x47b: 0x0010, + 0x47c: 0x0010, 0x47e: 0x0010, + // Block 0x12, offset 0x480 + 0x480: 0x2213, 0x481: 0x2213, 0x482: 0x2613, 0x483: 0x2613, 0x484: 0x2213, 0x485: 0x2213, + 0x486: 0x2e13, 0x487: 0x2e13, 0x488: 0x2213, 0x489: 0x2213, 0x48a: 0x2613, 0x48b: 0x2613, + 0x48c: 0x2213, 0x48d: 0x2213, 0x48e: 0x3e13, 0x48f: 0x3e13, 0x490: 0x2213, 0x491: 0x2213, + 0x492: 0x2613, 0x493: 0x2613, 0x494: 0x2213, 0x495: 0x2213, 0x496: 0x2e13, 0x497: 0x2e13, + 0x498: 0x2213, 0x499: 0x2213, 0x49a: 0x2613, 0x49b: 0x2613, 0x49c: 0x2213, 0x49d: 0x2213, + 0x49e: 0xb553, 0x49f: 0xb553, 0x4a0: 0xb853, 0x4a1: 0xb853, 0x4a2: 0x2212, 0x4a3: 0x2212, + 0x4a4: 0x2612, 0x4a5: 0x2612, 0x4a6: 0x2212, 0x4a7: 0x2212, 0x4a8: 0x2e12, 0x4a9: 0x2e12, + 0x4aa: 0x2212, 0x4ab: 0x2212, 0x4ac: 0x2612, 0x4ad: 0x2612, 0x4ae: 0x2212, 0x4af: 0x2212, + 0x4b0: 0x3e12, 0x4b1: 0x3e12, 0x4b2: 0x2212, 0x4b3: 0x2212, 0x4b4: 0x2612, 0x4b5: 0x2612, + 0x4b6: 0x2212, 0x4b7: 0x2212, 0x4b8: 0x2e12, 0x4b9: 0x2e12, 0x4ba: 0x2212, 0x4bb: 0x2212, + 0x4bc: 0x2612, 0x4bd: 0x2612, 0x4be: 0x2212, 0x4bf: 0x2212, + // Block 0x13, offset 0x4c0 + 0x4c2: 0x0010, + 0x4c7: 0x0010, 0x4c9: 0x0010, 0x4cb: 0x0010, + 0x4cd: 0x0010, 0x4ce: 0x0010, 0x4cf: 0x0010, 0x4d1: 0x0010, + 0x4d2: 0x0010, 0x4d4: 0x0010, 0x4d7: 0x0010, + 0x4d9: 0x0010, 0x4db: 0x0010, 0x4dd: 0x0010, + 0x4df: 0x0010, 0x4e1: 0x0010, 0x4e2: 0x0010, + 0x4e4: 0x0010, 0x4e7: 0x0010, 0x4e8: 0x0010, 0x4e9: 0x0010, + 0x4ea: 0x0010, 0x4ec: 0x0010, 0x4ed: 0x0010, 0x4ee: 0x0010, 0x4ef: 0x0010, + 0x4f0: 0x0010, 0x4f1: 0x0010, 0x4f2: 0x0010, 0x4f4: 0x0010, 0x4f5: 0x0010, + 0x4f6: 0x0010, 0x4f7: 0x0010, 0x4f9: 0x0010, 0x4fa: 0x0010, 0x4fb: 0x0010, + 0x4fc: 0x0010, 0x4fe: 0x0010, +} + +// caseIndex: 25 blocks, 1600 entries, 3200 bytes +// Block 0 is the zero block. +var caseIndex = [1600]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x12, 0xc3: 0x13, 0xc4: 0x14, 0xc5: 0x15, 0xc6: 0x01, 0xc7: 0x02, + 0xc8: 0x16, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x17, 0xcc: 0x18, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07, + 0xd0: 0x19, 0xd1: 0x1a, 0xd2: 0x1b, 0xd3: 0x1c, 0xd4: 0x1d, 0xd5: 0x1e, 0xd6: 0x1f, 0xd7: 0x20, + 0xd8: 0x21, 0xd9: 0x22, 0xda: 0x23, 0xdb: 0x24, 0xdc: 0x25, 0xdd: 0x26, 0xde: 0x27, 0xdf: 0x28, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09, + 0xf0: 0x14, 0xf3: 0x16, + // Block 0x4, offset 0x100 + 0x120: 0x29, 0x121: 0x2a, 0x122: 0x2b, 0x123: 0x2c, 0x124: 0x2d, 0x125: 0x2e, 0x126: 0x2f, 0x127: 0x30, + 0x128: 0x31, 0x129: 0x32, 0x12a: 0x33, 0x12b: 0x34, 0x12c: 0x35, 0x12d: 0x36, 0x12e: 0x37, 0x12f: 0x38, + 0x130: 0x39, 0x131: 0x3a, 0x132: 0x3b, 0x133: 0x3c, 0x134: 0x3d, 0x135: 0x3e, 0x136: 0x3f, 0x137: 0x40, + 0x138: 0x41, 0x139: 0x42, 0x13a: 0x43, 0x13b: 0x44, 0x13c: 0x45, 0x13d: 0x46, 0x13e: 0x47, 0x13f: 0x48, + // Block 0x5, offset 0x140 + 0x140: 0x49, 0x141: 0x4a, 0x142: 0x4b, 0x143: 0x4c, 0x144: 0x23, 0x145: 0x23, 0x146: 0x23, 0x147: 0x23, + 0x148: 0x23, 0x149: 0x4d, 0x14a: 0x4e, 0x14b: 0x4f, 0x14c: 0x50, 0x14d: 0x51, 0x14e: 0x52, 0x14f: 0x53, + 0x150: 0x54, 0x151: 0x23, 0x152: 0x23, 0x153: 0x23, 0x154: 0x23, 0x155: 0x23, 0x156: 0x23, 0x157: 0x23, + 0x158: 0x23, 0x159: 0x55, 0x15a: 0x56, 0x15b: 0x57, 0x15c: 0x58, 0x15d: 0x59, 0x15e: 0x5a, 0x15f: 0x5b, + 0x160: 0x5c, 0x161: 0x5d, 0x162: 0x5e, 0x163: 0x5f, 0x164: 0x60, 0x165: 0x61, 0x167: 0x62, + 0x168: 0x63, 0x169: 0x64, 0x16a: 0x65, 0x16c: 0x66, 0x16d: 0x67, 0x16e: 0x68, 0x16f: 0x69, + 0x170: 0x6a, 0x171: 0x6b, 0x172: 0x6c, 0x173: 0x6d, 0x174: 0x6e, 0x175: 0x6f, 0x176: 0x70, 0x177: 0x71, + 0x178: 0x72, 0x179: 0x72, 0x17a: 0x73, 0x17b: 0x72, 0x17c: 0x74, 0x17d: 0x08, 0x17e: 0x09, 0x17f: 0x0a, + // Block 0x6, offset 0x180 + 0x180: 0x75, 0x181: 0x76, 0x182: 0x77, 0x183: 0x78, 0x184: 0x0b, 0x185: 0x79, 0x186: 0x7a, + 0x192: 0x7b, 0x193: 0x0c, + 0x1b0: 0x7c, 0x1b1: 0x0d, 0x1b2: 0x72, 0x1b3: 0x7d, 0x1b4: 0x7e, 0x1b5: 0x7f, 0x1b6: 0x80, 0x1b7: 0x81, + 0x1b8: 0x82, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x83, 0x1c2: 0x84, 0x1c3: 0x85, 0x1c4: 0x86, 0x1c5: 0x23, 0x1c6: 0x87, + // Block 0x8, offset 0x200 + 0x200: 0x88, 0x201: 0x23, 0x202: 0x23, 0x203: 0x23, 0x204: 0x23, 0x205: 0x23, 0x206: 0x23, 0x207: 0x23, + 0x208: 0x23, 0x209: 0x23, 0x20a: 0x23, 0x20b: 0x23, 0x20c: 0x23, 0x20d: 0x23, 0x20e: 0x23, 0x20f: 0x23, + 0x210: 0x23, 0x211: 0x23, 0x212: 0x89, 0x213: 0x8a, 0x214: 0x23, 0x215: 0x23, 0x216: 0x23, 0x217: 0x23, + 0x218: 0x8b, 0x219: 0x8c, 0x21a: 0x8d, 0x21b: 0x8e, 0x21c: 0x8f, 0x21d: 0x90, 0x21e: 0x0e, 0x21f: 0x91, + 0x220: 0x92, 0x221: 0x93, 0x222: 0x23, 0x223: 0x94, 0x224: 0x95, 0x225: 0x96, 0x226: 0x97, 0x227: 0x98, + 0x228: 0x99, 0x229: 0x9a, 0x22a: 0x9b, 0x22b: 0x9c, 0x22c: 0x9d, 0x22d: 0x9e, 0x22e: 0x9f, 0x22f: 0xa0, + 0x230: 0x23, 0x231: 0x23, 0x232: 0x23, 0x233: 0x23, 0x234: 0x23, 0x235: 0x23, 0x236: 0x23, 0x237: 0x23, + 0x238: 0x23, 0x239: 0x23, 0x23a: 0x23, 0x23b: 0x23, 0x23c: 0x23, 0x23d: 0x23, 0x23e: 0x23, 0x23f: 0x23, + // Block 0x9, offset 0x240 + 0x240: 0x23, 0x241: 0x23, 0x242: 0x23, 0x243: 0x23, 0x244: 0x23, 0x245: 0x23, 0x246: 0x23, 0x247: 0x23, + 0x248: 0x23, 0x249: 0x23, 0x24a: 0x23, 0x24b: 0x23, 0x24c: 0x23, 0x24d: 0x23, 0x24e: 0x23, 0x24f: 0x23, + 0x250: 0x23, 0x251: 0x23, 0x252: 0x23, 0x253: 0x23, 0x254: 0x23, 0x255: 0x23, 0x256: 0x23, 0x257: 0x23, + 0x258: 0x23, 0x259: 0x23, 0x25a: 0x23, 0x25b: 0x23, 0x25c: 0x23, 0x25d: 0x23, 0x25e: 0x23, 0x25f: 0x23, + 0x260: 0x23, 0x261: 0x23, 0x262: 0x23, 0x263: 0x23, 0x264: 0x23, 0x265: 0x23, 0x266: 0x23, 0x267: 0x23, + 0x268: 0x23, 0x269: 0x23, 0x26a: 0x23, 0x26b: 0x23, 0x26c: 0x23, 0x26d: 0x23, 0x26e: 0x23, 0x26f: 0x23, + 0x270: 0x23, 0x271: 0x23, 0x272: 0x23, 0x273: 0x23, 0x274: 0x23, 0x275: 0x23, 0x276: 0x23, 0x277: 0x23, + 0x278: 0x23, 0x279: 0x23, 0x27a: 0x23, 0x27b: 0x23, 0x27c: 0x23, 0x27d: 0x23, 0x27e: 0x23, 0x27f: 0x23, + // Block 0xa, offset 0x280 + 0x280: 0x23, 0x281: 0x23, 0x282: 0x23, 0x283: 0x23, 0x284: 0x23, 0x285: 0x23, 0x286: 0x23, 0x287: 0x23, + 0x288: 0x23, 0x289: 0x23, 0x28a: 0x23, 0x28b: 0x23, 0x28c: 0x23, 0x28d: 0x23, 0x28e: 0x23, 0x28f: 0x23, + 0x290: 0x23, 0x291: 0x23, 0x292: 0x23, 0x293: 0x23, 0x294: 0x23, 0x295: 0x23, 0x296: 0x23, 0x297: 0x23, + 0x298: 0x23, 0x299: 0x23, 0x29a: 0x23, 0x29b: 0x23, 0x29c: 0x23, 0x29d: 0x23, 0x29e: 0xa1, 0x29f: 0xa2, + // Block 0xb, offset 0x2c0 + 0x2ec: 0x0f, 0x2ed: 0xa3, 0x2ee: 0xa4, 0x2ef: 0xa5, + 0x2f0: 0x23, 0x2f1: 0x23, 0x2f2: 0x23, 0x2f3: 0x23, 0x2f4: 0xa6, 0x2f5: 0xa7, 0x2f6: 0xa8, 0x2f7: 0xa9, + 0x2f8: 0xaa, 0x2f9: 0xab, 0x2fa: 0x23, 0x2fb: 0xac, 0x2fc: 0xad, 0x2fd: 0xae, 0x2fe: 0xaf, 0x2ff: 0xb0, + // Block 0xc, offset 0x300 + 0x300: 0xb1, 0x301: 0xb2, 0x302: 0x23, 0x303: 0xb3, 0x305: 0xb4, 0x307: 0xb5, + 0x30a: 0xb6, 0x30b: 0xb7, 0x30c: 0xb8, 0x30d: 0xb9, 0x30e: 0xba, 0x30f: 0xbb, + 0x310: 0xbc, 0x311: 0xbd, 0x312: 0xbe, 0x313: 0xbf, 0x314: 0xc0, 0x315: 0xc1, + 0x318: 0x23, 0x319: 0x23, 0x31a: 0x23, 0x31b: 0x23, 0x31c: 0xc2, 0x31d: 0xc3, + 0x320: 0xc4, 0x321: 0xc5, 0x322: 0xc6, 0x323: 0xc7, 0x324: 0xc8, 0x326: 0xc9, + 0x328: 0xca, 0x329: 0xcb, 0x32a: 0xcc, 0x32b: 0xcd, 0x32c: 0x5f, 0x32d: 0xce, 0x32e: 0xcf, + 0x330: 0x23, 0x331: 0xd0, 0x332: 0xd1, 0x333: 0xd2, + // Block 0xd, offset 0x340 + 0x340: 0xd3, 0x341: 0xd4, 0x342: 0xd5, 0x343: 0xd6, 0x344: 0xd7, 0x345: 0xd8, 0x346: 0xd9, 0x347: 0xda, + 0x348: 0xdb, 0x34a: 0xdc, 0x34b: 0xdd, 0x34c: 0xde, 0x34d: 0xdf, + 0x350: 0xe0, 0x351: 0xe1, 0x352: 0xe2, 0x353: 0xe3, 0x356: 0xe4, 0x357: 0xe5, + 0x358: 0xe6, 0x359: 0xe7, 0x35a: 0xe8, 0x35b: 0xe9, 0x35c: 0xea, + 0x362: 0xeb, 0x363: 0xec, + 0x368: 0xed, 0x369: 0xee, 0x36a: 0xef, 0x36b: 0xf0, + 0x370: 0xf1, 0x371: 0xf2, 0x372: 0xf3, 0x374: 0xf4, 0x375: 0xf5, + // Block 0xe, offset 0x380 + 0x380: 0x23, 0x381: 0x23, 0x382: 0x23, 0x383: 0x23, 0x384: 0x23, 0x385: 0x23, 0x386: 0x23, 0x387: 0x23, + 0x388: 0x23, 0x389: 0x23, 0x38a: 0x23, 0x38b: 0x23, 0x38c: 0x23, 0x38d: 0x23, 0x38e: 0xf6, + 0x390: 0x23, 0x391: 0xf7, 0x392: 0x23, 0x393: 0x23, 0x394: 0x23, 0x395: 0xf8, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x23, 0x3c1: 0x23, 0x3c2: 0x23, 0x3c3: 0x23, 0x3c4: 0x23, 0x3c5: 0x23, 0x3c6: 0x23, 0x3c7: 0x23, + 0x3c8: 0x23, 0x3c9: 0x23, 0x3ca: 0x23, 0x3cb: 0x23, 0x3cc: 0x23, 0x3cd: 0x23, 0x3ce: 0x23, 0x3cf: 0x23, + 0x3d0: 0xf7, + // Block 0x10, offset 0x400 + 0x410: 0x23, 0x411: 0x23, 0x412: 0x23, 0x413: 0x23, 0x414: 0x23, 0x415: 0x23, 0x416: 0x23, 0x417: 0x23, + 0x418: 0x23, 0x419: 0xf9, + // Block 0x11, offset 0x440 + 0x460: 0x23, 0x461: 0x23, 0x462: 0x23, 0x463: 0x23, 0x464: 0x23, 0x465: 0x23, 0x466: 0x23, 0x467: 0x23, + 0x468: 0xf0, 0x469: 0xfa, 0x46b: 0xfb, 0x46c: 0xfc, 0x46d: 0xfd, 0x46e: 0xfe, + 0x47c: 0x23, 0x47d: 0xff, 0x47e: 0x100, 0x47f: 0x101, + // Block 0x12, offset 0x480 + 0x4b0: 0x23, 0x4b1: 0x102, 0x4b2: 0x103, + // Block 0x13, offset 0x4c0 + 0x4c5: 0x104, 0x4c6: 0x105, + 0x4c9: 0x106, + 0x4d0: 0x107, 0x4d1: 0x108, 0x4d2: 0x109, 0x4d3: 0x10a, 0x4d4: 0x10b, 0x4d5: 0x10c, 0x4d6: 0x10d, 0x4d7: 0x10e, + 0x4d8: 0x10f, 0x4d9: 0x110, 0x4da: 0x111, 0x4db: 0x112, 0x4dc: 0x113, 0x4dd: 0x114, 0x4de: 0x115, 0x4df: 0x116, + 0x4e8: 0x117, 0x4e9: 0x118, 0x4ea: 0x119, + // Block 0x14, offset 0x500 + 0x500: 0x11a, + 0x520: 0x23, 0x521: 0x23, 0x522: 0x23, 0x523: 0x11b, 0x524: 0x10, 0x525: 0x11c, + 0x538: 0x11d, 0x539: 0x11, 0x53a: 0x11e, + // Block 0x15, offset 0x540 + 0x544: 0x11f, 0x545: 0x120, 0x546: 0x121, + 0x54f: 0x122, + // Block 0x16, offset 0x580 + 0x590: 0x0a, 0x591: 0x0b, 0x592: 0x0c, 0x593: 0x0d, 0x594: 0x0e, 0x596: 0x0f, + 0x59b: 0x10, 0x59d: 0x11, 0x59e: 0x12, 0x59f: 0x13, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x123, 0x5c1: 0x124, 0x5c4: 0x124, 0x5c5: 0x124, 0x5c6: 0x124, 0x5c7: 0x125, + // Block 0x18, offset 0x600 + 0x620: 0x15, +} + +// sparseOffsets: 277 entries, 554 bytes +var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x35, 0x38, 0x3c, 0x3f, 0x43, 0x4d, 0x4f, 0x54, 0x64, 0x6b, 0x70, 0x7e, 0x7f, 0x8d, 0x9c, 0xa6, 0xa9, 0xaf, 0xb7, 0xba, 0xbc, 0xca, 0xd0, 0xde, 0xe9, 0xf5, 0x100, 0x10c, 0x116, 0x122, 0x12d, 0x139, 0x145, 0x14d, 0x155, 0x15f, 0x16a, 0x176, 0x17d, 0x188, 0x18d, 0x195, 0x198, 0x19d, 0x1a1, 0x1a5, 0x1ac, 0x1b5, 0x1bd, 0x1be, 0x1c7, 0x1ce, 0x1d6, 0x1dc, 0x1e2, 0x1e7, 0x1eb, 0x1ee, 0x1f0, 0x1f3, 0x1f8, 0x1f9, 0x1fb, 0x1fd, 0x1ff, 0x206, 0x20b, 0x20f, 0x218, 0x21b, 0x21e, 0x224, 0x225, 0x230, 0x231, 0x232, 0x237, 0x244, 0x24c, 0x254, 0x25d, 0x266, 0x26f, 0x274, 0x277, 0x280, 0x28d, 0x28f, 0x296, 0x298, 0x2a4, 0x2a5, 0x2b0, 0x2b8, 0x2c0, 0x2c6, 0x2c7, 0x2d5, 0x2da, 0x2dd, 0x2e2, 0x2e6, 0x2ec, 0x2f1, 0x2f4, 0x2f9, 0x2fe, 0x2ff, 0x305, 0x307, 0x308, 0x30a, 0x30c, 0x30f, 0x310, 0x312, 0x315, 0x31b, 0x31f, 0x321, 0x326, 0x32d, 0x331, 0x33a, 0x33b, 0x343, 0x347, 0x34c, 0x354, 0x35a, 0x360, 0x36a, 0x36f, 0x378, 0x37e, 0x385, 0x389, 0x391, 0x393, 0x395, 0x398, 0x39a, 0x39c, 0x39d, 0x39e, 0x3a0, 0x3a2, 0x3a8, 0x3ad, 0x3af, 0x3b5, 0x3b8, 0x3ba, 0x3c0, 0x3c5, 0x3c7, 0x3c8, 0x3c9, 0x3ca, 0x3cc, 0x3ce, 0x3d0, 0x3d3, 0x3d5, 0x3d8, 0x3e0, 0x3e3, 0x3e7, 0x3ef, 0x3f1, 0x3f2, 0x3f3, 0x3f5, 0x3fb, 0x3fd, 0x3fe, 0x400, 0x402, 0x404, 0x411, 0x412, 0x413, 0x417, 0x419, 0x41a, 0x41b, 0x41c, 0x41d, 0x421, 0x425, 0x42b, 0x42d, 0x434, 0x437, 0x43b, 0x441, 0x44a, 0x450, 0x456, 0x460, 0x46a, 0x46c, 0x473, 0x479, 0x47f, 0x485, 0x488, 0x48e, 0x491, 0x499, 0x49a, 0x4a1, 0x4a2, 0x4a5, 0x4af, 0x4b5, 0x4bb, 0x4bc, 0x4c2, 0x4c5, 0x4cd, 0x4d4, 0x4db, 0x4dc, 0x4dd, 0x4de, 0x4df, 0x4e1, 0x4e3, 0x4e5, 0x4e9, 0x4ea, 0x4ec, 0x4ed, 0x4ee, 0x4f0, 0x4f5, 0x4fa, 0x4fe, 0x4ff, 0x502, 0x506, 0x511, 0x515, 0x51d, 0x522, 0x526, 0x529, 0x52d, 0x530, 0x533, 0x538, 0x53c, 0x540, 0x544, 0x548, 0x54a, 0x54c, 0x54f, 0x554, 0x556, 0x55b, 0x564, 0x569, 0x56a, 0x56d, 0x56e, 0x56f, 0x571, 0x572, 0x573} + +// sparseValues: 1395 entries, 5580 bytes +var sparseValues = [1395]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0004, lo: 0xa8, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xaa}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0004, lo: 0xaf, hi: 0xaf}, + {value: 0x0004, lo: 0xb4, hi: 0xb4}, + {value: 0x001a, lo: 0xb5, hi: 0xb5}, + {value: 0x0054, lo: 0xb7, hi: 0xb7}, + {value: 0x0004, lo: 0xb8, hi: 0xb8}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + // Block 0x1, offset 0x9 + {value: 0x2013, lo: 0x80, hi: 0x96}, + {value: 0x2013, lo: 0x98, hi: 0x9e}, + {value: 0x009a, lo: 0x9f, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xb6}, + {value: 0x2012, lo: 0xb8, hi: 0xbe}, + {value: 0x0252, lo: 0xbf, hi: 0xbf}, + // Block 0x2, offset 0xf + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x011b, lo: 0xb0, hi: 0xb0}, + {value: 0x019a, lo: 0xb1, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb7}, + {value: 0x0012, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x0553, lo: 0xbf, hi: 0xbf}, + // Block 0x3, offset 0x18 + {value: 0x0552, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x01da, lo: 0x89, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xb7}, + {value: 0x0253, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x028a, lo: 0xbf, hi: 0xbf}, + // Block 0x4, offset 0x24 + {value: 0x0117, lo: 0x80, hi: 0x9f}, + {value: 0x2f53, lo: 0xa0, hi: 0xa0}, + {value: 0x0012, lo: 0xa1, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xb3}, + {value: 0x0012, lo: 0xb4, hi: 0xb9}, + {value: 0x090b, lo: 0xba, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x2953, lo: 0xbd, hi: 0xbd}, + {value: 0x098b, lo: 0xbe, hi: 0xbe}, + {value: 0x0a0a, lo: 0xbf, hi: 0xbf}, + // Block 0x5, offset 0x2e + {value: 0x0015, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x97}, + {value: 0x0004, lo: 0x98, hi: 0x9d}, + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0015, lo: 0xa0, hi: 0xa4}, + {value: 0x0004, lo: 0xa5, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xbf}, + // Block 0x6, offset 0x35 + {value: 0x0024, lo: 0x80, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbf}, + // Block 0x7, offset 0x38 + {value: 0x6553, lo: 0x80, hi: 0x8f}, + {value: 0x2013, lo: 0x90, hi: 0x9f}, + {value: 0x5f53, lo: 0xa0, hi: 0xaf}, + {value: 0x2012, lo: 0xb0, hi: 0xbf}, + // Block 0x8, offset 0x3c + {value: 0x5f52, lo: 0x80, hi: 0x8f}, + {value: 0x6552, lo: 0x90, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x9, offset 0x3f + {value: 0x0117, lo: 0x80, hi: 0x81}, + {value: 0x0024, lo: 0x83, hi: 0x87}, + {value: 0x0014, lo: 0x88, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xbf}, + // Block 0xa, offset 0x43 + {value: 0x0f13, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x0316, lo: 0x89, hi: 0x8a}, + {value: 0x0716, lo: 0x8b, hi: 0x8c}, + {value: 0x0316, lo: 0x8d, hi: 0x8e}, + {value: 0x0f12, lo: 0x8f, hi: 0x8f}, + {value: 0x0117, lo: 0x90, hi: 0xbf}, + // Block 0xb, offset 0x4d + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x6553, lo: 0xb1, hi: 0xbf}, + // Block 0xc, offset 0x4f + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6853, lo: 0x90, hi: 0x96}, + {value: 0x0014, lo: 0x99, hi: 0x99}, + {value: 0x6552, lo: 0xa1, hi: 0xaf}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0xd, offset 0x54 + {value: 0x6852, lo: 0x80, hi: 0x86}, + {value: 0x198a, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x91, hi: 0x91}, + {value: 0x0024, lo: 0x92, hi: 0x95}, + {value: 0x0034, lo: 0x96, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x99}, + {value: 0x0034, lo: 0x9a, hi: 0x9b}, + {value: 0x0024, lo: 0x9c, hi: 0xa1}, + {value: 0x0034, lo: 0xa2, hi: 0xa7}, + {value: 0x0024, lo: 0xa8, hi: 0xa9}, + {value: 0x0034, lo: 0xaa, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xaf}, + {value: 0x0034, lo: 0xb0, hi: 0xbd}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xe, offset 0x64 + {value: 0x0034, lo: 0x81, hi: 0x82}, + {value: 0x0024, lo: 0x84, hi: 0x84}, + {value: 0x0034, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xb3}, + {value: 0x0054, lo: 0xb4, hi: 0xb4}, + // Block 0xf, offset 0x6b + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0024, lo: 0x90, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0014, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x10, offset 0x70 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9c}, + {value: 0x0024, lo: 0x9d, hi: 0x9e}, + {value: 0x0034, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0034, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x11, offset 0x7e + {value: 0x0010, lo: 0x80, hi: 0xbf}, + // Block 0x12, offset 0x7f + {value: 0x0010, lo: 0x80, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0024, lo: 0x9f, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xaa, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x13, offset 0x8d + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0034, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0034, lo: 0xb1, hi: 0xb1}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbd}, + {value: 0x0034, lo: 0xbe, hi: 0xbe}, + {value: 0x0024, lo: 0xbf, hi: 0xbf}, + // Block 0x14, offset 0x9c + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0024, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x88}, + {value: 0x0024, lo: 0x89, hi: 0x8a}, + {value: 0x0010, lo: 0x8d, hi: 0xbf}, + // Block 0x15, offset 0xa6 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x16, offset 0xa9 + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xb1}, + {value: 0x0034, lo: 0xb2, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + // Block 0x17, offset 0xaf + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x99}, + {value: 0x0014, lo: 0x9a, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0xa3}, + {value: 0x0014, lo: 0xa4, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xad}, + // Block 0x18, offset 0xb7 + {value: 0x0010, lo: 0x80, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0xa0, hi: 0xaa}, + // Block 0x19, offset 0xba + {value: 0x0010, lo: 0xa0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbd}, + // Block 0x1a, offset 0xbc + {value: 0x0024, lo: 0x94, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0024, lo: 0xaa, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbf}, + // Block 0x1b, offset 0xca + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1c, offset 0xd0 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0x1d, offset 0xde + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb6, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1e, offset 0xe9 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xb1}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + // Block 0x1f, offset 0xf5 + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x20, offset 0x100 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x99, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x21, offset 0x10c + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x22, offset 0x116 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x85}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xbf}, + // Block 0x23, offset 0x122 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x24, offset 0x12d + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x25, offset 0x139 + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0010, lo: 0xa8, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x26, offset 0x145 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x27, offset 0x14d + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb9}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbf}, + // Block 0x28, offset 0x155 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x88}, + {value: 0x0014, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x29, offset 0x15f + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x2a, offset 0x16a + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb2}, + // Block 0x2b, offset 0x176 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x2c, offset 0x17d + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x94, hi: 0x97}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xba, hi: 0xbf}, + // Block 0x2d, offset 0x188 + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x96}, + {value: 0x0010, lo: 0x9a, hi: 0xb1}, + {value: 0x0010, lo: 0xb3, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x2e, offset 0x18d + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x94}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9f}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + // Block 0x2f, offset 0x195 + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xba}, + // Block 0x30, offset 0x198 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x31, offset 0x19d + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xb9}, + {value: 0x0014, lo: 0xbb, hi: 0xbc}, + // Block 0x32, offset 0x1a1 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x33, offset 0x1a5 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0034, lo: 0x98, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0034, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x34, offset 0x1ac + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xac}, + {value: 0x0034, lo: 0xb1, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xba, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x35, offset 0x1b5 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0024, lo: 0x82, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x86, hi: 0x87}, + {value: 0x0010, lo: 0x88, hi: 0x8c}, + {value: 0x0014, lo: 0x8d, hi: 0x97}, + {value: 0x0014, lo: 0x99, hi: 0xbc}, + // Block 0x36, offset 0x1bd + {value: 0x0034, lo: 0x86, hi: 0x86}, + // Block 0x37, offset 0x1be + {value: 0x0010, lo: 0xab, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbe}, + // Block 0x38, offset 0x1c7 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x96, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x99}, + {value: 0x0014, lo: 0x9e, hi: 0xa0}, + {value: 0x0010, lo: 0xa2, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xad}, + {value: 0x0014, lo: 0xb1, hi: 0xb4}, + // Block 0x39, offset 0x1ce + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x6c53, lo: 0xa0, hi: 0xbf}, + // Block 0x3a, offset 0x1d6 + {value: 0x7053, lo: 0x80, hi: 0x85}, + {value: 0x7053, lo: 0x87, hi: 0x87}, + {value: 0x7053, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xba}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x3b, offset 0x1dc + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x9a, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x3c, offset 0x1e2 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x3d, offset 0x1e7 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x82, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3e, offset 0x1eb + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3f, offset 0x1ee + {value: 0x0010, lo: 0x80, hi: 0x9a}, + {value: 0x0024, lo: 0x9d, hi: 0x9f}, + // Block 0x40, offset 0x1f0 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x7453, lo: 0xa0, hi: 0xaf}, + {value: 0x7853, lo: 0xb0, hi: 0xbf}, + // Block 0x41, offset 0x1f3 + {value: 0x7c53, lo: 0x80, hi: 0x8f}, + {value: 0x8053, lo: 0x90, hi: 0x9f}, + {value: 0x7c53, lo: 0xa0, hi: 0xaf}, + {value: 0x0813, lo: 0xb0, hi: 0xb5}, + {value: 0x0892, lo: 0xb8, hi: 0xbd}, + // Block 0x42, offset 0x1f8 + {value: 0x0010, lo: 0x81, hi: 0xbf}, + // Block 0x43, offset 0x1f9 + {value: 0x0010, lo: 0x80, hi: 0xac}, + {value: 0x0010, lo: 0xaf, hi: 0xbf}, + // Block 0x44, offset 0x1fb + {value: 0x0010, lo: 0x81, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x45, offset 0x1fd + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb8}, + // Block 0x46, offset 0x1ff + {value: 0x0010, lo: 0x80, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0034, lo: 0x94, hi: 0x94}, + {value: 0x0010, lo: 0xa0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + // Block 0x47, offset 0x206 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xac}, + {value: 0x0010, lo: 0xae, hi: 0xb0}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + // Block 0x48, offset 0x20b + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x49, offset 0x20f + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x89, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0014, lo: 0x93, hi: 0x93}, + {value: 0x0004, lo: 0x97, hi: 0x97}, + {value: 0x0024, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0x4a, offset 0x218 + {value: 0x0014, lo: 0x8b, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x4b, offset 0x21b + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb7}, + // Block 0x4c, offset 0x21e + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x4d, offset 0x224 + {value: 0x0010, lo: 0x80, hi: 0xb5}, + // Block 0x4e, offset 0x225 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbb}, + // Block 0x4f, offset 0x230 + {value: 0x0010, lo: 0x86, hi: 0x8f}, + // Block 0x50, offset 0x231 + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x51, offset 0x232 + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + // Block 0x52, offset 0x237 + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x9e}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xac}, + {value: 0x0010, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xbc}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x53, offset 0x244 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xa7, hi: 0xa7}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + {value: 0x0034, lo: 0xb5, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbc}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0x54, offset 0x24c + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x55, offset 0x254 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0030, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8b}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xab, hi: 0xab}, + {value: 0x0034, lo: 0xac, hi: 0xac}, + {value: 0x0024, lo: 0xad, hi: 0xb3}, + // Block 0x56, offset 0x25d + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0030, lo: 0xaa, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbf}, + // Block 0x57, offset 0x266 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0030, lo: 0xb2, hi: 0xb3}, + // Block 0x58, offset 0x26f + {value: 0x0010, lo: 0x80, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0x59, offset 0x274 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8d, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x5a, offset 0x277 + {value: 0x1a6a, lo: 0x80, hi: 0x80}, + {value: 0x1aea, lo: 0x81, hi: 0x81}, + {value: 0x1b6a, lo: 0x82, hi: 0x82}, + {value: 0x1bea, lo: 0x83, hi: 0x83}, + {value: 0x1c6a, lo: 0x84, hi: 0x84}, + {value: 0x1cea, lo: 0x85, hi: 0x85}, + {value: 0x1d6a, lo: 0x86, hi: 0x86}, + {value: 0x1dea, lo: 0x87, hi: 0x87}, + {value: 0x1e6a, lo: 0x88, hi: 0x88}, + // Block 0x5b, offset 0x280 + {value: 0x0024, lo: 0x90, hi: 0x92}, + {value: 0x0034, lo: 0x94, hi: 0x99}, + {value: 0x0024, lo: 0x9a, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9f}, + {value: 0x0024, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0034, lo: 0xa2, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xb3}, + {value: 0x0024, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb7}, + {value: 0x0024, lo: 0xb8, hi: 0xb9}, + // Block 0x5c, offset 0x28d + {value: 0x0012, lo: 0x80, hi: 0xab}, + {value: 0x0015, lo: 0xac, hi: 0xbf}, + // Block 0x5d, offset 0x28f + {value: 0x0015, lo: 0x80, hi: 0xaa}, + {value: 0x0012, lo: 0xab, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb8}, + {value: 0x8452, lo: 0xb9, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbc}, + {value: 0x8852, lo: 0xbd, hi: 0xbd}, + {value: 0x0012, lo: 0xbe, hi: 0xbf}, + // Block 0x5e, offset 0x296 + {value: 0x0012, lo: 0x80, hi: 0x9a}, + {value: 0x0015, lo: 0x9b, hi: 0xbf}, + // Block 0x5f, offset 0x298 + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0024, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb9}, + {value: 0x0024, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbd}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x60, offset 0x2a4 + {value: 0x0117, lo: 0x80, hi: 0xbf}, + // Block 0x61, offset 0x2a5 + {value: 0x0117, lo: 0x80, hi: 0x95}, + {value: 0x1f1a, lo: 0x96, hi: 0x96}, + {value: 0x1fca, lo: 0x97, hi: 0x97}, + {value: 0x207a, lo: 0x98, hi: 0x98}, + {value: 0x212a, lo: 0x99, hi: 0x99}, + {value: 0x21da, lo: 0x9a, hi: 0x9a}, + {value: 0x228a, lo: 0x9b, hi: 0x9b}, + {value: 0x0012, lo: 0x9c, hi: 0x9d}, + {value: 0x233b, lo: 0x9e, hi: 0x9e}, + {value: 0x0012, lo: 0x9f, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x62, offset 0x2b0 + {value: 0x0812, lo: 0x80, hi: 0x87}, + {value: 0x0813, lo: 0x88, hi: 0x8f}, + {value: 0x0812, lo: 0x90, hi: 0x95}, + {value: 0x0813, lo: 0x98, hi: 0x9d}, + {value: 0x0812, lo: 0xa0, hi: 0xa7}, + {value: 0x0813, lo: 0xa8, hi: 0xaf}, + {value: 0x0812, lo: 0xb0, hi: 0xb7}, + {value: 0x0813, lo: 0xb8, hi: 0xbf}, + // Block 0x63, offset 0x2b8 + {value: 0x0004, lo: 0x8b, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8f}, + {value: 0x0054, lo: 0x98, hi: 0x99}, + {value: 0x0054, lo: 0xa4, hi: 0xa4}, + {value: 0x0054, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xaa, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xaf}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x64, offset 0x2c0 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x94, hi: 0x94}, + {value: 0x0014, lo: 0xa0, hi: 0xa4}, + {value: 0x0014, lo: 0xa6, hi: 0xaf}, + {value: 0x0015, lo: 0xb1, hi: 0xb1}, + {value: 0x0015, lo: 0xbf, hi: 0xbf}, + // Block 0x65, offset 0x2c6 + {value: 0x0015, lo: 0x90, hi: 0x9c}, + // Block 0x66, offset 0x2c7 + {value: 0x0024, lo: 0x90, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x93}, + {value: 0x0024, lo: 0x94, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0xa0}, + {value: 0x0024, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa4}, + {value: 0x0034, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa7}, + {value: 0x0034, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xa9}, + {value: 0x0034, lo: 0xaa, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + // Block 0x67, offset 0x2d5 + {value: 0x0016, lo: 0x85, hi: 0x86}, + {value: 0x0012, lo: 0x87, hi: 0x89}, + {value: 0x9d52, lo: 0x8e, hi: 0x8e}, + {value: 0x1013, lo: 0xa0, hi: 0xaf}, + {value: 0x1012, lo: 0xb0, hi: 0xbf}, + // Block 0x68, offset 0x2da + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x88}, + // Block 0x69, offset 0x2dd + {value: 0xa053, lo: 0xb6, hi: 0xb7}, + {value: 0xa353, lo: 0xb8, hi: 0xb9}, + {value: 0xa653, lo: 0xba, hi: 0xbb}, + {value: 0xa353, lo: 0xbc, hi: 0xbd}, + {value: 0xa053, lo: 0xbe, hi: 0xbf}, + // Block 0x6a, offset 0x2e2 + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6553, lo: 0x90, hi: 0x9f}, + {value: 0xa953, lo: 0xa0, hi: 0xae}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0x6b, offset 0x2e6 + {value: 0x0117, lo: 0x80, hi: 0xa3}, + {value: 0x0012, lo: 0xa4, hi: 0xa4}, + {value: 0x0716, lo: 0xab, hi: 0xac}, + {value: 0x0316, lo: 0xad, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb3}, + // Block 0x6c, offset 0x2ec + {value: 0x6c52, lo: 0x80, hi: 0x9f}, + {value: 0x7052, lo: 0xa0, hi: 0xa5}, + {value: 0x7052, lo: 0xa7, hi: 0xa7}, + {value: 0x7052, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x6d, offset 0x2f1 + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x6e, offset 0x2f4 + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0010, lo: 0xb0, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x6f, offset 0x2f9 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9e}, + {value: 0x0024, lo: 0xa0, hi: 0xbf}, + // Block 0x70, offset 0x2fe + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + // Block 0x71, offset 0x2ff + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0xaa, hi: 0xad}, + {value: 0x0030, lo: 0xae, hi: 0xaf}, + {value: 0x0004, lo: 0xb1, hi: 0xb5}, + {value: 0x0014, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + // Block 0x72, offset 0x305 + {value: 0x0034, lo: 0x99, hi: 0x9a}, + {value: 0x0004, lo: 0x9b, hi: 0x9e}, + // Block 0x73, offset 0x307 + {value: 0x0004, lo: 0xbc, hi: 0xbe}, + // Block 0x74, offset 0x308 + {value: 0x0010, lo: 0x85, hi: 0xae}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x75, offset 0x30a + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0010, lo: 0xa0, hi: 0xba}, + // Block 0x76, offset 0x30c + {value: 0x0010, lo: 0x80, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0xbf}, + // Block 0x77, offset 0x30f + {value: 0x0010, lo: 0x80, hi: 0x8c}, + // Block 0x78, offset 0x310 + {value: 0x0010, lo: 0x90, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x79, offset 0x312 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0xab}, + // Block 0x7a, offset 0x315 + {value: 0x0117, lo: 0x80, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb2}, + {value: 0x0024, lo: 0xb4, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x7b, offset 0x31b + {value: 0x0117, lo: 0x80, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9d}, + {value: 0x0024, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x7c, offset 0x31f + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb1}, + // Block 0x7d, offset 0x321 + {value: 0x0004, lo: 0x80, hi: 0x96}, + {value: 0x0014, lo: 0x97, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xaf}, + {value: 0x0012, lo: 0xb0, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xbf}, + // Block 0x7e, offset 0x326 + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x0015, lo: 0xb0, hi: 0xb0}, + {value: 0x0012, lo: 0xb1, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x8453, lo: 0xbd, hi: 0xbd}, + {value: 0x0117, lo: 0xbe, hi: 0xbf}, + // Block 0x7f, offset 0x32d + {value: 0x0010, lo: 0xb7, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbf}, + // Block 0x80, offset 0x331 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8b}, + {value: 0x0010, lo: 0x8c, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + // Block 0x81, offset 0x33a + {value: 0x0010, lo: 0x80, hi: 0xb3}, + // Block 0x82, offset 0x33b + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xa0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb7}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x83, offset 0x343 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x84, offset 0x347 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0x92}, + {value: 0x0030, lo: 0x93, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0x85, offset 0x34c + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb9}, + {value: 0x0010, lo: 0xba, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x86, offset 0x354 + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0004, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x87, offset 0x35a + {value: 0x0010, lo: 0x80, hi: 0xa8}, + {value: 0x0014, lo: 0xa9, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0x88, offset 0x360 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x89, offset 0x36a + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0024, lo: 0xbe, hi: 0xbf}, + // Block 0x8a, offset 0x36f + {value: 0x0024, lo: 0x81, hi: 0x81}, + {value: 0x0004, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + // Block 0x8b, offset 0x378 + {value: 0x0010, lo: 0x81, hi: 0x86}, + {value: 0x0010, lo: 0x89, hi: 0x8e}, + {value: 0x0010, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x8c, offset 0x37e + {value: 0x0012, lo: 0x80, hi: 0x92}, + {value: 0xac52, lo: 0x93, hi: 0x93}, + {value: 0x0012, lo: 0x94, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9f}, + {value: 0x0012, lo: 0xa0, hi: 0xa5}, + {value: 0x74d2, lo: 0xb0, hi: 0xbf}, + // Block 0x8d, offset 0x385 + {value: 0x78d2, lo: 0x80, hi: 0x8f}, + {value: 0x7cd2, lo: 0x90, hi: 0x9f}, + {value: 0x80d2, lo: 0xa0, hi: 0xaf}, + {value: 0x7cd2, lo: 0xb0, hi: 0xbf}, + // Block 0x8e, offset 0x389 + {value: 0x0010, lo: 0x80, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x8f, offset 0x391 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x90, offset 0x393 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x8b, hi: 0xbb}, + // Block 0x91, offset 0x395 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0xbf}, + // Block 0x92, offset 0x398 + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0004, lo: 0xb2, hi: 0xbf}, + // Block 0x93, offset 0x39a + {value: 0x0004, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x93, hi: 0xbf}, + // Block 0x94, offset 0x39c + {value: 0x0010, lo: 0x80, hi: 0xbd}, + // Block 0x95, offset 0x39d + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0x96, offset 0x39e + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0xbf}, + // Block 0x97, offset 0x3a0 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0xb0, hi: 0xbb}, + // Block 0x98, offset 0x3a2 + {value: 0x0014, lo: 0x80, hi: 0x8f}, + {value: 0x0054, lo: 0x93, hi: 0x93}, + {value: 0x0024, lo: 0xa0, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xad}, + {value: 0x0024, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + // Block 0x99, offset 0x3a8 + {value: 0x0010, lo: 0x8d, hi: 0x8f}, + {value: 0x0054, lo: 0x92, hi: 0x92}, + {value: 0x0054, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0xb0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0x9a, offset 0x3ad + {value: 0x0010, lo: 0x80, hi: 0xbc}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x9b, offset 0x3af + {value: 0x0054, lo: 0x87, hi: 0x87}, + {value: 0x0054, lo: 0x8e, hi: 0x8e}, + {value: 0x0054, lo: 0x9a, hi: 0x9a}, + {value: 0x5f53, lo: 0xa1, hi: 0xba}, + {value: 0x0004, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9c, offset 0x3b5 + {value: 0x0004, lo: 0x80, hi: 0x80}, + {value: 0x5f52, lo: 0x81, hi: 0x9a}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + // Block 0x9d, offset 0x3b8 + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbe}, + // Block 0x9e, offset 0x3ba + {value: 0x0010, lo: 0x82, hi: 0x87}, + {value: 0x0010, lo: 0x8a, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0x97}, + {value: 0x0010, lo: 0x9a, hi: 0x9c}, + {value: 0x0004, lo: 0xa3, hi: 0xa3}, + {value: 0x0014, lo: 0xb9, hi: 0xbb}, + // Block 0x9f, offset 0x3c0 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0010, lo: 0x8d, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xba}, + {value: 0x0010, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xa0, offset 0x3c5 + {value: 0x0010, lo: 0x80, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x9d}, + // Block 0xa1, offset 0x3c7 + {value: 0x0010, lo: 0x80, hi: 0xba}, + // Block 0xa2, offset 0x3c8 + {value: 0x0010, lo: 0x80, hi: 0xb4}, + // Block 0xa3, offset 0x3c9 + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0xa4, offset 0x3ca + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa5, offset 0x3cc + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + // Block 0xa6, offset 0x3ce + {value: 0x0010, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xad, hi: 0xbf}, + // Block 0xa7, offset 0x3d0 + {value: 0x0010, lo: 0x80, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0xb5}, + {value: 0x0024, lo: 0xb6, hi: 0xba}, + // Block 0xa8, offset 0x3d3 + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa9, offset 0x3d5 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x91, hi: 0x95}, + // Block 0xaa, offset 0x3d8 + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x97}, + {value: 0xaf53, lo: 0x98, hi: 0x9f}, + {value: 0xb253, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbf}, + // Block 0xab, offset 0x3e0 + {value: 0xaf52, lo: 0x80, hi: 0x87}, + {value: 0xb252, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0xac, offset 0x3e3 + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0xb253, lo: 0xb0, hi: 0xb7}, + {value: 0xaf53, lo: 0xb8, hi: 0xbf}, + // Block 0xad, offset 0x3e7 + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x93}, + {value: 0xb252, lo: 0x98, hi: 0x9f}, + {value: 0xaf52, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbb}, + // Block 0xae, offset 0x3ef + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xaf, offset 0x3f1 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + // Block 0xb0, offset 0x3f2 + {value: 0x0010, lo: 0x80, hi: 0xb6}, + // Block 0xb1, offset 0x3f3 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xa7}, + // Block 0xb2, offset 0x3f5 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xb5}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xb3, offset 0x3fb + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb6}, + // Block 0xb4, offset 0x3fd + {value: 0x0010, lo: 0x80, hi: 0x9e}, + // Block 0xb5, offset 0x3fe + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + // Block 0xb6, offset 0x400 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb9}, + // Block 0xb7, offset 0x402 + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0xb8, offset 0x404 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x8e, hi: 0x8e}, + {value: 0x0024, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x99, hi: 0xb3}, + {value: 0x0024, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xb9, offset 0x411 + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0xba, offset 0x412 + {value: 0x0010, lo: 0x80, hi: 0x9c}, + // Block 0xbb, offset 0x413 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + // Block 0xbc, offset 0x417 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + // Block 0xbd, offset 0x419 + {value: 0x0010, lo: 0x80, hi: 0x91}, + // Block 0xbe, offset 0x41a + {value: 0x0010, lo: 0x80, hi: 0x88}, + // Block 0xbf, offset 0x41b + {value: 0x5653, lo: 0x80, hi: 0xb2}, + // Block 0xc0, offset 0x41c + {value: 0x5652, lo: 0x80, hi: 0xb2}, + // Block 0xc1, offset 0x41d + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xc2, offset 0x421 + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xc3, offset 0x425 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb6}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + // Block 0xc4, offset 0x42b + {value: 0x0010, lo: 0x90, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xc5, offset 0x42d + {value: 0x0024, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0xc6, offset 0x434 + {value: 0x0010, lo: 0x90, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + // Block 0xc7, offset 0x437 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xc8, offset 0x43b + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + // Block 0xc9, offset 0x441 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb4}, + {value: 0x0030, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xb7}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0xca, offset 0x44a + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xcb, offset 0x450 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa2}, + {value: 0x0014, lo: 0xa3, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xcc, offset 0x456 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xcd, offset 0x460 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0030, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9d, hi: 0xa3}, + {value: 0x0024, lo: 0xa6, hi: 0xac}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + // Block 0xce, offset 0x46a + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xcf, offset 0x46c + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd0, offset 0x473 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xd1, offset 0x479 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd2, offset 0x47f + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd3, offset 0x485 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x98, hi: 0x9b}, + {value: 0x0014, lo: 0x9c, hi: 0x9d}, + // Block 0xd4, offset 0x488 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd5, offset 0x48e + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd6, offset 0x491 + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0014, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb5}, + {value: 0x0030, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0xd7, offset 0x499 + {value: 0x0010, lo: 0x80, hi: 0x89}, + // Block 0xd8, offset 0x49a + {value: 0x0014, lo: 0x9d, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xd9, offset 0x4a1 + {value: 0x5f53, lo: 0xa0, hi: 0xbf}, + // Block 0xda, offset 0x4a2 + {value: 0x5f52, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xdb, offset 0x4a5 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x89, hi: 0x8a}, + {value: 0x0010, lo: 0x8b, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbb, hi: 0xbe}, + // Block 0xdc, offset 0x4af + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0014, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x98}, + {value: 0x0014, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0x9c, hi: 0xbf}, + // Block 0xdd, offset 0x4b5 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x86, hi: 0x89}, + {value: 0x0014, lo: 0x8a, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x99}, + // Block 0xde, offset 0x4bb + {value: 0x0010, lo: 0x80, hi: 0xb8}, + // Block 0xdf, offset 0x4bc + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb6}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xe0, offset 0x4c2 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0xe1, offset 0x4c5 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0014, lo: 0x92, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xa9}, + {value: 0x0014, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0xe2, offset 0x4cd + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb6}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xe3, offset 0x4d4 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xe4, offset 0x4db + {value: 0x0010, lo: 0x80, hi: 0x99}, + // Block 0xe5, offset 0x4dc + {value: 0x0010, lo: 0x80, hi: 0xae}, + // Block 0xe6, offset 0x4dd + {value: 0x0010, lo: 0x80, hi: 0x83}, + // Block 0xe7, offset 0x4de + {value: 0x0010, lo: 0x80, hi: 0x86}, + // Block 0xe8, offset 0x4df + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0xe9, offset 0x4e1 + {value: 0x0010, lo: 0x90, hi: 0xad}, + {value: 0x0034, lo: 0xb0, hi: 0xb4}, + // Block 0xea, offset 0x4e3 + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb6}, + // Block 0xeb, offset 0x4e5 + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa3, hi: 0xb7}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xec, offset 0x4e9 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + // Block 0xed, offset 0x4ea + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0xbe}, + // Block 0xee, offset 0x4ec + {value: 0x0014, lo: 0x8f, hi: 0x9f}, + // Block 0xef, offset 0x4ed + {value: 0x0014, lo: 0xa0, hi: 0xa1}, + // Block 0xf0, offset 0x4ee + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbc}, + // Block 0xf1, offset 0x4f0 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0034, lo: 0x9e, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa3}, + // Block 0xf2, offset 0x4f5 + {value: 0x0030, lo: 0xa5, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xa9}, + {value: 0x0030, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbf}, + // Block 0xf3, offset 0x4fa + {value: 0x0034, lo: 0x80, hi: 0x82}, + {value: 0x0024, lo: 0x85, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8b}, + {value: 0x0024, lo: 0xaa, hi: 0xad}, + // Block 0xf4, offset 0x4fe + {value: 0x0024, lo: 0x82, hi: 0x84}, + // Block 0xf5, offset 0x4ff + {value: 0x0013, lo: 0x80, hi: 0x99}, + {value: 0x0012, lo: 0x9a, hi: 0xb3}, + {value: 0x0013, lo: 0xb4, hi: 0xbf}, + // Block 0xf6, offset 0x502 + {value: 0x0013, lo: 0x80, hi: 0x8d}, + {value: 0x0012, lo: 0x8e, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0xa7}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0xf7, offset 0x506 + {value: 0x0013, lo: 0x80, hi: 0x81}, + {value: 0x0012, lo: 0x82, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0x9c}, + {value: 0x0013, lo: 0x9e, hi: 0x9f}, + {value: 0x0013, lo: 0xa2, hi: 0xa2}, + {value: 0x0013, lo: 0xa5, hi: 0xa6}, + {value: 0x0013, lo: 0xa9, hi: 0xac}, + {value: 0x0013, lo: 0xae, hi: 0xb5}, + {value: 0x0012, lo: 0xb6, hi: 0xb9}, + {value: 0x0012, lo: 0xbb, hi: 0xbb}, + {value: 0x0012, lo: 0xbd, hi: 0xbf}, + // Block 0xf8, offset 0x511 + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0012, lo: 0x85, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0xf9, offset 0x515 + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0013, lo: 0x84, hi: 0x85}, + {value: 0x0013, lo: 0x87, hi: 0x8a}, + {value: 0x0013, lo: 0x8d, hi: 0x94}, + {value: 0x0013, lo: 0x96, hi: 0x9c}, + {value: 0x0012, lo: 0x9e, hi: 0xb7}, + {value: 0x0013, lo: 0xb8, hi: 0xb9}, + {value: 0x0013, lo: 0xbb, hi: 0xbe}, + // Block 0xfa, offset 0x51d + {value: 0x0013, lo: 0x80, hi: 0x84}, + {value: 0x0013, lo: 0x86, hi: 0x86}, + {value: 0x0013, lo: 0x8a, hi: 0x90}, + {value: 0x0012, lo: 0x92, hi: 0xab}, + {value: 0x0013, lo: 0xac, hi: 0xbf}, + // Block 0xfb, offset 0x522 + {value: 0x0013, lo: 0x80, hi: 0x85}, + {value: 0x0012, lo: 0x86, hi: 0x9f}, + {value: 0x0013, lo: 0xa0, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbf}, + // Block 0xfc, offset 0x526 + {value: 0x0012, lo: 0x80, hi: 0x93}, + {value: 0x0013, lo: 0x94, hi: 0xad}, + {value: 0x0012, lo: 0xae, hi: 0xbf}, + // Block 0xfd, offset 0x529 + {value: 0x0012, lo: 0x80, hi: 0x87}, + {value: 0x0013, lo: 0x88, hi: 0xa1}, + {value: 0x0012, lo: 0xa2, hi: 0xbb}, + {value: 0x0013, lo: 0xbc, hi: 0xbf}, + // Block 0xfe, offset 0x52d + {value: 0x0013, lo: 0x80, hi: 0x95}, + {value: 0x0012, lo: 0x96, hi: 0xaf}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0xff, offset 0x530 + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0012, lo: 0x8a, hi: 0xa5}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0x100, offset 0x533 + {value: 0x0013, lo: 0x80, hi: 0x80}, + {value: 0x0012, lo: 0x82, hi: 0x9a}, + {value: 0x0012, lo: 0x9c, hi: 0xa1}, + {value: 0x0013, lo: 0xa2, hi: 0xba}, + {value: 0x0012, lo: 0xbc, hi: 0xbf}, + // Block 0x101, offset 0x538 + {value: 0x0012, lo: 0x80, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0xb4}, + {value: 0x0012, lo: 0xb6, hi: 0xbf}, + // Block 0x102, offset 0x53c + {value: 0x0012, lo: 0x80, hi: 0x8e}, + {value: 0x0012, lo: 0x90, hi: 0x95}, + {value: 0x0013, lo: 0x96, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x103, offset 0x540 + {value: 0x0012, lo: 0x80, hi: 0x88}, + {value: 0x0012, lo: 0x8a, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0x104, offset 0x544 + {value: 0x0012, lo: 0x80, hi: 0x82}, + {value: 0x0012, lo: 0x84, hi: 0x89}, + {value: 0x0017, lo: 0x8a, hi: 0x8b}, + {value: 0x0010, lo: 0x8e, hi: 0xbf}, + // Block 0x105, offset 0x548 + {value: 0x0014, lo: 0x80, hi: 0xb6}, + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x106, offset 0x54a + {value: 0x0014, lo: 0x80, hi: 0xac}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x107, offset 0x54c + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x9b, hi: 0x9f}, + {value: 0x0014, lo: 0xa1, hi: 0xaf}, + // Block 0x108, offset 0x54f + {value: 0x0024, lo: 0x80, hi: 0x86}, + {value: 0x0024, lo: 0x88, hi: 0x98}, + {value: 0x0024, lo: 0x9b, hi: 0xa1}, + {value: 0x0024, lo: 0xa3, hi: 0xa4}, + {value: 0x0024, lo: 0xa6, hi: 0xaa}, + // Block 0x109, offset 0x554 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0034, lo: 0x90, hi: 0x96}, + // Block 0x10a, offset 0x556 + {value: 0xb552, lo: 0x80, hi: 0x81}, + {value: 0xb852, lo: 0x82, hi: 0x83}, + {value: 0x0024, lo: 0x84, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x10b, offset 0x55b + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x9f}, + {value: 0x0010, lo: 0xa1, hi: 0xa2}, + {value: 0x0010, lo: 0xa4, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb7}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + // Block 0x10c, offset 0x564 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x9b}, + {value: 0x0010, lo: 0xa1, hi: 0xa3}, + {value: 0x0010, lo: 0xa5, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xbb}, + // Block 0x10d, offset 0x569 + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x10e, offset 0x56a + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x10f, offset 0x56d + {value: 0x0013, lo: 0x80, hi: 0x89}, + // Block 0x110, offset 0x56e + {value: 0x0004, lo: 0xbb, hi: 0xbf}, + // Block 0x111, offset 0x56f + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0014, lo: 0xa0, hi: 0xbf}, + // Block 0x112, offset 0x571 + {value: 0x0014, lo: 0x80, hi: 0xbf}, + // Block 0x113, offset 0x572 + {value: 0x0014, lo: 0x80, hi: 0xaf}, +} + +// Total table size 14177 bytes (13KiB); checksum: F17D40E8 diff --git a/vendor/golang.org/x/text/cases/tables11.0.0.go b/vendor/golang.org/x/text/cases/tables11.0.0.go new file mode 100644 index 0000000..b1106b4 --- /dev/null +++ b/vendor/golang.org/x/text/cases/tables11.0.0.go @@ -0,0 +1,2317 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.13 && !go1.14 +// +build go1.13,!go1.14 + +package cases + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "11.0.0" + +var xorData string = "" + // Size: 188 bytes + "\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" + + "\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" + + "\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" + + "\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" + + "\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" + + "\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" + + "\x0b!\x10\x00\x0b!0\x001\x00\x00\x0b(\x04\x00\x03\x04\x1e\x00\x03\x0a" + + "\x00\x02:\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<\x00\x01&" + + "\x00\x01*\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x01\x1e\x00" + + "\x01\x22" + +var exceptions string = "" + // Size: 2436 bytes + "\x00\x12\x12μΜΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x09II\x13\x1bʼnʼNʼN\x11" + + "\x09sSS\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ\x10\x12LJLj" + + "\x12\x12njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x1bǰJ̌J̌\x12\x12dzdzDz\x12\x12dzdzDZ\x10" + + "\x12DZDz\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x1bⱾⱾ\x10\x1bⱿⱿ\x10\x1bⱯⱯ\x10\x1bⱭⱭ\x10" + + "\x1bⱰⱰ\x10\x1bꞫꞫ\x10\x1bꞬꞬ\x10\x1bꞍꞍ\x10\x1bꞪꞪ\x10\x1bꞮꞮ\x10\x1bⱢⱢ\x10" + + "\x1bꞭꞭ\x10\x1bⱮⱮ\x10\x1bⱤⱤ\x10\x1bꞱꞱ\x10\x1bꞲꞲ\x10\x1bꞰꞰ2\x12ιΙΙ\x166ΐ" + + "Ϊ́Ϊ́\x166ΰΫ́Ϋ́\x12\x12σΣΣ\x12\x12βΒΒ\x12\x12θΘΘ\x12\x12φΦΦ\x12" + + "\x12πΠΠ\x12\x12κΚΚ\x12\x12ρΡΡ\x12\x12εΕΕ\x14$եւԵՒԵւ\x10\x1bᲐა\x10\x1bᲑბ" + + "\x10\x1bᲒგ\x10\x1bᲓდ\x10\x1bᲔე\x10\x1bᲕვ\x10\x1bᲖზ\x10\x1bᲗთ\x10\x1bᲘი" + + "\x10\x1bᲙკ\x10\x1bᲚლ\x10\x1bᲛმ\x10\x1bᲜნ\x10\x1bᲝო\x10\x1bᲞპ\x10\x1bᲟჟ" + + "\x10\x1bᲠრ\x10\x1bᲡს\x10\x1bᲢტ\x10\x1bᲣუ\x10\x1bᲤფ\x10\x1bᲥქ\x10\x1bᲦღ" + + "\x10\x1bᲧყ\x10\x1bᲨშ\x10\x1bᲩჩ\x10\x1bᲪც\x10\x1bᲫძ\x10\x1bᲬწ\x10\x1bᲭჭ" + + "\x10\x1bᲮხ\x10\x1bᲯჯ\x10\x1bᲰჰ\x10\x1bᲱჱ\x10\x1bᲲჲ\x10\x1bᲳჳ\x10\x1bᲴჴ" + + "\x10\x1bᲵჵ\x10\x1bᲶჶ\x10\x1bᲷჷ\x10\x1bᲸჸ\x10\x1bᲹჹ\x10\x1bᲺჺ\x10\x1bᲽჽ" + + "\x10\x1bᲾჾ\x10\x1bᲿჿ\x12\x12вВВ\x12\x12дДД\x12\x12оОО\x12\x12сСС\x12\x12" + + "тТТ\x12\x12тТТ\x12\x12ъЪЪ\x12\x12ѣѢѢ\x13\x1bꙋꙊꙊ\x13\x1bẖH̱H̱\x13\x1bẗ" + + "T̈T̈\x13\x1bẘW̊W̊\x13\x1bẙY̊Y̊\x13\x1baʾAʾAʾ\x13\x1bṡṠṠ\x12\x10ssß\x14" + + "$ὐΥ̓Υ̓\x166ὒΥ̓̀Υ̓̀\x166ὔΥ̓́Υ̓́\x166ὖΥ̓͂Υ̓͂\x15+ἀιἈΙᾈ\x15+ἁιἉΙᾉ" + + "\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ\x15\x1dἀιᾀἈ" + + "Ι\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ\x15\x1dἄιᾄἌΙ\x15\x1dἅιᾅἍΙ\x15" + + "\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ\x15+ἢιἪΙᾚ\x15+ἣιἫΙᾛ\x15+ἤιἬΙᾜ" + + "\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨΙ\x15\x1dἡιᾑἩΙ\x15\x1dἢιᾒἪΙ" + + "\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15\x1dἦιᾖἮΙ\x15\x1dἧιᾗἯΙ\x15+ὠι" + + "ὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ\x15+ὥιὭΙᾭ\x15+ὦιὮΙᾮ\x15+ὧι" + + "ὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ\x15\x1dὣιᾣὫΙ\x15\x1dὤιᾤὬΙ" + + "\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰιᾺΙᾺͅ\x14#αιΑΙᾼ\x14$άιΆΙΆͅ" + + "\x14$ᾶΑ͂Α͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12\x12ιΙΙ\x15-ὴιῊΙῊͅ\x14#ηιΗΙῌ" + + "\x14$ήιΉΙΉͅ\x14$ῆΗ͂Η͂\x166ῆιΗ͂Ιῌ͂\x14\x1cηιῃΗΙ\x166ῒΪ̀Ϊ̀\x166ΐΙ" + + "̈́Ϊ́\x14$ῖΙ͂Ι͂\x166ῗΪ͂Ϊ͂\x166ῢΫ̀Ϋ̀\x166ΰΫ́Ϋ́\x14$ῤΡ̓Ρ̓" + + "\x14$ῦΥ͂Υ͂\x166ῧΫ͂Ϋ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙῼ\x14$ώιΏΙΏͅ\x14$ῶΩ͂Ω͂\x16" + + "6ῶιΩ͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk\x12\x10åå\x12\x10ɫɫ\x12\x10ɽ" + + "ɽ\x10\x12ȺȺ\x10\x12ȾȾ\x12\x10ɑɑ\x12\x10ɱɱ\x12\x10ɐɐ\x12\x10ɒɒ\x12\x10ȿȿ" + + "\x12\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ\x12\x10ɡɡ\x12\x10ɬɬ\x12\x10ɪɪ" + + "\x12\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x12ffFFFf\x12\x12fiFIFi\x12\x12flFLFl" + + "\x13\x1bffiFFIFfi\x13\x1bfflFFLFfl\x12\x12stSTSt\x12\x12stSTSt\x14$մնՄՆՄ" + + "ն\x14$մեՄԵՄե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄԽՄխ" + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// caseTrie. Total size: 12250 bytes (11.96 KiB). Checksum: 53ff6cb7321675e1. +type caseTrie struct{} + +func newCaseTrie(i int) *caseTrie { + return &caseTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *caseTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 20: + return uint16(caseValues[n<<6+uint32(b)]) + default: + n -= 20 + return uint16(sparse.lookup(n, b)) + } +} + +// caseValues: 22 blocks, 1408 entries, 2816 bytes +// The third block is the zero block. +var caseValues = [1408]uint16{ + // Block 0x0, offset 0x0 + 0x27: 0x0054, + 0x2e: 0x0054, + 0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010, + 0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054, + // Block 0x1, offset 0x40 + 0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013, + 0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013, + 0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013, + 0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013, + 0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013, + 0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012, + 0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012, + 0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012, + 0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012, + 0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112, + 0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713, + 0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313, + 0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653, + 0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x0012, 0xdc: 0x1d53, 0xdd: 0x2c53, + 0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112, + 0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853, + 0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13, + 0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313, + 0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010, + 0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452, + // Block 0x4, offset 0x100 + 0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x02db, 0x105: 0x0359, + 0x106: 0x03da, 0x107: 0x043b, 0x108: 0x04b9, 0x109: 0x053a, 0x10a: 0x059b, 0x10b: 0x0619, + 0x10c: 0x069a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313, + 0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13, + 0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452, + 0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112, + 0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112, + 0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112, + 0x130: 0x06fa, 0x131: 0x07ab, 0x132: 0x0829, 0x133: 0x08aa, 0x134: 0x0113, 0x135: 0x0112, + 0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112, + 0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112, + // Block 0x5, offset 0x140 + 0x140: 0x0a8a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53, + 0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112, + 0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x0b0a, 0x151: 0x0b8a, + 0x152: 0x0c0a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152, + 0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x0c8a, 0x15d: 0x0012, + 0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x0d0a, 0x162: 0x0012, 0x163: 0x2052, + 0x164: 0x0012, 0x165: 0x0d8a, 0x166: 0x0e0a, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652, + 0x16a: 0x0e8a, 0x16b: 0x0f0a, 0x16c: 0x0f8a, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52, + 0x170: 0x0012, 0x171: 0x100a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252, + 0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012, + 0x17c: 0x0012, 0x17d: 0x108a, 0x17e: 0x0012, 0x17f: 0x0012, + // Block 0x6, offset 0x180 + 0x180: 0x3552, 0x181: 0x0012, 0x182: 0x0012, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012, + 0x186: 0x0012, 0x187: 0x110a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52, + 0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012, + 0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0012, 0x196: 0x0012, 0x197: 0x0012, + 0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x118a, + 0x19e: 0x120a, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012, + 0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012, + 0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012, + 0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015, + 0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014, + 0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x128d, + 0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024, + 0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024, + 0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024, + 0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034, + 0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024, + 0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024, + 0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024, + 0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004, + 0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52, + 0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353, + // Block 0x8, offset 0x200 + 0x204: 0x0004, 0x205: 0x0004, + 0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513, + 0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x130a, 0x211: 0x2013, + 0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013, + 0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013, + 0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53, + 0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53, + 0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512, + 0x230: 0x144a, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012, + 0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012, + 0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012, + // Block 0x9, offset 0x240 + 0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x158a, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52, + 0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52, + 0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x160a, 0x251: 0x168a, + 0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x170a, 0x256: 0x178a, 0x257: 0x1812, + 0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112, + 0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112, + 0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112, + 0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112, + 0x270: 0x180a, 0x271: 0x188a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x190a, + 0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112, + 0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053, + // Block 0xa, offset 0x280 + 0x280: 0x6852, 0x281: 0x6852, 0x282: 0x6852, 0x283: 0x6852, 0x284: 0x6852, 0x285: 0x6852, + 0x286: 0x6852, 0x287: 0x198a, 0x288: 0x0012, + 0x291: 0x0034, + 0x292: 0x0024, 0x293: 0x0024, 0x294: 0x0024, 0x295: 0x0024, 0x296: 0x0034, 0x297: 0x0024, + 0x298: 0x0024, 0x299: 0x0024, 0x29a: 0x0034, 0x29b: 0x0034, 0x29c: 0x0024, 0x29d: 0x0024, + 0x29e: 0x0024, 0x29f: 0x0024, 0x2a0: 0x0024, 0x2a1: 0x0024, 0x2a2: 0x0034, 0x2a3: 0x0034, + 0x2a4: 0x0034, 0x2a5: 0x0034, 0x2a6: 0x0034, 0x2a7: 0x0034, 0x2a8: 0x0024, 0x2a9: 0x0024, + 0x2aa: 0x0034, 0x2ab: 0x0024, 0x2ac: 0x0024, 0x2ad: 0x0034, 0x2ae: 0x0034, 0x2af: 0x0024, + 0x2b0: 0x0034, 0x2b1: 0x0034, 0x2b2: 0x0034, 0x2b3: 0x0034, 0x2b4: 0x0034, 0x2b5: 0x0034, + 0x2b6: 0x0034, 0x2b7: 0x0034, 0x2b8: 0x0034, 0x2b9: 0x0034, 0x2ba: 0x0034, 0x2bb: 0x0034, + 0x2bc: 0x0034, 0x2bd: 0x0034, 0x2bf: 0x0034, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x7053, 0x2c1: 0x7053, 0x2c2: 0x7053, 0x2c3: 0x7053, 0x2c4: 0x7053, 0x2c5: 0x7053, + 0x2c7: 0x7053, + 0x2cd: 0x7053, 0x2d0: 0x1a6a, 0x2d1: 0x1aea, + 0x2d2: 0x1b6a, 0x2d3: 0x1bea, 0x2d4: 0x1c6a, 0x2d5: 0x1cea, 0x2d6: 0x1d6a, 0x2d7: 0x1dea, + 0x2d8: 0x1e6a, 0x2d9: 0x1eea, 0x2da: 0x1f6a, 0x2db: 0x1fea, 0x2dc: 0x206a, 0x2dd: 0x20ea, + 0x2de: 0x216a, 0x2df: 0x21ea, 0x2e0: 0x226a, 0x2e1: 0x22ea, 0x2e2: 0x236a, 0x2e3: 0x23ea, + 0x2e4: 0x246a, 0x2e5: 0x24ea, 0x2e6: 0x256a, 0x2e7: 0x25ea, 0x2e8: 0x266a, 0x2e9: 0x26ea, + 0x2ea: 0x276a, 0x2eb: 0x27ea, 0x2ec: 0x286a, 0x2ed: 0x28ea, 0x2ee: 0x296a, 0x2ef: 0x29ea, + 0x2f0: 0x2a6a, 0x2f1: 0x2aea, 0x2f2: 0x2b6a, 0x2f3: 0x2bea, 0x2f4: 0x2c6a, 0x2f5: 0x2cea, + 0x2f6: 0x2d6a, 0x2f7: 0x2dea, 0x2f8: 0x2e6a, 0x2f9: 0x2eea, 0x2fa: 0x2f6a, + 0x2fc: 0x0014, 0x2fd: 0x2fea, 0x2fe: 0x306a, 0x2ff: 0x30ea, + // Block 0xc, offset 0x300 + 0x300: 0x0812, 0x301: 0x0812, 0x302: 0x0812, 0x303: 0x0812, 0x304: 0x0812, 0x305: 0x0812, + 0x308: 0x0813, 0x309: 0x0813, 0x30a: 0x0813, 0x30b: 0x0813, + 0x30c: 0x0813, 0x30d: 0x0813, 0x310: 0x3a9a, 0x311: 0x0812, + 0x312: 0x3b7a, 0x313: 0x0812, 0x314: 0x3cba, 0x315: 0x0812, 0x316: 0x3dfa, 0x317: 0x0812, + 0x319: 0x0813, 0x31b: 0x0813, 0x31d: 0x0813, + 0x31f: 0x0813, 0x320: 0x0812, 0x321: 0x0812, 0x322: 0x0812, 0x323: 0x0812, + 0x324: 0x0812, 0x325: 0x0812, 0x326: 0x0812, 0x327: 0x0812, 0x328: 0x0813, 0x329: 0x0813, + 0x32a: 0x0813, 0x32b: 0x0813, 0x32c: 0x0813, 0x32d: 0x0813, 0x32e: 0x0813, 0x32f: 0x0813, + 0x330: 0x8e52, 0x331: 0x8e52, 0x332: 0x9152, 0x333: 0x9152, 0x334: 0x9452, 0x335: 0x9452, + 0x336: 0x9752, 0x337: 0x9752, 0x338: 0x9a52, 0x339: 0x9a52, 0x33a: 0x9d52, 0x33b: 0x9d52, + 0x33c: 0x4d52, 0x33d: 0x4d52, + // Block 0xd, offset 0x340 + 0x340: 0x3f3a, 0x341: 0x402a, 0x342: 0x411a, 0x343: 0x420a, 0x344: 0x42fa, 0x345: 0x43ea, + 0x346: 0x44da, 0x347: 0x45ca, 0x348: 0x46b9, 0x349: 0x47a9, 0x34a: 0x4899, 0x34b: 0x4989, + 0x34c: 0x4a79, 0x34d: 0x4b69, 0x34e: 0x4c59, 0x34f: 0x4d49, 0x350: 0x4e3a, 0x351: 0x4f2a, + 0x352: 0x501a, 0x353: 0x510a, 0x354: 0x51fa, 0x355: 0x52ea, 0x356: 0x53da, 0x357: 0x54ca, + 0x358: 0x55b9, 0x359: 0x56a9, 0x35a: 0x5799, 0x35b: 0x5889, 0x35c: 0x5979, 0x35d: 0x5a69, + 0x35e: 0x5b59, 0x35f: 0x5c49, 0x360: 0x5d3a, 0x361: 0x5e2a, 0x362: 0x5f1a, 0x363: 0x600a, + 0x364: 0x60fa, 0x365: 0x61ea, 0x366: 0x62da, 0x367: 0x63ca, 0x368: 0x64b9, 0x369: 0x65a9, + 0x36a: 0x6699, 0x36b: 0x6789, 0x36c: 0x6879, 0x36d: 0x6969, 0x36e: 0x6a59, 0x36f: 0x6b49, + 0x370: 0x0812, 0x371: 0x0812, 0x372: 0x6c3a, 0x373: 0x6d4a, 0x374: 0x6e1a, + 0x376: 0x6efa, 0x377: 0x6fda, 0x378: 0x0813, 0x379: 0x0813, 0x37a: 0x8e53, 0x37b: 0x8e53, + 0x37c: 0x7119, 0x37d: 0x0004, 0x37e: 0x71ea, 0x37f: 0x0004, + // Block 0xe, offset 0x380 + 0x380: 0x0004, 0x381: 0x0004, 0x382: 0x726a, 0x383: 0x737a, 0x384: 0x744a, + 0x386: 0x752a, 0x387: 0x760a, 0x388: 0x9153, 0x389: 0x9153, 0x38a: 0x9453, 0x38b: 0x9453, + 0x38c: 0x7749, 0x38d: 0x0004, 0x38e: 0x0004, 0x38f: 0x0004, 0x390: 0x0812, 0x391: 0x0812, + 0x392: 0x781a, 0x393: 0x795a, 0x396: 0x7a9a, 0x397: 0x7b7a, + 0x398: 0x0813, 0x399: 0x0813, 0x39a: 0x9753, 0x39b: 0x9753, 0x39d: 0x0004, + 0x39e: 0x0004, 0x39f: 0x0004, 0x3a0: 0x0812, 0x3a1: 0x0812, 0x3a2: 0x7cba, 0x3a3: 0x7dfa, + 0x3a4: 0x7f3a, 0x3a5: 0x0912, 0x3a6: 0x801a, 0x3a7: 0x80fa, 0x3a8: 0x0813, 0x3a9: 0x0813, + 0x3aa: 0x9d53, 0x3ab: 0x9d53, 0x3ac: 0x0913, 0x3ad: 0x0004, 0x3ae: 0x0004, 0x3af: 0x0004, + 0x3b2: 0x823a, 0x3b3: 0x834a, 0x3b4: 0x841a, + 0x3b6: 0x84fa, 0x3b7: 0x85da, 0x3b8: 0x9a53, 0x3b9: 0x9a53, 0x3ba: 0x4d53, 0x3bb: 0x4d53, + 0x3bc: 0x8719, 0x3bd: 0x0004, 0x3be: 0x0004, + // Block 0xf, offset 0x3c0 + 0x3c2: 0x0013, + 0x3c7: 0x0013, 0x3ca: 0x0012, 0x3cb: 0x0013, + 0x3cc: 0x0013, 0x3cd: 0x0013, 0x3ce: 0x0012, 0x3cf: 0x0012, 0x3d0: 0x0013, 0x3d1: 0x0013, + 0x3d2: 0x0013, 0x3d3: 0x0012, 0x3d5: 0x0013, + 0x3d9: 0x0013, 0x3da: 0x0013, 0x3db: 0x0013, 0x3dc: 0x0013, 0x3dd: 0x0013, + 0x3e4: 0x0013, 0x3e6: 0x87eb, 0x3e8: 0x0013, + 0x3ea: 0x884b, 0x3eb: 0x888b, 0x3ec: 0x0013, 0x3ed: 0x0013, 0x3ef: 0x0012, + 0x3f0: 0x0013, 0x3f1: 0x0013, 0x3f2: 0xa053, 0x3f3: 0x0013, 0x3f4: 0x0012, 0x3f5: 0x0010, + 0x3f6: 0x0010, 0x3f7: 0x0010, 0x3f8: 0x0010, 0x3f9: 0x0012, + 0x3fc: 0x0012, 0x3fd: 0x0012, 0x3fe: 0x0013, 0x3ff: 0x0013, + // Block 0x10, offset 0x400 + 0x400: 0x1a13, 0x401: 0x1a13, 0x402: 0x1e13, 0x403: 0x1e13, 0x404: 0x1a13, 0x405: 0x1a13, + 0x406: 0x2613, 0x407: 0x2613, 0x408: 0x2a13, 0x409: 0x2a13, 0x40a: 0x2e13, 0x40b: 0x2e13, + 0x40c: 0x2a13, 0x40d: 0x2a13, 0x40e: 0x2613, 0x40f: 0x2613, 0x410: 0xa352, 0x411: 0xa352, + 0x412: 0xa652, 0x413: 0xa652, 0x414: 0xa952, 0x415: 0xa952, 0x416: 0xa652, 0x417: 0xa652, + 0x418: 0xa352, 0x419: 0xa352, 0x41a: 0x1a12, 0x41b: 0x1a12, 0x41c: 0x1e12, 0x41d: 0x1e12, + 0x41e: 0x1a12, 0x41f: 0x1a12, 0x420: 0x2612, 0x421: 0x2612, 0x422: 0x2a12, 0x423: 0x2a12, + 0x424: 0x2e12, 0x425: 0x2e12, 0x426: 0x2a12, 0x427: 0x2a12, 0x428: 0x2612, 0x429: 0x2612, + // Block 0x11, offset 0x440 + 0x440: 0x6552, 0x441: 0x6552, 0x442: 0x6552, 0x443: 0x6552, 0x444: 0x6552, 0x445: 0x6552, + 0x446: 0x6552, 0x447: 0x6552, 0x448: 0x6552, 0x449: 0x6552, 0x44a: 0x6552, 0x44b: 0x6552, + 0x44c: 0x6552, 0x44d: 0x6552, 0x44e: 0x6552, 0x44f: 0x6552, 0x450: 0xac52, 0x451: 0xac52, + 0x452: 0xac52, 0x453: 0xac52, 0x454: 0xac52, 0x455: 0xac52, 0x456: 0xac52, 0x457: 0xac52, + 0x458: 0xac52, 0x459: 0xac52, 0x45a: 0xac52, 0x45b: 0xac52, 0x45c: 0xac52, 0x45d: 0xac52, + 0x45e: 0xac52, 0x460: 0x0113, 0x461: 0x0112, 0x462: 0x88eb, 0x463: 0x8b53, + 0x464: 0x894b, 0x465: 0x89aa, 0x466: 0x8a0a, 0x467: 0x0f13, 0x468: 0x0f12, 0x469: 0x0313, + 0x46a: 0x0312, 0x46b: 0x0713, 0x46c: 0x0712, 0x46d: 0x8a6b, 0x46e: 0x8acb, 0x46f: 0x8b2b, + 0x470: 0x8b8b, 0x471: 0x0012, 0x472: 0x0113, 0x473: 0x0112, 0x474: 0x0012, 0x475: 0x0313, + 0x476: 0x0312, 0x477: 0x0012, 0x478: 0x0012, 0x479: 0x0012, 0x47a: 0x0012, 0x47b: 0x0012, + 0x47c: 0x0015, 0x47d: 0x0015, 0x47e: 0x8beb, 0x47f: 0x8c4b, + // Block 0x12, offset 0x480 + 0x480: 0x0113, 0x481: 0x0112, 0x482: 0x0113, 0x483: 0x0112, 0x484: 0x0113, 0x485: 0x0112, + 0x486: 0x0113, 0x487: 0x0112, 0x488: 0x0014, 0x489: 0x0014, 0x48a: 0x0014, 0x48b: 0x0713, + 0x48c: 0x0712, 0x48d: 0x8cab, 0x48e: 0x0012, 0x48f: 0x0010, 0x490: 0x0113, 0x491: 0x0112, + 0x492: 0x0113, 0x493: 0x0112, 0x494: 0x0012, 0x495: 0x0012, 0x496: 0x0113, 0x497: 0x0112, + 0x498: 0x0113, 0x499: 0x0112, 0x49a: 0x0113, 0x49b: 0x0112, 0x49c: 0x0113, 0x49d: 0x0112, + 0x49e: 0x0113, 0x49f: 0x0112, 0x4a0: 0x0113, 0x4a1: 0x0112, 0x4a2: 0x0113, 0x4a3: 0x0112, + 0x4a4: 0x0113, 0x4a5: 0x0112, 0x4a6: 0x0113, 0x4a7: 0x0112, 0x4a8: 0x0113, 0x4a9: 0x0112, + 0x4aa: 0x8d0b, 0x4ab: 0x8d6b, 0x4ac: 0x8dcb, 0x4ad: 0x8e2b, 0x4ae: 0x8e8b, 0x4af: 0x0012, + 0x4b0: 0x8eeb, 0x4b1: 0x8f4b, 0x4b2: 0x8fab, 0x4b3: 0xaf53, 0x4b4: 0x0113, 0x4b5: 0x0112, + 0x4b6: 0x0113, 0x4b7: 0x0112, 0x4b8: 0x0113, 0x4b9: 0x0112, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x900a, 0x4c1: 0x908a, 0x4c2: 0x910a, 0x4c3: 0x918a, 0x4c4: 0x923a, 0x4c5: 0x92ea, + 0x4c6: 0x936a, + 0x4d3: 0x93ea, 0x4d4: 0x94ca, 0x4d5: 0x95aa, 0x4d6: 0x968a, 0x4d7: 0x976a, + 0x4dd: 0x0010, + 0x4de: 0x0034, 0x4df: 0x0010, 0x4e0: 0x0010, 0x4e1: 0x0010, 0x4e2: 0x0010, 0x4e3: 0x0010, + 0x4e4: 0x0010, 0x4e5: 0x0010, 0x4e6: 0x0010, 0x4e7: 0x0010, 0x4e8: 0x0010, + 0x4ea: 0x0010, 0x4eb: 0x0010, 0x4ec: 0x0010, 0x4ed: 0x0010, 0x4ee: 0x0010, 0x4ef: 0x0010, + 0x4f0: 0x0010, 0x4f1: 0x0010, 0x4f2: 0x0010, 0x4f3: 0x0010, 0x4f4: 0x0010, 0x4f5: 0x0010, + 0x4f6: 0x0010, 0x4f8: 0x0010, 0x4f9: 0x0010, 0x4fa: 0x0010, 0x4fb: 0x0010, + 0x4fc: 0x0010, 0x4fe: 0x0010, + // Block 0x14, offset 0x500 + 0x500: 0x2213, 0x501: 0x2213, 0x502: 0x2613, 0x503: 0x2613, 0x504: 0x2213, 0x505: 0x2213, + 0x506: 0x2e13, 0x507: 0x2e13, 0x508: 0x2213, 0x509: 0x2213, 0x50a: 0x2613, 0x50b: 0x2613, + 0x50c: 0x2213, 0x50d: 0x2213, 0x50e: 0x3e13, 0x50f: 0x3e13, 0x510: 0x2213, 0x511: 0x2213, + 0x512: 0x2613, 0x513: 0x2613, 0x514: 0x2213, 0x515: 0x2213, 0x516: 0x2e13, 0x517: 0x2e13, + 0x518: 0x2213, 0x519: 0x2213, 0x51a: 0x2613, 0x51b: 0x2613, 0x51c: 0x2213, 0x51d: 0x2213, + 0x51e: 0xb853, 0x51f: 0xb853, 0x520: 0xbb53, 0x521: 0xbb53, 0x522: 0x2212, 0x523: 0x2212, + 0x524: 0x2612, 0x525: 0x2612, 0x526: 0x2212, 0x527: 0x2212, 0x528: 0x2e12, 0x529: 0x2e12, + 0x52a: 0x2212, 0x52b: 0x2212, 0x52c: 0x2612, 0x52d: 0x2612, 0x52e: 0x2212, 0x52f: 0x2212, + 0x530: 0x3e12, 0x531: 0x3e12, 0x532: 0x2212, 0x533: 0x2212, 0x534: 0x2612, 0x535: 0x2612, + 0x536: 0x2212, 0x537: 0x2212, 0x538: 0x2e12, 0x539: 0x2e12, 0x53a: 0x2212, 0x53b: 0x2212, + 0x53c: 0x2612, 0x53d: 0x2612, 0x53e: 0x2212, 0x53f: 0x2212, + // Block 0x15, offset 0x540 + 0x542: 0x0010, + 0x547: 0x0010, 0x549: 0x0010, 0x54b: 0x0010, + 0x54d: 0x0010, 0x54e: 0x0010, 0x54f: 0x0010, 0x551: 0x0010, + 0x552: 0x0010, 0x554: 0x0010, 0x557: 0x0010, + 0x559: 0x0010, 0x55b: 0x0010, 0x55d: 0x0010, + 0x55f: 0x0010, 0x561: 0x0010, 0x562: 0x0010, + 0x564: 0x0010, 0x567: 0x0010, 0x568: 0x0010, 0x569: 0x0010, + 0x56a: 0x0010, 0x56c: 0x0010, 0x56d: 0x0010, 0x56e: 0x0010, 0x56f: 0x0010, + 0x570: 0x0010, 0x571: 0x0010, 0x572: 0x0010, 0x574: 0x0010, 0x575: 0x0010, + 0x576: 0x0010, 0x577: 0x0010, 0x579: 0x0010, 0x57a: 0x0010, 0x57b: 0x0010, + 0x57c: 0x0010, 0x57e: 0x0010, +} + +// caseIndex: 25 blocks, 1600 entries, 3200 bytes +// Block 0 is the zero block. +var caseIndex = [1600]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x14, 0xc3: 0x15, 0xc4: 0x16, 0xc5: 0x17, 0xc6: 0x01, 0xc7: 0x02, + 0xc8: 0x18, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x19, 0xcc: 0x1a, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07, + 0xd0: 0x1b, 0xd1: 0x1c, 0xd2: 0x1d, 0xd3: 0x1e, 0xd4: 0x1f, 0xd5: 0x20, 0xd6: 0x08, 0xd7: 0x21, + 0xd8: 0x22, 0xd9: 0x23, 0xda: 0x24, 0xdb: 0x25, 0xdc: 0x26, 0xdd: 0x27, 0xde: 0x28, 0xdf: 0x29, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09, + 0xf0: 0x14, 0xf3: 0x16, + // Block 0x4, offset 0x100 + 0x120: 0x2a, 0x121: 0x2b, 0x122: 0x2c, 0x123: 0x2d, 0x124: 0x2e, 0x125: 0x2f, 0x126: 0x30, 0x127: 0x31, + 0x128: 0x32, 0x129: 0x33, 0x12a: 0x34, 0x12b: 0x35, 0x12c: 0x36, 0x12d: 0x37, 0x12e: 0x38, 0x12f: 0x39, + 0x130: 0x3a, 0x131: 0x3b, 0x132: 0x3c, 0x133: 0x3d, 0x134: 0x3e, 0x135: 0x3f, 0x136: 0x40, 0x137: 0x41, + 0x138: 0x42, 0x139: 0x43, 0x13a: 0x44, 0x13b: 0x45, 0x13c: 0x46, 0x13d: 0x47, 0x13e: 0x48, 0x13f: 0x49, + // Block 0x5, offset 0x140 + 0x140: 0x4a, 0x141: 0x4b, 0x142: 0x4c, 0x143: 0x09, 0x144: 0x24, 0x145: 0x24, 0x146: 0x24, 0x147: 0x24, + 0x148: 0x24, 0x149: 0x4d, 0x14a: 0x4e, 0x14b: 0x4f, 0x14c: 0x50, 0x14d: 0x51, 0x14e: 0x52, 0x14f: 0x53, + 0x150: 0x54, 0x151: 0x24, 0x152: 0x24, 0x153: 0x24, 0x154: 0x24, 0x155: 0x24, 0x156: 0x24, 0x157: 0x24, + 0x158: 0x24, 0x159: 0x55, 0x15a: 0x56, 0x15b: 0x57, 0x15c: 0x58, 0x15d: 0x59, 0x15e: 0x5a, 0x15f: 0x5b, + 0x160: 0x5c, 0x161: 0x5d, 0x162: 0x5e, 0x163: 0x5f, 0x164: 0x60, 0x165: 0x61, 0x167: 0x62, + 0x168: 0x63, 0x169: 0x64, 0x16a: 0x65, 0x16c: 0x66, 0x16d: 0x67, 0x16e: 0x68, 0x16f: 0x69, + 0x170: 0x6a, 0x171: 0x6b, 0x172: 0x6c, 0x173: 0x6d, 0x174: 0x6e, 0x175: 0x6f, 0x176: 0x70, 0x177: 0x71, + 0x178: 0x72, 0x179: 0x72, 0x17a: 0x73, 0x17b: 0x72, 0x17c: 0x74, 0x17d: 0x0a, 0x17e: 0x0b, 0x17f: 0x0c, + // Block 0x6, offset 0x180 + 0x180: 0x75, 0x181: 0x76, 0x182: 0x77, 0x183: 0x78, 0x184: 0x0d, 0x185: 0x79, 0x186: 0x7a, + 0x192: 0x7b, 0x193: 0x0e, + 0x1b0: 0x7c, 0x1b1: 0x0f, 0x1b2: 0x72, 0x1b3: 0x7d, 0x1b4: 0x7e, 0x1b5: 0x7f, 0x1b6: 0x80, 0x1b7: 0x81, + 0x1b8: 0x82, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x83, 0x1c2: 0x84, 0x1c3: 0x85, 0x1c4: 0x86, 0x1c5: 0x24, 0x1c6: 0x87, + // Block 0x8, offset 0x200 + 0x200: 0x88, 0x201: 0x24, 0x202: 0x24, 0x203: 0x24, 0x204: 0x24, 0x205: 0x24, 0x206: 0x24, 0x207: 0x24, + 0x208: 0x24, 0x209: 0x24, 0x20a: 0x24, 0x20b: 0x24, 0x20c: 0x24, 0x20d: 0x24, 0x20e: 0x24, 0x20f: 0x24, + 0x210: 0x24, 0x211: 0x24, 0x212: 0x89, 0x213: 0x8a, 0x214: 0x24, 0x215: 0x24, 0x216: 0x24, 0x217: 0x24, + 0x218: 0x8b, 0x219: 0x8c, 0x21a: 0x8d, 0x21b: 0x8e, 0x21c: 0x8f, 0x21d: 0x90, 0x21e: 0x10, 0x21f: 0x91, + 0x220: 0x92, 0x221: 0x93, 0x222: 0x24, 0x223: 0x94, 0x224: 0x95, 0x225: 0x96, 0x226: 0x97, 0x227: 0x98, + 0x228: 0x99, 0x229: 0x9a, 0x22a: 0x9b, 0x22b: 0x9c, 0x22c: 0x9d, 0x22d: 0x9e, 0x22e: 0x9f, 0x22f: 0xa0, + 0x230: 0x24, 0x231: 0x24, 0x232: 0x24, 0x233: 0x24, 0x234: 0x24, 0x235: 0x24, 0x236: 0x24, 0x237: 0x24, + 0x238: 0x24, 0x239: 0x24, 0x23a: 0x24, 0x23b: 0x24, 0x23c: 0x24, 0x23d: 0x24, 0x23e: 0x24, 0x23f: 0x24, + // Block 0x9, offset 0x240 + 0x240: 0x24, 0x241: 0x24, 0x242: 0x24, 0x243: 0x24, 0x244: 0x24, 0x245: 0x24, 0x246: 0x24, 0x247: 0x24, + 0x248: 0x24, 0x249: 0x24, 0x24a: 0x24, 0x24b: 0x24, 0x24c: 0x24, 0x24d: 0x24, 0x24e: 0x24, 0x24f: 0x24, + 0x250: 0x24, 0x251: 0x24, 0x252: 0x24, 0x253: 0x24, 0x254: 0x24, 0x255: 0x24, 0x256: 0x24, 0x257: 0x24, + 0x258: 0x24, 0x259: 0x24, 0x25a: 0x24, 0x25b: 0x24, 0x25c: 0x24, 0x25d: 0x24, 0x25e: 0x24, 0x25f: 0x24, + 0x260: 0x24, 0x261: 0x24, 0x262: 0x24, 0x263: 0x24, 0x264: 0x24, 0x265: 0x24, 0x266: 0x24, 0x267: 0x24, + 0x268: 0x24, 0x269: 0x24, 0x26a: 0x24, 0x26b: 0x24, 0x26c: 0x24, 0x26d: 0x24, 0x26e: 0x24, 0x26f: 0x24, + 0x270: 0x24, 0x271: 0x24, 0x272: 0x24, 0x273: 0x24, 0x274: 0x24, 0x275: 0x24, 0x276: 0x24, 0x277: 0x24, + 0x278: 0x24, 0x279: 0x24, 0x27a: 0x24, 0x27b: 0x24, 0x27c: 0x24, 0x27d: 0x24, 0x27e: 0x24, 0x27f: 0x24, + // Block 0xa, offset 0x280 + 0x280: 0x24, 0x281: 0x24, 0x282: 0x24, 0x283: 0x24, 0x284: 0x24, 0x285: 0x24, 0x286: 0x24, 0x287: 0x24, + 0x288: 0x24, 0x289: 0x24, 0x28a: 0x24, 0x28b: 0x24, 0x28c: 0x24, 0x28d: 0x24, 0x28e: 0x24, 0x28f: 0x24, + 0x290: 0x24, 0x291: 0x24, 0x292: 0x24, 0x293: 0x24, 0x294: 0x24, 0x295: 0x24, 0x296: 0x24, 0x297: 0x24, + 0x298: 0x24, 0x299: 0x24, 0x29a: 0x24, 0x29b: 0x24, 0x29c: 0x24, 0x29d: 0x24, 0x29e: 0xa1, 0x29f: 0xa2, + // Block 0xb, offset 0x2c0 + 0x2ec: 0x11, 0x2ed: 0xa3, 0x2ee: 0xa4, 0x2ef: 0xa5, + 0x2f0: 0x24, 0x2f1: 0x24, 0x2f2: 0x24, 0x2f3: 0x24, 0x2f4: 0xa6, 0x2f5: 0xa7, 0x2f6: 0xa8, 0x2f7: 0xa9, + 0x2f8: 0xaa, 0x2f9: 0xab, 0x2fa: 0x24, 0x2fb: 0xac, 0x2fc: 0xad, 0x2fd: 0xae, 0x2fe: 0xaf, 0x2ff: 0xb0, + // Block 0xc, offset 0x300 + 0x300: 0xb1, 0x301: 0xb2, 0x302: 0x24, 0x303: 0xb3, 0x305: 0xb4, 0x307: 0xb5, + 0x30a: 0xb6, 0x30b: 0xb7, 0x30c: 0xb8, 0x30d: 0xb9, 0x30e: 0xba, 0x30f: 0xbb, + 0x310: 0xbc, 0x311: 0xbd, 0x312: 0xbe, 0x313: 0xbf, 0x314: 0xc0, 0x315: 0xc1, + 0x318: 0x24, 0x319: 0x24, 0x31a: 0x24, 0x31b: 0x24, 0x31c: 0xc2, 0x31d: 0xc3, + 0x320: 0xc4, 0x321: 0xc5, 0x322: 0xc6, 0x323: 0xc7, 0x324: 0xc8, 0x326: 0xc9, + 0x328: 0xca, 0x329: 0xcb, 0x32a: 0xcc, 0x32b: 0xcd, 0x32c: 0x5f, 0x32d: 0xce, 0x32e: 0xcf, + 0x330: 0x24, 0x331: 0xd0, 0x332: 0xd1, 0x333: 0xd2, 0x334: 0xd3, + 0x33c: 0xd4, 0x33d: 0xd5, + // Block 0xd, offset 0x340 + 0x340: 0xd6, 0x341: 0xd7, 0x342: 0xd8, 0x343: 0xd9, 0x344: 0xda, 0x345: 0xdb, 0x346: 0xdc, 0x347: 0xdd, + 0x348: 0xde, 0x34a: 0xdf, 0x34b: 0xe0, 0x34c: 0xe1, 0x34d: 0xe2, + 0x350: 0xe3, 0x351: 0xe4, 0x352: 0xe5, 0x353: 0xe6, 0x356: 0xe7, 0x357: 0xe8, + 0x358: 0xe9, 0x359: 0xea, 0x35a: 0xeb, 0x35b: 0xec, 0x35c: 0xed, + 0x360: 0xee, 0x362: 0xef, 0x363: 0xf0, + 0x368: 0xf1, 0x369: 0xf2, 0x36a: 0xf3, 0x36b: 0xf4, + 0x370: 0xf5, 0x371: 0xf6, 0x372: 0xf7, 0x374: 0xf8, 0x375: 0xf9, 0x376: 0xfa, + 0x37b: 0xfb, + // Block 0xe, offset 0x380 + 0x380: 0x24, 0x381: 0x24, 0x382: 0x24, 0x383: 0x24, 0x384: 0x24, 0x385: 0x24, 0x386: 0x24, 0x387: 0x24, + 0x388: 0x24, 0x389: 0x24, 0x38a: 0x24, 0x38b: 0x24, 0x38c: 0x24, 0x38d: 0x24, 0x38e: 0xfc, + 0x390: 0x24, 0x391: 0xfd, 0x392: 0x24, 0x393: 0x24, 0x394: 0x24, 0x395: 0xfe, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x24, 0x3c1: 0x24, 0x3c2: 0x24, 0x3c3: 0x24, 0x3c4: 0x24, 0x3c5: 0x24, 0x3c6: 0x24, 0x3c7: 0x24, + 0x3c8: 0x24, 0x3c9: 0x24, 0x3ca: 0x24, 0x3cb: 0x24, 0x3cc: 0x24, 0x3cd: 0x24, 0x3ce: 0x24, 0x3cf: 0x24, + 0x3d0: 0xfd, + // Block 0x10, offset 0x400 + 0x410: 0x24, 0x411: 0x24, 0x412: 0x24, 0x413: 0x24, 0x414: 0x24, 0x415: 0x24, 0x416: 0x24, 0x417: 0x24, + 0x418: 0x24, 0x419: 0xff, + // Block 0x11, offset 0x440 + 0x460: 0x24, 0x461: 0x24, 0x462: 0x24, 0x463: 0x24, 0x464: 0x24, 0x465: 0x24, 0x466: 0x24, 0x467: 0x24, + 0x468: 0xf4, 0x469: 0x100, 0x46b: 0x101, 0x46c: 0x102, 0x46d: 0x103, 0x46e: 0x104, + 0x479: 0x105, 0x47c: 0x24, 0x47d: 0x106, 0x47e: 0x107, 0x47f: 0x108, + // Block 0x12, offset 0x480 + 0x4b0: 0x24, 0x4b1: 0x109, 0x4b2: 0x10a, + // Block 0x13, offset 0x4c0 + 0x4c5: 0x10b, 0x4c6: 0x10c, + 0x4c9: 0x10d, + 0x4d0: 0x10e, 0x4d1: 0x10f, 0x4d2: 0x110, 0x4d3: 0x111, 0x4d4: 0x112, 0x4d5: 0x113, 0x4d6: 0x114, 0x4d7: 0x115, + 0x4d8: 0x116, 0x4d9: 0x117, 0x4da: 0x118, 0x4db: 0x119, 0x4dc: 0x11a, 0x4dd: 0x11b, 0x4de: 0x11c, 0x4df: 0x11d, + 0x4e8: 0x11e, 0x4e9: 0x11f, 0x4ea: 0x120, + // Block 0x14, offset 0x500 + 0x500: 0x121, + 0x520: 0x24, 0x521: 0x24, 0x522: 0x24, 0x523: 0x122, 0x524: 0x12, 0x525: 0x123, + 0x538: 0x124, 0x539: 0x13, 0x53a: 0x125, + // Block 0x15, offset 0x540 + 0x544: 0x126, 0x545: 0x127, 0x546: 0x128, + 0x54f: 0x129, + // Block 0x16, offset 0x580 + 0x590: 0x0a, 0x591: 0x0b, 0x592: 0x0c, 0x593: 0x0d, 0x594: 0x0e, 0x596: 0x0f, + 0x59b: 0x10, 0x59d: 0x11, 0x59e: 0x12, 0x59f: 0x13, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x12a, 0x5c1: 0x12b, 0x5c4: 0x12b, 0x5c5: 0x12b, 0x5c6: 0x12b, 0x5c7: 0x12c, + // Block 0x18, offset 0x600 + 0x620: 0x15, +} + +// sparseOffsets: 282 entries, 564 bytes +var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x35, 0x38, 0x3c, 0x3f, 0x43, 0x4d, 0x4f, 0x57, 0x5e, 0x63, 0x71, 0x72, 0x80, 0x8f, 0x99, 0x9c, 0xa3, 0xab, 0xae, 0xb0, 0xbf, 0xc5, 0xd3, 0xde, 0xeb, 0xf6, 0x102, 0x10c, 0x118, 0x123, 0x12f, 0x13b, 0x143, 0x14c, 0x156, 0x161, 0x16d, 0x174, 0x17f, 0x184, 0x18c, 0x18f, 0x194, 0x198, 0x19c, 0x1a3, 0x1ac, 0x1b4, 0x1b5, 0x1be, 0x1c5, 0x1cd, 0x1d3, 0x1d8, 0x1dc, 0x1df, 0x1e1, 0x1e4, 0x1e9, 0x1ea, 0x1ec, 0x1ee, 0x1f0, 0x1f7, 0x1fc, 0x200, 0x209, 0x20c, 0x20f, 0x215, 0x216, 0x221, 0x222, 0x223, 0x228, 0x235, 0x23d, 0x245, 0x24e, 0x257, 0x260, 0x265, 0x268, 0x273, 0x280, 0x282, 0x289, 0x28b, 0x297, 0x298, 0x2a3, 0x2ab, 0x2b3, 0x2b9, 0x2ba, 0x2c8, 0x2cd, 0x2d0, 0x2d5, 0x2d9, 0x2df, 0x2e4, 0x2e7, 0x2ec, 0x2f1, 0x2f2, 0x2f8, 0x2fa, 0x2fb, 0x2fd, 0x2ff, 0x302, 0x303, 0x305, 0x308, 0x30e, 0x312, 0x314, 0x319, 0x320, 0x324, 0x32d, 0x32e, 0x337, 0x33b, 0x340, 0x348, 0x34e, 0x354, 0x35e, 0x363, 0x36c, 0x372, 0x379, 0x37d, 0x385, 0x387, 0x389, 0x38c, 0x38e, 0x390, 0x391, 0x392, 0x394, 0x396, 0x39c, 0x3a1, 0x3a3, 0x3a9, 0x3ac, 0x3ae, 0x3b4, 0x3b9, 0x3bb, 0x3bc, 0x3bd, 0x3be, 0x3c0, 0x3c2, 0x3c4, 0x3c7, 0x3c9, 0x3cc, 0x3d4, 0x3d7, 0x3db, 0x3e3, 0x3e5, 0x3e6, 0x3e7, 0x3e9, 0x3ef, 0x3f1, 0x3f2, 0x3f4, 0x3f6, 0x3f8, 0x405, 0x406, 0x407, 0x40b, 0x40d, 0x40e, 0x40f, 0x410, 0x411, 0x414, 0x417, 0x41d, 0x421, 0x425, 0x42b, 0x42e, 0x435, 0x439, 0x43d, 0x444, 0x44d, 0x453, 0x459, 0x463, 0x46d, 0x46f, 0x477, 0x47d, 0x483, 0x489, 0x48c, 0x492, 0x495, 0x49d, 0x49e, 0x4a5, 0x4a9, 0x4aa, 0x4ad, 0x4b5, 0x4bb, 0x4c2, 0x4c3, 0x4c9, 0x4cc, 0x4d4, 0x4db, 0x4e5, 0x4ed, 0x4f0, 0x4f1, 0x4f2, 0x4f3, 0x4f4, 0x4f6, 0x4f8, 0x4fa, 0x4fe, 0x4ff, 0x501, 0x503, 0x504, 0x505, 0x507, 0x50c, 0x511, 0x515, 0x516, 0x519, 0x51d, 0x528, 0x52c, 0x534, 0x539, 0x53d, 0x540, 0x544, 0x547, 0x54a, 0x54f, 0x553, 0x557, 0x55b, 0x55f, 0x561, 0x563, 0x566, 0x56b, 0x56d, 0x572, 0x57b, 0x580, 0x581, 0x584, 0x585, 0x586, 0x588, 0x589, 0x58a} + +// sparseValues: 1418 entries, 5672 bytes +var sparseValues = [1418]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0004, lo: 0xa8, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xaa}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0004, lo: 0xaf, hi: 0xaf}, + {value: 0x0004, lo: 0xb4, hi: 0xb4}, + {value: 0x001a, lo: 0xb5, hi: 0xb5}, + {value: 0x0054, lo: 0xb7, hi: 0xb7}, + {value: 0x0004, lo: 0xb8, hi: 0xb8}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + // Block 0x1, offset 0x9 + {value: 0x2013, lo: 0x80, hi: 0x96}, + {value: 0x2013, lo: 0x98, hi: 0x9e}, + {value: 0x009a, lo: 0x9f, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xb6}, + {value: 0x2012, lo: 0xb8, hi: 0xbe}, + {value: 0x0252, lo: 0xbf, hi: 0xbf}, + // Block 0x2, offset 0xf + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x011b, lo: 0xb0, hi: 0xb0}, + {value: 0x019a, lo: 0xb1, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb7}, + {value: 0x0012, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x0553, lo: 0xbf, hi: 0xbf}, + // Block 0x3, offset 0x18 + {value: 0x0552, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x01da, lo: 0x89, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xb7}, + {value: 0x0253, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x028a, lo: 0xbf, hi: 0xbf}, + // Block 0x4, offset 0x24 + {value: 0x0117, lo: 0x80, hi: 0x9f}, + {value: 0x2f53, lo: 0xa0, hi: 0xa0}, + {value: 0x0012, lo: 0xa1, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xb3}, + {value: 0x0012, lo: 0xb4, hi: 0xb9}, + {value: 0x090b, lo: 0xba, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x2953, lo: 0xbd, hi: 0xbd}, + {value: 0x098b, lo: 0xbe, hi: 0xbe}, + {value: 0x0a0a, lo: 0xbf, hi: 0xbf}, + // Block 0x5, offset 0x2e + {value: 0x0015, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x97}, + {value: 0x0004, lo: 0x98, hi: 0x9d}, + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0015, lo: 0xa0, hi: 0xa4}, + {value: 0x0004, lo: 0xa5, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xbf}, + // Block 0x6, offset 0x35 + {value: 0x0024, lo: 0x80, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbf}, + // Block 0x7, offset 0x38 + {value: 0x6553, lo: 0x80, hi: 0x8f}, + {value: 0x2013, lo: 0x90, hi: 0x9f}, + {value: 0x5f53, lo: 0xa0, hi: 0xaf}, + {value: 0x2012, lo: 0xb0, hi: 0xbf}, + // Block 0x8, offset 0x3c + {value: 0x5f52, lo: 0x80, hi: 0x8f}, + {value: 0x6552, lo: 0x90, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x9, offset 0x3f + {value: 0x0117, lo: 0x80, hi: 0x81}, + {value: 0x0024, lo: 0x83, hi: 0x87}, + {value: 0x0014, lo: 0x88, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xbf}, + // Block 0xa, offset 0x43 + {value: 0x0f13, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x0316, lo: 0x89, hi: 0x8a}, + {value: 0x0716, lo: 0x8b, hi: 0x8c}, + {value: 0x0316, lo: 0x8d, hi: 0x8e}, + {value: 0x0f12, lo: 0x8f, hi: 0x8f}, + {value: 0x0117, lo: 0x90, hi: 0xbf}, + // Block 0xb, offset 0x4d + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x6553, lo: 0xb1, hi: 0xbf}, + // Block 0xc, offset 0x4f + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6853, lo: 0x90, hi: 0x96}, + {value: 0x0014, lo: 0x99, hi: 0x99}, + {value: 0x0010, lo: 0x9b, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0012, lo: 0xa0, hi: 0xa0}, + {value: 0x6552, lo: 0xa1, hi: 0xaf}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0xd, offset 0x57 + {value: 0x0034, lo: 0x81, hi: 0x82}, + {value: 0x0024, lo: 0x84, hi: 0x84}, + {value: 0x0034, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0xaa}, + {value: 0x0010, lo: 0xaf, hi: 0xb3}, + {value: 0x0054, lo: 0xb4, hi: 0xb4}, + // Block 0xe, offset 0x5e + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0024, lo: 0x90, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0014, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xf, offset 0x63 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9c}, + {value: 0x0024, lo: 0x9d, hi: 0x9e}, + {value: 0x0034, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0034, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x10, offset 0x71 + {value: 0x0010, lo: 0x80, hi: 0xbf}, + // Block 0x11, offset 0x72 + {value: 0x0010, lo: 0x80, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0024, lo: 0x9f, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xaa, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x12, offset 0x80 + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0034, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0034, lo: 0xb1, hi: 0xb1}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbd}, + {value: 0x0034, lo: 0xbe, hi: 0xbe}, + {value: 0x0024, lo: 0xbf, hi: 0xbf}, + // Block 0x13, offset 0x8f + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0024, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x88}, + {value: 0x0024, lo: 0x89, hi: 0x8a}, + {value: 0x0010, lo: 0x8d, hi: 0xbf}, + // Block 0x14, offset 0x99 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x15, offset 0x9c + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xb1}, + {value: 0x0034, lo: 0xb2, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0x16, offset 0xa3 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x99}, + {value: 0x0014, lo: 0x9a, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0xa3}, + {value: 0x0014, lo: 0xa4, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xad}, + // Block 0x17, offset 0xab + {value: 0x0010, lo: 0x80, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0xa0, hi: 0xaa}, + // Block 0x18, offset 0xae + {value: 0x0010, lo: 0xa0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbd}, + // Block 0x19, offset 0xb0 + {value: 0x0034, lo: 0x93, hi: 0x93}, + {value: 0x0024, lo: 0x94, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0024, lo: 0xaa, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbf}, + // Block 0x1a, offset 0xbf + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1b, offset 0xc5 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0x1c, offset 0xd3 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb6, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1d, offset 0xde + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xb1}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + // Block 0x1e, offset 0xeb + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x1f, offset 0xf6 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x99, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x20, offset 0x102 + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x21, offset 0x10c + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x85}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xbf}, + // Block 0x22, offset 0x118 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x23, offset 0x123 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x24, offset 0x12f + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0010, lo: 0xa8, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x25, offset 0x13b + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x26, offset 0x143 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb9}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbf}, + // Block 0x27, offset 0x14c + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x88}, + {value: 0x0014, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x28, offset 0x156 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x29, offset 0x161 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb2}, + // Block 0x2a, offset 0x16d + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x2b, offset 0x174 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x94, hi: 0x97}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xba, hi: 0xbf}, + // Block 0x2c, offset 0x17f + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x96}, + {value: 0x0010, lo: 0x9a, hi: 0xb1}, + {value: 0x0010, lo: 0xb3, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x2d, offset 0x184 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x94}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9f}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + // Block 0x2e, offset 0x18c + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xba}, + // Block 0x2f, offset 0x18f + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x30, offset 0x194 + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xb9}, + {value: 0x0014, lo: 0xbb, hi: 0xbc}, + // Block 0x31, offset 0x198 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x32, offset 0x19c + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0034, lo: 0x98, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0034, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x33, offset 0x1a3 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xac}, + {value: 0x0034, lo: 0xb1, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xba, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x34, offset 0x1ac + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0024, lo: 0x82, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x86, hi: 0x87}, + {value: 0x0010, lo: 0x88, hi: 0x8c}, + {value: 0x0014, lo: 0x8d, hi: 0x97}, + {value: 0x0014, lo: 0x99, hi: 0xbc}, + // Block 0x35, offset 0x1b4 + {value: 0x0034, lo: 0x86, hi: 0x86}, + // Block 0x36, offset 0x1b5 + {value: 0x0010, lo: 0xab, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbe}, + // Block 0x37, offset 0x1be + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x96, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x99}, + {value: 0x0014, lo: 0x9e, hi: 0xa0}, + {value: 0x0010, lo: 0xa2, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xad}, + {value: 0x0014, lo: 0xb1, hi: 0xb4}, + // Block 0x38, offset 0x1c5 + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x6c53, lo: 0xa0, hi: 0xbf}, + // Block 0x39, offset 0x1cd + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x9a, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x3a, offset 0x1d3 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x3b, offset 0x1d8 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x82, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3c, offset 0x1dc + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3d, offset 0x1df + {value: 0x0010, lo: 0x80, hi: 0x9a}, + {value: 0x0024, lo: 0x9d, hi: 0x9f}, + // Block 0x3e, offset 0x1e1 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x7453, lo: 0xa0, hi: 0xaf}, + {value: 0x7853, lo: 0xb0, hi: 0xbf}, + // Block 0x3f, offset 0x1e4 + {value: 0x7c53, lo: 0x80, hi: 0x8f}, + {value: 0x8053, lo: 0x90, hi: 0x9f}, + {value: 0x7c53, lo: 0xa0, hi: 0xaf}, + {value: 0x0813, lo: 0xb0, hi: 0xb5}, + {value: 0x0892, lo: 0xb8, hi: 0xbd}, + // Block 0x40, offset 0x1e9 + {value: 0x0010, lo: 0x81, hi: 0xbf}, + // Block 0x41, offset 0x1ea + {value: 0x0010, lo: 0x80, hi: 0xac}, + {value: 0x0010, lo: 0xaf, hi: 0xbf}, + // Block 0x42, offset 0x1ec + {value: 0x0010, lo: 0x81, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x43, offset 0x1ee + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb8}, + // Block 0x44, offset 0x1f0 + {value: 0x0010, lo: 0x80, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0034, lo: 0x94, hi: 0x94}, + {value: 0x0010, lo: 0xa0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + // Block 0x45, offset 0x1f7 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xac}, + {value: 0x0010, lo: 0xae, hi: 0xb0}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + // Block 0x46, offset 0x1fc + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x47, offset 0x200 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x89, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0014, lo: 0x93, hi: 0x93}, + {value: 0x0004, lo: 0x97, hi: 0x97}, + {value: 0x0024, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0x48, offset 0x209 + {value: 0x0014, lo: 0x8b, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x49, offset 0x20c + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb8}, + // Block 0x4a, offset 0x20f + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x4b, offset 0x215 + {value: 0x0010, lo: 0x80, hi: 0xb5}, + // Block 0x4c, offset 0x216 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbb}, + // Block 0x4d, offset 0x221 + {value: 0x0010, lo: 0x86, hi: 0x8f}, + // Block 0x4e, offset 0x222 + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x4f, offset 0x223 + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + // Block 0x50, offset 0x228 + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x9e}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xac}, + {value: 0x0010, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xbc}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x51, offset 0x235 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xa7, hi: 0xa7}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + {value: 0x0034, lo: 0xb5, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbc}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0x52, offset 0x23d + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x53, offset 0x245 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0030, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8b}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xab, hi: 0xab}, + {value: 0x0034, lo: 0xac, hi: 0xac}, + {value: 0x0024, lo: 0xad, hi: 0xb3}, + // Block 0x54, offset 0x24e + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0030, lo: 0xaa, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbf}, + // Block 0x55, offset 0x257 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0030, lo: 0xb2, hi: 0xb3}, + // Block 0x56, offset 0x260 + {value: 0x0010, lo: 0x80, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0x57, offset 0x265 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8d, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x58, offset 0x268 + {value: 0x316a, lo: 0x80, hi: 0x80}, + {value: 0x31ea, lo: 0x81, hi: 0x81}, + {value: 0x326a, lo: 0x82, hi: 0x82}, + {value: 0x32ea, lo: 0x83, hi: 0x83}, + {value: 0x336a, lo: 0x84, hi: 0x84}, + {value: 0x33ea, lo: 0x85, hi: 0x85}, + {value: 0x346a, lo: 0x86, hi: 0x86}, + {value: 0x34ea, lo: 0x87, hi: 0x87}, + {value: 0x356a, lo: 0x88, hi: 0x88}, + {value: 0x8353, lo: 0x90, hi: 0xba}, + {value: 0x8353, lo: 0xbd, hi: 0xbf}, + // Block 0x59, offset 0x273 + {value: 0x0024, lo: 0x90, hi: 0x92}, + {value: 0x0034, lo: 0x94, hi: 0x99}, + {value: 0x0024, lo: 0x9a, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9f}, + {value: 0x0024, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0034, lo: 0xa2, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xb3}, + {value: 0x0024, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb7}, + {value: 0x0024, lo: 0xb8, hi: 0xb9}, + // Block 0x5a, offset 0x280 + {value: 0x0012, lo: 0x80, hi: 0xab}, + {value: 0x0015, lo: 0xac, hi: 0xbf}, + // Block 0x5b, offset 0x282 + {value: 0x0015, lo: 0x80, hi: 0xaa}, + {value: 0x0012, lo: 0xab, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb8}, + {value: 0x8752, lo: 0xb9, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbc}, + {value: 0x8b52, lo: 0xbd, hi: 0xbd}, + {value: 0x0012, lo: 0xbe, hi: 0xbf}, + // Block 0x5c, offset 0x289 + {value: 0x0012, lo: 0x80, hi: 0x9a}, + {value: 0x0015, lo: 0x9b, hi: 0xbf}, + // Block 0x5d, offset 0x28b + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0024, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb9}, + {value: 0x0024, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbd}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x5e, offset 0x297 + {value: 0x0117, lo: 0x80, hi: 0xbf}, + // Block 0x5f, offset 0x298 + {value: 0x0117, lo: 0x80, hi: 0x95}, + {value: 0x361a, lo: 0x96, hi: 0x96}, + {value: 0x36ca, lo: 0x97, hi: 0x97}, + {value: 0x377a, lo: 0x98, hi: 0x98}, + {value: 0x382a, lo: 0x99, hi: 0x99}, + {value: 0x38da, lo: 0x9a, hi: 0x9a}, + {value: 0x398a, lo: 0x9b, hi: 0x9b}, + {value: 0x0012, lo: 0x9c, hi: 0x9d}, + {value: 0x3a3b, lo: 0x9e, hi: 0x9e}, + {value: 0x0012, lo: 0x9f, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x60, offset 0x2a3 + {value: 0x0812, lo: 0x80, hi: 0x87}, + {value: 0x0813, lo: 0x88, hi: 0x8f}, + {value: 0x0812, lo: 0x90, hi: 0x95}, + {value: 0x0813, lo: 0x98, hi: 0x9d}, + {value: 0x0812, lo: 0xa0, hi: 0xa7}, + {value: 0x0813, lo: 0xa8, hi: 0xaf}, + {value: 0x0812, lo: 0xb0, hi: 0xb7}, + {value: 0x0813, lo: 0xb8, hi: 0xbf}, + // Block 0x61, offset 0x2ab + {value: 0x0004, lo: 0x8b, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8f}, + {value: 0x0054, lo: 0x98, hi: 0x99}, + {value: 0x0054, lo: 0xa4, hi: 0xa4}, + {value: 0x0054, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xaa, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xaf}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x62, offset 0x2b3 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x94, hi: 0x94}, + {value: 0x0014, lo: 0xa0, hi: 0xa4}, + {value: 0x0014, lo: 0xa6, hi: 0xaf}, + {value: 0x0015, lo: 0xb1, hi: 0xb1}, + {value: 0x0015, lo: 0xbf, hi: 0xbf}, + // Block 0x63, offset 0x2b9 + {value: 0x0015, lo: 0x90, hi: 0x9c}, + // Block 0x64, offset 0x2ba + {value: 0x0024, lo: 0x90, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x93}, + {value: 0x0024, lo: 0x94, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0xa0}, + {value: 0x0024, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa4}, + {value: 0x0034, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa7}, + {value: 0x0034, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xa9}, + {value: 0x0034, lo: 0xaa, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + // Block 0x65, offset 0x2c8 + {value: 0x0016, lo: 0x85, hi: 0x86}, + {value: 0x0012, lo: 0x87, hi: 0x89}, + {value: 0xa052, lo: 0x8e, hi: 0x8e}, + {value: 0x1013, lo: 0xa0, hi: 0xaf}, + {value: 0x1012, lo: 0xb0, hi: 0xbf}, + // Block 0x66, offset 0x2cd + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x88}, + // Block 0x67, offset 0x2d0 + {value: 0xa353, lo: 0xb6, hi: 0xb7}, + {value: 0xa653, lo: 0xb8, hi: 0xb9}, + {value: 0xa953, lo: 0xba, hi: 0xbb}, + {value: 0xa653, lo: 0xbc, hi: 0xbd}, + {value: 0xa353, lo: 0xbe, hi: 0xbf}, + // Block 0x68, offset 0x2d5 + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6553, lo: 0x90, hi: 0x9f}, + {value: 0xac53, lo: 0xa0, hi: 0xae}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0x69, offset 0x2d9 + {value: 0x0117, lo: 0x80, hi: 0xa3}, + {value: 0x0012, lo: 0xa4, hi: 0xa4}, + {value: 0x0716, lo: 0xab, hi: 0xac}, + {value: 0x0316, lo: 0xad, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb3}, + // Block 0x6a, offset 0x2df + {value: 0x6c52, lo: 0x80, hi: 0x9f}, + {value: 0x7052, lo: 0xa0, hi: 0xa5}, + {value: 0x7052, lo: 0xa7, hi: 0xa7}, + {value: 0x7052, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x6b, offset 0x2e4 + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x6c, offset 0x2e7 + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0010, lo: 0xb0, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x6d, offset 0x2ec + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9e}, + {value: 0x0024, lo: 0xa0, hi: 0xbf}, + // Block 0x6e, offset 0x2f1 + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + // Block 0x6f, offset 0x2f2 + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0xaa, hi: 0xad}, + {value: 0x0030, lo: 0xae, hi: 0xaf}, + {value: 0x0004, lo: 0xb1, hi: 0xb5}, + {value: 0x0014, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + // Block 0x70, offset 0x2f8 + {value: 0x0034, lo: 0x99, hi: 0x9a}, + {value: 0x0004, lo: 0x9b, hi: 0x9e}, + // Block 0x71, offset 0x2fa + {value: 0x0004, lo: 0xbc, hi: 0xbe}, + // Block 0x72, offset 0x2fb + {value: 0x0010, lo: 0x85, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x73, offset 0x2fd + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0010, lo: 0xa0, hi: 0xba}, + // Block 0x74, offset 0x2ff + {value: 0x0010, lo: 0x80, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0xbf}, + // Block 0x75, offset 0x302 + {value: 0x0010, lo: 0x80, hi: 0x8c}, + // Block 0x76, offset 0x303 + {value: 0x0010, lo: 0x90, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x77, offset 0x305 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0xab}, + // Block 0x78, offset 0x308 + {value: 0x0117, lo: 0x80, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb2}, + {value: 0x0024, lo: 0xb4, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x79, offset 0x30e + {value: 0x0117, lo: 0x80, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9d}, + {value: 0x0024, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x7a, offset 0x312 + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb1}, + // Block 0x7b, offset 0x314 + {value: 0x0004, lo: 0x80, hi: 0x96}, + {value: 0x0014, lo: 0x97, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xaf}, + {value: 0x0012, lo: 0xb0, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xbf}, + // Block 0x7c, offset 0x319 + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x0015, lo: 0xb0, hi: 0xb0}, + {value: 0x0012, lo: 0xb1, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x8753, lo: 0xbd, hi: 0xbd}, + {value: 0x0117, lo: 0xbe, hi: 0xbf}, + // Block 0x7d, offset 0x320 + {value: 0x0010, lo: 0xb7, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbf}, + // Block 0x7e, offset 0x324 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8b}, + {value: 0x0010, lo: 0x8c, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + // Block 0x7f, offset 0x32d + {value: 0x0010, lo: 0x80, hi: 0xb3}, + // Block 0x80, offset 0x32e + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xa0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb7}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x81, offset 0x337 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x82, offset 0x33b + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0x92}, + {value: 0x0030, lo: 0x93, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0x83, offset 0x340 + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb9}, + {value: 0x0010, lo: 0xba, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x84, offset 0x348 + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0004, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x85, offset 0x34e + {value: 0x0010, lo: 0x80, hi: 0xa8}, + {value: 0x0014, lo: 0xa9, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0x86, offset 0x354 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x87, offset 0x35e + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0024, lo: 0xbe, hi: 0xbf}, + // Block 0x88, offset 0x363 + {value: 0x0024, lo: 0x81, hi: 0x81}, + {value: 0x0004, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + // Block 0x89, offset 0x36c + {value: 0x0010, lo: 0x81, hi: 0x86}, + {value: 0x0010, lo: 0x89, hi: 0x8e}, + {value: 0x0010, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x8a, offset 0x372 + {value: 0x0012, lo: 0x80, hi: 0x92}, + {value: 0xaf52, lo: 0x93, hi: 0x93}, + {value: 0x0012, lo: 0x94, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9f}, + {value: 0x0012, lo: 0xa0, hi: 0xa5}, + {value: 0x74d2, lo: 0xb0, hi: 0xbf}, + // Block 0x8b, offset 0x379 + {value: 0x78d2, lo: 0x80, hi: 0x8f}, + {value: 0x7cd2, lo: 0x90, hi: 0x9f}, + {value: 0x80d2, lo: 0xa0, hi: 0xaf}, + {value: 0x7cd2, lo: 0xb0, hi: 0xbf}, + // Block 0x8c, offset 0x37d + {value: 0x0010, lo: 0x80, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x8d, offset 0x385 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x8e, offset 0x387 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x8b, hi: 0xbb}, + // Block 0x8f, offset 0x389 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0xbf}, + // Block 0x90, offset 0x38c + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0004, lo: 0xb2, hi: 0xbf}, + // Block 0x91, offset 0x38e + {value: 0x0004, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x93, hi: 0xbf}, + // Block 0x92, offset 0x390 + {value: 0x0010, lo: 0x80, hi: 0xbd}, + // Block 0x93, offset 0x391 + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0x94, offset 0x392 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0xbf}, + // Block 0x95, offset 0x394 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0xb0, hi: 0xbb}, + // Block 0x96, offset 0x396 + {value: 0x0014, lo: 0x80, hi: 0x8f}, + {value: 0x0054, lo: 0x93, hi: 0x93}, + {value: 0x0024, lo: 0xa0, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xad}, + {value: 0x0024, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + // Block 0x97, offset 0x39c + {value: 0x0010, lo: 0x8d, hi: 0x8f}, + {value: 0x0054, lo: 0x92, hi: 0x92}, + {value: 0x0054, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0xb0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0x98, offset 0x3a1 + {value: 0x0010, lo: 0x80, hi: 0xbc}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x99, offset 0x3a3 + {value: 0x0054, lo: 0x87, hi: 0x87}, + {value: 0x0054, lo: 0x8e, hi: 0x8e}, + {value: 0x0054, lo: 0x9a, hi: 0x9a}, + {value: 0x5f53, lo: 0xa1, hi: 0xba}, + {value: 0x0004, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9a, offset 0x3a9 + {value: 0x0004, lo: 0x80, hi: 0x80}, + {value: 0x5f52, lo: 0x81, hi: 0x9a}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + // Block 0x9b, offset 0x3ac + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbe}, + // Block 0x9c, offset 0x3ae + {value: 0x0010, lo: 0x82, hi: 0x87}, + {value: 0x0010, lo: 0x8a, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0x97}, + {value: 0x0010, lo: 0x9a, hi: 0x9c}, + {value: 0x0004, lo: 0xa3, hi: 0xa3}, + {value: 0x0014, lo: 0xb9, hi: 0xbb}, + // Block 0x9d, offset 0x3b4 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0010, lo: 0x8d, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xba}, + {value: 0x0010, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9e, offset 0x3b9 + {value: 0x0010, lo: 0x80, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x9d}, + // Block 0x9f, offset 0x3bb + {value: 0x0010, lo: 0x80, hi: 0xba}, + // Block 0xa0, offset 0x3bc + {value: 0x0010, lo: 0x80, hi: 0xb4}, + // Block 0xa1, offset 0x3bd + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0xa2, offset 0x3be + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa3, offset 0x3c0 + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + // Block 0xa4, offset 0x3c2 + {value: 0x0010, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xad, hi: 0xbf}, + // Block 0xa5, offset 0x3c4 + {value: 0x0010, lo: 0x80, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0xb5}, + {value: 0x0024, lo: 0xb6, hi: 0xba}, + // Block 0xa6, offset 0x3c7 + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa7, offset 0x3c9 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x91, hi: 0x95}, + // Block 0xa8, offset 0x3cc + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x97}, + {value: 0xb253, lo: 0x98, hi: 0x9f}, + {value: 0xb553, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbf}, + // Block 0xa9, offset 0x3d4 + {value: 0xb252, lo: 0x80, hi: 0x87}, + {value: 0xb552, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0xaa, offset 0x3d7 + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0xb553, lo: 0xb0, hi: 0xb7}, + {value: 0xb253, lo: 0xb8, hi: 0xbf}, + // Block 0xab, offset 0x3db + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x93}, + {value: 0xb552, lo: 0x98, hi: 0x9f}, + {value: 0xb252, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbb}, + // Block 0xac, offset 0x3e3 + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xad, offset 0x3e5 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + // Block 0xae, offset 0x3e6 + {value: 0x0010, lo: 0x80, hi: 0xb6}, + // Block 0xaf, offset 0x3e7 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xa7}, + // Block 0xb0, offset 0x3e9 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xb5}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xb1, offset 0x3ef + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb6}, + // Block 0xb2, offset 0x3f1 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + // Block 0xb3, offset 0x3f2 + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + // Block 0xb4, offset 0x3f4 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb9}, + // Block 0xb5, offset 0x3f6 + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0xb6, offset 0x3f8 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x8e, hi: 0x8e}, + {value: 0x0024, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x99, hi: 0xb5}, + {value: 0x0024, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xb7, offset 0x405 + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0xb8, offset 0x406 + {value: 0x0010, lo: 0x80, hi: 0x9c}, + // Block 0xb9, offset 0x407 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + // Block 0xba, offset 0x40b + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + // Block 0xbb, offset 0x40d + {value: 0x0010, lo: 0x80, hi: 0x91}, + // Block 0xbc, offset 0x40e + {value: 0x0010, lo: 0x80, hi: 0x88}, + // Block 0xbd, offset 0x40f + {value: 0x5653, lo: 0x80, hi: 0xb2}, + // Block 0xbe, offset 0x410 + {value: 0x5652, lo: 0x80, hi: 0xb2}, + // Block 0xbf, offset 0x411 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xc0, offset 0x414 + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xc1, offset 0x417 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x87}, + {value: 0x0024, lo: 0x88, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x8b}, + {value: 0x0024, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + // Block 0xc2, offset 0x41d + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xc3, offset 0x421 + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xc4, offset 0x425 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb6}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + // Block 0xc5, offset 0x42b + {value: 0x0014, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xc6, offset 0x42e + {value: 0x0024, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0xc7, offset 0x435 + {value: 0x0010, lo: 0x84, hi: 0x86}, + {value: 0x0010, lo: 0x90, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + // Block 0xc8, offset 0x439 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xc9, offset 0x43d + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x89, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + // Block 0xca, offset 0x444 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb4}, + {value: 0x0030, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xb7}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0xcb, offset 0x44d + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xcc, offset 0x453 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa2}, + {value: 0x0014, lo: 0xa3, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xcd, offset 0x459 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xce, offset 0x463 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0030, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9d, hi: 0xa3}, + {value: 0x0024, lo: 0xa6, hi: 0xac}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + // Block 0xcf, offset 0x46d + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xd0, offset 0x46f + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0x9e, hi: 0x9e}, + // Block 0xd1, offset 0x477 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xd2, offset 0x47d + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd3, offset 0x483 + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd4, offset 0x489 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x98, hi: 0x9b}, + {value: 0x0014, lo: 0x9c, hi: 0x9d}, + // Block 0xd5, offset 0x48c + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd6, offset 0x492 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd7, offset 0x495 + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0014, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb5}, + {value: 0x0030, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0xd8, offset 0x49d + {value: 0x0010, lo: 0x80, hi: 0x89}, + // Block 0xd9, offset 0x49e + {value: 0x0014, lo: 0x9d, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xda, offset 0x4a5 + {value: 0x0010, lo: 0x80, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + // Block 0xdb, offset 0x4a9 + {value: 0x5f53, lo: 0xa0, hi: 0xbf}, + // Block 0xdc, offset 0x4aa + {value: 0x5f52, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xdd, offset 0x4ad + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x8a}, + {value: 0x0010, lo: 0x8b, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbb, hi: 0xbe}, + // Block 0xde, offset 0x4b5 + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0014, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x98}, + {value: 0x0014, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0x9c, hi: 0xbf}, + // Block 0xdf, offset 0x4bb + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x86, hi: 0x89}, + {value: 0x0014, lo: 0x8a, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x99}, + {value: 0x0010, lo: 0x9d, hi: 0x9d}, + // Block 0xe0, offset 0x4c2 + {value: 0x0010, lo: 0x80, hi: 0xb8}, + // Block 0xe1, offset 0x4c3 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb6}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xe2, offset 0x4c9 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0xe3, offset 0x4cc + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0014, lo: 0x92, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xa9}, + {value: 0x0014, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0xe4, offset 0x4d4 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb6}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xe5, offset 0x4db + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa5}, + {value: 0x0010, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xbf}, + // Block 0xe6, offset 0x4e5 + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0014, lo: 0x90, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0x96}, + {value: 0x0034, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0xe7, offset 0x4ed + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + // Block 0xe8, offset 0x4f0 + {value: 0x0010, lo: 0x80, hi: 0x99}, + // Block 0xe9, offset 0x4f1 + {value: 0x0010, lo: 0x80, hi: 0xae}, + // Block 0xea, offset 0x4f2 + {value: 0x0010, lo: 0x80, hi: 0x83}, + // Block 0xeb, offset 0x4f3 + {value: 0x0010, lo: 0x80, hi: 0x86}, + // Block 0xec, offset 0x4f4 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0xed, offset 0x4f6 + {value: 0x0010, lo: 0x90, hi: 0xad}, + {value: 0x0034, lo: 0xb0, hi: 0xb4}, + // Block 0xee, offset 0x4f8 + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb6}, + // Block 0xef, offset 0x4fa + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa3, hi: 0xb7}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xf0, offset 0x4fe + {value: 0x0010, lo: 0x80, hi: 0x8f}, + // Block 0xf1, offset 0x4ff + {value: 0x2013, lo: 0x80, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xbf}, + // Block 0xf2, offset 0x501 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0xbe}, + // Block 0xf3, offset 0x503 + {value: 0x0014, lo: 0x8f, hi: 0x9f}, + // Block 0xf4, offset 0x504 + {value: 0x0014, lo: 0xa0, hi: 0xa1}, + // Block 0xf5, offset 0x505 + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbc}, + // Block 0xf6, offset 0x507 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0034, lo: 0x9e, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa3}, + // Block 0xf7, offset 0x50c + {value: 0x0030, lo: 0xa5, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xa9}, + {value: 0x0030, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbf}, + // Block 0xf8, offset 0x511 + {value: 0x0034, lo: 0x80, hi: 0x82}, + {value: 0x0024, lo: 0x85, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8b}, + {value: 0x0024, lo: 0xaa, hi: 0xad}, + // Block 0xf9, offset 0x515 + {value: 0x0024, lo: 0x82, hi: 0x84}, + // Block 0xfa, offset 0x516 + {value: 0x0013, lo: 0x80, hi: 0x99}, + {value: 0x0012, lo: 0x9a, hi: 0xb3}, + {value: 0x0013, lo: 0xb4, hi: 0xbf}, + // Block 0xfb, offset 0x519 + {value: 0x0013, lo: 0x80, hi: 0x8d}, + {value: 0x0012, lo: 0x8e, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0xa7}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0xfc, offset 0x51d + {value: 0x0013, lo: 0x80, hi: 0x81}, + {value: 0x0012, lo: 0x82, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0x9c}, + {value: 0x0013, lo: 0x9e, hi: 0x9f}, + {value: 0x0013, lo: 0xa2, hi: 0xa2}, + {value: 0x0013, lo: 0xa5, hi: 0xa6}, + {value: 0x0013, lo: 0xa9, hi: 0xac}, + {value: 0x0013, lo: 0xae, hi: 0xb5}, + {value: 0x0012, lo: 0xb6, hi: 0xb9}, + {value: 0x0012, lo: 0xbb, hi: 0xbb}, + {value: 0x0012, lo: 0xbd, hi: 0xbf}, + // Block 0xfd, offset 0x528 + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0012, lo: 0x85, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0xfe, offset 0x52c + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0013, lo: 0x84, hi: 0x85}, + {value: 0x0013, lo: 0x87, hi: 0x8a}, + {value: 0x0013, lo: 0x8d, hi: 0x94}, + {value: 0x0013, lo: 0x96, hi: 0x9c}, + {value: 0x0012, lo: 0x9e, hi: 0xb7}, + {value: 0x0013, lo: 0xb8, hi: 0xb9}, + {value: 0x0013, lo: 0xbb, hi: 0xbe}, + // Block 0xff, offset 0x534 + {value: 0x0013, lo: 0x80, hi: 0x84}, + {value: 0x0013, lo: 0x86, hi: 0x86}, + {value: 0x0013, lo: 0x8a, hi: 0x90}, + {value: 0x0012, lo: 0x92, hi: 0xab}, + {value: 0x0013, lo: 0xac, hi: 0xbf}, + // Block 0x100, offset 0x539 + {value: 0x0013, lo: 0x80, hi: 0x85}, + {value: 0x0012, lo: 0x86, hi: 0x9f}, + {value: 0x0013, lo: 0xa0, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbf}, + // Block 0x101, offset 0x53d + {value: 0x0012, lo: 0x80, hi: 0x93}, + {value: 0x0013, lo: 0x94, hi: 0xad}, + {value: 0x0012, lo: 0xae, hi: 0xbf}, + // Block 0x102, offset 0x540 + {value: 0x0012, lo: 0x80, hi: 0x87}, + {value: 0x0013, lo: 0x88, hi: 0xa1}, + {value: 0x0012, lo: 0xa2, hi: 0xbb}, + {value: 0x0013, lo: 0xbc, hi: 0xbf}, + // Block 0x103, offset 0x544 + {value: 0x0013, lo: 0x80, hi: 0x95}, + {value: 0x0012, lo: 0x96, hi: 0xaf}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x104, offset 0x547 + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0012, lo: 0x8a, hi: 0xa5}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0x105, offset 0x54a + {value: 0x0013, lo: 0x80, hi: 0x80}, + {value: 0x0012, lo: 0x82, hi: 0x9a}, + {value: 0x0012, lo: 0x9c, hi: 0xa1}, + {value: 0x0013, lo: 0xa2, hi: 0xba}, + {value: 0x0012, lo: 0xbc, hi: 0xbf}, + // Block 0x106, offset 0x54f + {value: 0x0012, lo: 0x80, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0xb4}, + {value: 0x0012, lo: 0xb6, hi: 0xbf}, + // Block 0x107, offset 0x553 + {value: 0x0012, lo: 0x80, hi: 0x8e}, + {value: 0x0012, lo: 0x90, hi: 0x95}, + {value: 0x0013, lo: 0x96, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x108, offset 0x557 + {value: 0x0012, lo: 0x80, hi: 0x88}, + {value: 0x0012, lo: 0x8a, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0x109, offset 0x55b + {value: 0x0012, lo: 0x80, hi: 0x82}, + {value: 0x0012, lo: 0x84, hi: 0x89}, + {value: 0x0017, lo: 0x8a, hi: 0x8b}, + {value: 0x0010, lo: 0x8e, hi: 0xbf}, + // Block 0x10a, offset 0x55f + {value: 0x0014, lo: 0x80, hi: 0xb6}, + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x10b, offset 0x561 + {value: 0x0014, lo: 0x80, hi: 0xac}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x10c, offset 0x563 + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x9b, hi: 0x9f}, + {value: 0x0014, lo: 0xa1, hi: 0xaf}, + // Block 0x10d, offset 0x566 + {value: 0x0024, lo: 0x80, hi: 0x86}, + {value: 0x0024, lo: 0x88, hi: 0x98}, + {value: 0x0024, lo: 0x9b, hi: 0xa1}, + {value: 0x0024, lo: 0xa3, hi: 0xa4}, + {value: 0x0024, lo: 0xa6, hi: 0xaa}, + // Block 0x10e, offset 0x56b + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0034, lo: 0x90, hi: 0x96}, + // Block 0x10f, offset 0x56d + {value: 0xb852, lo: 0x80, hi: 0x81}, + {value: 0xbb52, lo: 0x82, hi: 0x83}, + {value: 0x0024, lo: 0x84, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x110, offset 0x572 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x9f}, + {value: 0x0010, lo: 0xa1, hi: 0xa2}, + {value: 0x0010, lo: 0xa4, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb7}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + // Block 0x111, offset 0x57b + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x9b}, + {value: 0x0010, lo: 0xa1, hi: 0xa3}, + {value: 0x0010, lo: 0xa5, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xbb}, + // Block 0x112, offset 0x580 + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x113, offset 0x581 + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x114, offset 0x584 + {value: 0x0013, lo: 0x80, hi: 0x89}, + // Block 0x115, offset 0x585 + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x116, offset 0x586 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0014, lo: 0xa0, hi: 0xbf}, + // Block 0x117, offset 0x588 + {value: 0x0014, lo: 0x80, hi: 0xbf}, + // Block 0x118, offset 0x589 + {value: 0x0014, lo: 0x80, hi: 0xaf}, +} + +// Total table size 14906 bytes (14KiB); checksum: 362795C7 diff --git a/vendor/golang.org/x/text/cases/tables12.0.0.go b/vendor/golang.org/x/text/cases/tables12.0.0.go new file mode 100644 index 0000000..ae7dc24 --- /dev/null +++ b/vendor/golang.org/x/text/cases/tables12.0.0.go @@ -0,0 +1,2360 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.14 && !go1.16 +// +build go1.14,!go1.16 + +package cases + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "12.0.0" + +var xorData string = "" + // Size: 192 bytes + "\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" + + "\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" + + "\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" + + "\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" + + "\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" + + "\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" + + "\x0b!\x10\x00\x0b!0\x001\x00\x00\x0b(\x04\x00\x03\x04\x1e\x00\x0b)\x08" + + "\x00\x03\x0a\x00\x02:\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<" + + "\x00\x01&\x00\x01*\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x01" + + "\x1e\x00\x01\x22" + +var exceptions string = "" + // Size: 2450 bytes + "\x00\x12\x12μΜΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x09II\x13\x1bʼnʼNʼN\x11" + + "\x09sSS\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ\x10\x12LJLj" + + "\x12\x12njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x1bǰJ̌J̌\x12\x12dzdzDz\x12\x12dzdzDZ\x10" + + "\x12DZDz\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x1bⱾⱾ\x10\x1bⱿⱿ\x10\x1bⱯⱯ\x10\x1bⱭⱭ\x10" + + "\x1bⱰⱰ\x10\x1bꞫꞫ\x10\x1bꞬꞬ\x10\x1bꞍꞍ\x10\x1bꞪꞪ\x10\x1bꞮꞮ\x10\x1bⱢⱢ\x10" + + "\x1bꞭꞭ\x10\x1bⱮⱮ\x10\x1bⱤⱤ\x10\x1bꟅꟅ\x10\x1bꞱꞱ\x10\x1bꞲꞲ\x10\x1bꞰꞰ2\x12ι" + + "ΙΙ\x166ΐΪ́Ϊ́\x166ΰΫ́Ϋ́\x12\x12σΣΣ\x12\x12βΒΒ\x12\x12θΘΘ\x12\x12" + + "φΦΦ\x12\x12πΠΠ\x12\x12κΚΚ\x12\x12ρΡΡ\x12\x12εΕΕ\x14$եւԵՒԵւ\x10\x1bᲐა" + + "\x10\x1bᲑბ\x10\x1bᲒგ\x10\x1bᲓდ\x10\x1bᲔე\x10\x1bᲕვ\x10\x1bᲖზ\x10\x1bᲗთ" + + "\x10\x1bᲘი\x10\x1bᲙკ\x10\x1bᲚლ\x10\x1bᲛმ\x10\x1bᲜნ\x10\x1bᲝო\x10\x1bᲞპ" + + "\x10\x1bᲟჟ\x10\x1bᲠრ\x10\x1bᲡს\x10\x1bᲢტ\x10\x1bᲣუ\x10\x1bᲤფ\x10\x1bᲥქ" + + "\x10\x1bᲦღ\x10\x1bᲧყ\x10\x1bᲨშ\x10\x1bᲩჩ\x10\x1bᲪც\x10\x1bᲫძ\x10\x1bᲬწ" + + "\x10\x1bᲭჭ\x10\x1bᲮხ\x10\x1bᲯჯ\x10\x1bᲰჰ\x10\x1bᲱჱ\x10\x1bᲲჲ\x10\x1bᲳჳ" + + "\x10\x1bᲴჴ\x10\x1bᲵჵ\x10\x1bᲶჶ\x10\x1bᲷჷ\x10\x1bᲸჸ\x10\x1bᲹჹ\x10\x1bᲺჺ" + + "\x10\x1bᲽჽ\x10\x1bᲾჾ\x10\x1bᲿჿ\x12\x12вВВ\x12\x12дДД\x12\x12оОО\x12\x12с" + + "СС\x12\x12тТТ\x12\x12тТТ\x12\x12ъЪЪ\x12\x12ѣѢѢ\x13\x1bꙋꙊꙊ\x13\x1bẖH̱H̱" + + "\x13\x1bẗT̈T̈\x13\x1bẘW̊W̊\x13\x1bẙY̊Y̊\x13\x1baʾAʾAʾ\x13\x1bṡṠṠ\x12" + + "\x10ssß\x14$ὐΥ̓Υ̓\x166ὒΥ̓̀Υ̓̀\x166ὔΥ̓́Υ̓́\x166ὖΥ̓͂Υ̓͂\x15+ἀιἈΙᾈ" + + "\x15+ἁιἉΙᾉ\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ" + + "\x15\x1dἀιᾀἈΙ\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ\x15\x1dἄιᾄἌΙ\x15" + + "\x1dἅιᾅἍΙ\x15\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ\x15+ἢιἪΙᾚ\x15+ἣι" + + "ἫΙᾛ\x15+ἤιἬΙᾜ\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨΙ\x15\x1dἡιᾑἩΙ" + + "\x15\x1dἢιᾒἪΙ\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15\x1dἦιᾖἮΙ\x15" + + "\x1dἧιᾗἯΙ\x15+ὠιὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ\x15+ὥιὭΙᾭ" + + "\x15+ὦιὮΙᾮ\x15+ὧιὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ\x15\x1dὣιᾣὫΙ" + + "\x15\x1dὤιᾤὬΙ\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰιᾺΙᾺͅ\x14#αιΑΙ" + + "ᾼ\x14$άιΆΙΆͅ\x14$ᾶΑ͂Α͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12\x12ιΙΙ\x15-ὴιῊΙ" + + "Ὴͅ\x14#ηιΗΙῌ\x14$ήιΉΙΉͅ\x14$ῆΗ͂Η͂\x166ῆιΗ͂Ιῌ͂\x14\x1cηιῃΗΙ\x166ῒΙ" + + "̈̀Ϊ̀\x166ΐΪ́Ϊ́\x14$ῖΙ͂Ι͂\x166ῗΪ͂Ϊ͂\x166ῢΫ̀Ϋ̀\x166ΰΫ́Ϋ" + + "́\x14$ῤΡ̓Ρ̓\x14$ῦΥ͂Υ͂\x166ῧΫ͂Ϋ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙῼ\x14$ώιΏΙΏͅ" + + "\x14$ῶΩ͂Ω͂\x166ῶιΩ͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk\x12\x10åå\x12" + + "\x10ɫɫ\x12\x10ɽɽ\x10\x12ȺȺ\x10\x12ȾȾ\x12\x10ɑɑ\x12\x10ɱɱ\x12\x10ɐɐ\x12" + + "\x10ɒɒ\x12\x10ȿȿ\x12\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ\x12\x10ɡɡ\x12" + + "\x10ɬɬ\x12\x10ɪɪ\x12\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x10ʂʂ\x12\x12ffFFFf" + + "\x12\x12fiFIFi\x12\x12flFLFl\x13\x1bffiFFIFfi\x13\x1bfflFFLFfl\x12\x12st" + + "STSt\x12\x12stSTSt\x14$մնՄՆՄն\x14$մեՄԵՄե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄԽՄ" + + "խ" + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// caseTrie. Total size: 12396 bytes (12.11 KiB). Checksum: c0656238384c3da1. +type caseTrie struct{} + +func newCaseTrie(i int) *caseTrie { + return &caseTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *caseTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 20: + return uint16(caseValues[n<<6+uint32(b)]) + default: + n -= 20 + return uint16(sparse.lookup(n, b)) + } +} + +// caseValues: 22 blocks, 1408 entries, 2816 bytes +// The third block is the zero block. +var caseValues = [1408]uint16{ + // Block 0x0, offset 0x0 + 0x27: 0x0054, + 0x2e: 0x0054, + 0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010, + 0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054, + // Block 0x1, offset 0x40 + 0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013, + 0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013, + 0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013, + 0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013, + 0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013, + 0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012, + 0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012, + 0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012, + 0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012, + 0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112, + 0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713, + 0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313, + 0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653, + 0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x0012, 0xdc: 0x1d53, 0xdd: 0x2c53, + 0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112, + 0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853, + 0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13, + 0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313, + 0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010, + 0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452, + // Block 0x4, offset 0x100 + 0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x02db, 0x105: 0x0359, + 0x106: 0x03da, 0x107: 0x043b, 0x108: 0x04b9, 0x109: 0x053a, 0x10a: 0x059b, 0x10b: 0x0619, + 0x10c: 0x069a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313, + 0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13, + 0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452, + 0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112, + 0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112, + 0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112, + 0x130: 0x06fa, 0x131: 0x07ab, 0x132: 0x0829, 0x133: 0x08aa, 0x134: 0x0113, 0x135: 0x0112, + 0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112, + 0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112, + // Block 0x5, offset 0x140 + 0x140: 0x0a8a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53, + 0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112, + 0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x0b0a, 0x151: 0x0b8a, + 0x152: 0x0c0a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152, + 0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x0c8a, 0x15d: 0x0012, + 0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x0d0a, 0x162: 0x0012, 0x163: 0x2052, + 0x164: 0x0012, 0x165: 0x0d8a, 0x166: 0x0e0a, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652, + 0x16a: 0x0e8a, 0x16b: 0x0f0a, 0x16c: 0x0f8a, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52, + 0x170: 0x0012, 0x171: 0x100a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252, + 0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012, + 0x17c: 0x0012, 0x17d: 0x108a, 0x17e: 0x0012, 0x17f: 0x0012, + // Block 0x6, offset 0x180 + 0x180: 0x3552, 0x181: 0x0012, 0x182: 0x110a, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012, + 0x186: 0x0012, 0x187: 0x118a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52, + 0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012, + 0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0012, 0x196: 0x0012, 0x197: 0x0012, + 0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x120a, + 0x19e: 0x128a, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012, + 0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012, + 0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012, + 0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015, + 0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014, + 0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x130d, + 0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024, + 0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024, + 0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024, + 0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034, + 0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024, + 0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024, + 0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024, + 0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004, + 0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52, + 0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353, + // Block 0x8, offset 0x200 + 0x204: 0x0004, 0x205: 0x0004, + 0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513, + 0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x138a, 0x211: 0x2013, + 0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013, + 0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013, + 0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53, + 0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53, + 0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512, + 0x230: 0x14ca, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012, + 0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012, + 0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012, + // Block 0x9, offset 0x240 + 0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x160a, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52, + 0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52, + 0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x168a, 0x251: 0x170a, + 0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x178a, 0x256: 0x180a, 0x257: 0x1812, + 0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112, + 0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112, + 0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112, + 0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112, + 0x270: 0x188a, 0x271: 0x190a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x198a, + 0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112, + 0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053, + // Block 0xa, offset 0x280 + 0x280: 0x6852, 0x281: 0x6852, 0x282: 0x6852, 0x283: 0x6852, 0x284: 0x6852, 0x285: 0x6852, + 0x286: 0x6852, 0x287: 0x1a0a, 0x288: 0x0012, + 0x291: 0x0034, + 0x292: 0x0024, 0x293: 0x0024, 0x294: 0x0024, 0x295: 0x0024, 0x296: 0x0034, 0x297: 0x0024, + 0x298: 0x0024, 0x299: 0x0024, 0x29a: 0x0034, 0x29b: 0x0034, 0x29c: 0x0024, 0x29d: 0x0024, + 0x29e: 0x0024, 0x29f: 0x0024, 0x2a0: 0x0024, 0x2a1: 0x0024, 0x2a2: 0x0034, 0x2a3: 0x0034, + 0x2a4: 0x0034, 0x2a5: 0x0034, 0x2a6: 0x0034, 0x2a7: 0x0034, 0x2a8: 0x0024, 0x2a9: 0x0024, + 0x2aa: 0x0034, 0x2ab: 0x0024, 0x2ac: 0x0024, 0x2ad: 0x0034, 0x2ae: 0x0034, 0x2af: 0x0024, + 0x2b0: 0x0034, 0x2b1: 0x0034, 0x2b2: 0x0034, 0x2b3: 0x0034, 0x2b4: 0x0034, 0x2b5: 0x0034, + 0x2b6: 0x0034, 0x2b7: 0x0034, 0x2b8: 0x0034, 0x2b9: 0x0034, 0x2ba: 0x0034, 0x2bb: 0x0034, + 0x2bc: 0x0034, 0x2bd: 0x0034, 0x2bf: 0x0034, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x7053, 0x2c1: 0x7053, 0x2c2: 0x7053, 0x2c3: 0x7053, 0x2c4: 0x7053, 0x2c5: 0x7053, + 0x2c7: 0x7053, + 0x2cd: 0x7053, 0x2d0: 0x1aea, 0x2d1: 0x1b6a, + 0x2d2: 0x1bea, 0x2d3: 0x1c6a, 0x2d4: 0x1cea, 0x2d5: 0x1d6a, 0x2d6: 0x1dea, 0x2d7: 0x1e6a, + 0x2d8: 0x1eea, 0x2d9: 0x1f6a, 0x2da: 0x1fea, 0x2db: 0x206a, 0x2dc: 0x20ea, 0x2dd: 0x216a, + 0x2de: 0x21ea, 0x2df: 0x226a, 0x2e0: 0x22ea, 0x2e1: 0x236a, 0x2e2: 0x23ea, 0x2e3: 0x246a, + 0x2e4: 0x24ea, 0x2e5: 0x256a, 0x2e6: 0x25ea, 0x2e7: 0x266a, 0x2e8: 0x26ea, 0x2e9: 0x276a, + 0x2ea: 0x27ea, 0x2eb: 0x286a, 0x2ec: 0x28ea, 0x2ed: 0x296a, 0x2ee: 0x29ea, 0x2ef: 0x2a6a, + 0x2f0: 0x2aea, 0x2f1: 0x2b6a, 0x2f2: 0x2bea, 0x2f3: 0x2c6a, 0x2f4: 0x2cea, 0x2f5: 0x2d6a, + 0x2f6: 0x2dea, 0x2f7: 0x2e6a, 0x2f8: 0x2eea, 0x2f9: 0x2f6a, 0x2fa: 0x2fea, + 0x2fc: 0x0014, 0x2fd: 0x306a, 0x2fe: 0x30ea, 0x2ff: 0x316a, + // Block 0xc, offset 0x300 + 0x300: 0x0812, 0x301: 0x0812, 0x302: 0x0812, 0x303: 0x0812, 0x304: 0x0812, 0x305: 0x0812, + 0x308: 0x0813, 0x309: 0x0813, 0x30a: 0x0813, 0x30b: 0x0813, + 0x30c: 0x0813, 0x30d: 0x0813, 0x310: 0x3b1a, 0x311: 0x0812, + 0x312: 0x3bfa, 0x313: 0x0812, 0x314: 0x3d3a, 0x315: 0x0812, 0x316: 0x3e7a, 0x317: 0x0812, + 0x319: 0x0813, 0x31b: 0x0813, 0x31d: 0x0813, + 0x31f: 0x0813, 0x320: 0x0812, 0x321: 0x0812, 0x322: 0x0812, 0x323: 0x0812, + 0x324: 0x0812, 0x325: 0x0812, 0x326: 0x0812, 0x327: 0x0812, 0x328: 0x0813, 0x329: 0x0813, + 0x32a: 0x0813, 0x32b: 0x0813, 0x32c: 0x0813, 0x32d: 0x0813, 0x32e: 0x0813, 0x32f: 0x0813, + 0x330: 0x9252, 0x331: 0x9252, 0x332: 0x9552, 0x333: 0x9552, 0x334: 0x9852, 0x335: 0x9852, + 0x336: 0x9b52, 0x337: 0x9b52, 0x338: 0x9e52, 0x339: 0x9e52, 0x33a: 0xa152, 0x33b: 0xa152, + 0x33c: 0x4d52, 0x33d: 0x4d52, + // Block 0xd, offset 0x340 + 0x340: 0x3fba, 0x341: 0x40aa, 0x342: 0x419a, 0x343: 0x428a, 0x344: 0x437a, 0x345: 0x446a, + 0x346: 0x455a, 0x347: 0x464a, 0x348: 0x4739, 0x349: 0x4829, 0x34a: 0x4919, 0x34b: 0x4a09, + 0x34c: 0x4af9, 0x34d: 0x4be9, 0x34e: 0x4cd9, 0x34f: 0x4dc9, 0x350: 0x4eba, 0x351: 0x4faa, + 0x352: 0x509a, 0x353: 0x518a, 0x354: 0x527a, 0x355: 0x536a, 0x356: 0x545a, 0x357: 0x554a, + 0x358: 0x5639, 0x359: 0x5729, 0x35a: 0x5819, 0x35b: 0x5909, 0x35c: 0x59f9, 0x35d: 0x5ae9, + 0x35e: 0x5bd9, 0x35f: 0x5cc9, 0x360: 0x5dba, 0x361: 0x5eaa, 0x362: 0x5f9a, 0x363: 0x608a, + 0x364: 0x617a, 0x365: 0x626a, 0x366: 0x635a, 0x367: 0x644a, 0x368: 0x6539, 0x369: 0x6629, + 0x36a: 0x6719, 0x36b: 0x6809, 0x36c: 0x68f9, 0x36d: 0x69e9, 0x36e: 0x6ad9, 0x36f: 0x6bc9, + 0x370: 0x0812, 0x371: 0x0812, 0x372: 0x6cba, 0x373: 0x6dca, 0x374: 0x6e9a, + 0x376: 0x6f7a, 0x377: 0x705a, 0x378: 0x0813, 0x379: 0x0813, 0x37a: 0x9253, 0x37b: 0x9253, + 0x37c: 0x7199, 0x37d: 0x0004, 0x37e: 0x726a, 0x37f: 0x0004, + // Block 0xe, offset 0x380 + 0x380: 0x0004, 0x381: 0x0004, 0x382: 0x72ea, 0x383: 0x73fa, 0x384: 0x74ca, + 0x386: 0x75aa, 0x387: 0x768a, 0x388: 0x9553, 0x389: 0x9553, 0x38a: 0x9853, 0x38b: 0x9853, + 0x38c: 0x77c9, 0x38d: 0x0004, 0x38e: 0x0004, 0x38f: 0x0004, 0x390: 0x0812, 0x391: 0x0812, + 0x392: 0x789a, 0x393: 0x79da, 0x396: 0x7b1a, 0x397: 0x7bfa, + 0x398: 0x0813, 0x399: 0x0813, 0x39a: 0x9b53, 0x39b: 0x9b53, 0x39d: 0x0004, + 0x39e: 0x0004, 0x39f: 0x0004, 0x3a0: 0x0812, 0x3a1: 0x0812, 0x3a2: 0x7d3a, 0x3a3: 0x7e7a, + 0x3a4: 0x7fba, 0x3a5: 0x0912, 0x3a6: 0x809a, 0x3a7: 0x817a, 0x3a8: 0x0813, 0x3a9: 0x0813, + 0x3aa: 0xa153, 0x3ab: 0xa153, 0x3ac: 0x0913, 0x3ad: 0x0004, 0x3ae: 0x0004, 0x3af: 0x0004, + 0x3b2: 0x82ba, 0x3b3: 0x83ca, 0x3b4: 0x849a, + 0x3b6: 0x857a, 0x3b7: 0x865a, 0x3b8: 0x9e53, 0x3b9: 0x9e53, 0x3ba: 0x4d53, 0x3bb: 0x4d53, + 0x3bc: 0x8799, 0x3bd: 0x0004, 0x3be: 0x0004, + // Block 0xf, offset 0x3c0 + 0x3c2: 0x0013, + 0x3c7: 0x0013, 0x3ca: 0x0012, 0x3cb: 0x0013, + 0x3cc: 0x0013, 0x3cd: 0x0013, 0x3ce: 0x0012, 0x3cf: 0x0012, 0x3d0: 0x0013, 0x3d1: 0x0013, + 0x3d2: 0x0013, 0x3d3: 0x0012, 0x3d5: 0x0013, + 0x3d9: 0x0013, 0x3da: 0x0013, 0x3db: 0x0013, 0x3dc: 0x0013, 0x3dd: 0x0013, + 0x3e4: 0x0013, 0x3e6: 0x886b, 0x3e8: 0x0013, + 0x3ea: 0x88cb, 0x3eb: 0x890b, 0x3ec: 0x0013, 0x3ed: 0x0013, 0x3ef: 0x0012, + 0x3f0: 0x0013, 0x3f1: 0x0013, 0x3f2: 0xa453, 0x3f3: 0x0013, 0x3f4: 0x0012, 0x3f5: 0x0010, + 0x3f6: 0x0010, 0x3f7: 0x0010, 0x3f8: 0x0010, 0x3f9: 0x0012, + 0x3fc: 0x0012, 0x3fd: 0x0012, 0x3fe: 0x0013, 0x3ff: 0x0013, + // Block 0x10, offset 0x400 + 0x400: 0x1a13, 0x401: 0x1a13, 0x402: 0x1e13, 0x403: 0x1e13, 0x404: 0x1a13, 0x405: 0x1a13, + 0x406: 0x2613, 0x407: 0x2613, 0x408: 0x2a13, 0x409: 0x2a13, 0x40a: 0x2e13, 0x40b: 0x2e13, + 0x40c: 0x2a13, 0x40d: 0x2a13, 0x40e: 0x2613, 0x40f: 0x2613, 0x410: 0xa752, 0x411: 0xa752, + 0x412: 0xaa52, 0x413: 0xaa52, 0x414: 0xad52, 0x415: 0xad52, 0x416: 0xaa52, 0x417: 0xaa52, + 0x418: 0xa752, 0x419: 0xa752, 0x41a: 0x1a12, 0x41b: 0x1a12, 0x41c: 0x1e12, 0x41d: 0x1e12, + 0x41e: 0x1a12, 0x41f: 0x1a12, 0x420: 0x2612, 0x421: 0x2612, 0x422: 0x2a12, 0x423: 0x2a12, + 0x424: 0x2e12, 0x425: 0x2e12, 0x426: 0x2a12, 0x427: 0x2a12, 0x428: 0x2612, 0x429: 0x2612, + // Block 0x11, offset 0x440 + 0x440: 0x6552, 0x441: 0x6552, 0x442: 0x6552, 0x443: 0x6552, 0x444: 0x6552, 0x445: 0x6552, + 0x446: 0x6552, 0x447: 0x6552, 0x448: 0x6552, 0x449: 0x6552, 0x44a: 0x6552, 0x44b: 0x6552, + 0x44c: 0x6552, 0x44d: 0x6552, 0x44e: 0x6552, 0x44f: 0x6552, 0x450: 0xb052, 0x451: 0xb052, + 0x452: 0xb052, 0x453: 0xb052, 0x454: 0xb052, 0x455: 0xb052, 0x456: 0xb052, 0x457: 0xb052, + 0x458: 0xb052, 0x459: 0xb052, 0x45a: 0xb052, 0x45b: 0xb052, 0x45c: 0xb052, 0x45d: 0xb052, + 0x45e: 0xb052, 0x460: 0x0113, 0x461: 0x0112, 0x462: 0x896b, 0x463: 0x8b53, + 0x464: 0x89cb, 0x465: 0x8a2a, 0x466: 0x8a8a, 0x467: 0x0f13, 0x468: 0x0f12, 0x469: 0x0313, + 0x46a: 0x0312, 0x46b: 0x0713, 0x46c: 0x0712, 0x46d: 0x8aeb, 0x46e: 0x8b4b, 0x46f: 0x8bab, + 0x470: 0x8c0b, 0x471: 0x0012, 0x472: 0x0113, 0x473: 0x0112, 0x474: 0x0012, 0x475: 0x0313, + 0x476: 0x0312, 0x477: 0x0012, 0x478: 0x0012, 0x479: 0x0012, 0x47a: 0x0012, 0x47b: 0x0012, + 0x47c: 0x0015, 0x47d: 0x0015, 0x47e: 0x8c6b, 0x47f: 0x8ccb, + // Block 0x12, offset 0x480 + 0x480: 0x0113, 0x481: 0x0112, 0x482: 0x0113, 0x483: 0x0112, 0x484: 0x0113, 0x485: 0x0112, + 0x486: 0x0113, 0x487: 0x0112, 0x488: 0x0014, 0x489: 0x0014, 0x48a: 0x0014, 0x48b: 0x0713, + 0x48c: 0x0712, 0x48d: 0x8d2b, 0x48e: 0x0012, 0x48f: 0x0010, 0x490: 0x0113, 0x491: 0x0112, + 0x492: 0x0113, 0x493: 0x0112, 0x494: 0x6552, 0x495: 0x0012, 0x496: 0x0113, 0x497: 0x0112, + 0x498: 0x0113, 0x499: 0x0112, 0x49a: 0x0113, 0x49b: 0x0112, 0x49c: 0x0113, 0x49d: 0x0112, + 0x49e: 0x0113, 0x49f: 0x0112, 0x4a0: 0x0113, 0x4a1: 0x0112, 0x4a2: 0x0113, 0x4a3: 0x0112, + 0x4a4: 0x0113, 0x4a5: 0x0112, 0x4a6: 0x0113, 0x4a7: 0x0112, 0x4a8: 0x0113, 0x4a9: 0x0112, + 0x4aa: 0x8d8b, 0x4ab: 0x8deb, 0x4ac: 0x8e4b, 0x4ad: 0x8eab, 0x4ae: 0x8f0b, 0x4af: 0x0012, + 0x4b0: 0x8f6b, 0x4b1: 0x8fcb, 0x4b2: 0x902b, 0x4b3: 0xb353, 0x4b4: 0x0113, 0x4b5: 0x0112, + 0x4b6: 0x0113, 0x4b7: 0x0112, 0x4b8: 0x0113, 0x4b9: 0x0112, 0x4ba: 0x0113, 0x4bb: 0x0112, + 0x4bc: 0x0113, 0x4bd: 0x0112, 0x4be: 0x0113, 0x4bf: 0x0112, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x90ea, 0x4c1: 0x916a, 0x4c2: 0x91ea, 0x4c3: 0x926a, 0x4c4: 0x931a, 0x4c5: 0x93ca, + 0x4c6: 0x944a, + 0x4d3: 0x94ca, 0x4d4: 0x95aa, 0x4d5: 0x968a, 0x4d6: 0x976a, 0x4d7: 0x984a, + 0x4dd: 0x0010, + 0x4de: 0x0034, 0x4df: 0x0010, 0x4e0: 0x0010, 0x4e1: 0x0010, 0x4e2: 0x0010, 0x4e3: 0x0010, + 0x4e4: 0x0010, 0x4e5: 0x0010, 0x4e6: 0x0010, 0x4e7: 0x0010, 0x4e8: 0x0010, + 0x4ea: 0x0010, 0x4eb: 0x0010, 0x4ec: 0x0010, 0x4ed: 0x0010, 0x4ee: 0x0010, 0x4ef: 0x0010, + 0x4f0: 0x0010, 0x4f1: 0x0010, 0x4f2: 0x0010, 0x4f3: 0x0010, 0x4f4: 0x0010, 0x4f5: 0x0010, + 0x4f6: 0x0010, 0x4f8: 0x0010, 0x4f9: 0x0010, 0x4fa: 0x0010, 0x4fb: 0x0010, + 0x4fc: 0x0010, 0x4fe: 0x0010, + // Block 0x14, offset 0x500 + 0x500: 0x2213, 0x501: 0x2213, 0x502: 0x2613, 0x503: 0x2613, 0x504: 0x2213, 0x505: 0x2213, + 0x506: 0x2e13, 0x507: 0x2e13, 0x508: 0x2213, 0x509: 0x2213, 0x50a: 0x2613, 0x50b: 0x2613, + 0x50c: 0x2213, 0x50d: 0x2213, 0x50e: 0x3e13, 0x50f: 0x3e13, 0x510: 0x2213, 0x511: 0x2213, + 0x512: 0x2613, 0x513: 0x2613, 0x514: 0x2213, 0x515: 0x2213, 0x516: 0x2e13, 0x517: 0x2e13, + 0x518: 0x2213, 0x519: 0x2213, 0x51a: 0x2613, 0x51b: 0x2613, 0x51c: 0x2213, 0x51d: 0x2213, + 0x51e: 0xbc53, 0x51f: 0xbc53, 0x520: 0xbf53, 0x521: 0xbf53, 0x522: 0x2212, 0x523: 0x2212, + 0x524: 0x2612, 0x525: 0x2612, 0x526: 0x2212, 0x527: 0x2212, 0x528: 0x2e12, 0x529: 0x2e12, + 0x52a: 0x2212, 0x52b: 0x2212, 0x52c: 0x2612, 0x52d: 0x2612, 0x52e: 0x2212, 0x52f: 0x2212, + 0x530: 0x3e12, 0x531: 0x3e12, 0x532: 0x2212, 0x533: 0x2212, 0x534: 0x2612, 0x535: 0x2612, + 0x536: 0x2212, 0x537: 0x2212, 0x538: 0x2e12, 0x539: 0x2e12, 0x53a: 0x2212, 0x53b: 0x2212, + 0x53c: 0x2612, 0x53d: 0x2612, 0x53e: 0x2212, 0x53f: 0x2212, + // Block 0x15, offset 0x540 + 0x542: 0x0010, + 0x547: 0x0010, 0x549: 0x0010, 0x54b: 0x0010, + 0x54d: 0x0010, 0x54e: 0x0010, 0x54f: 0x0010, 0x551: 0x0010, + 0x552: 0x0010, 0x554: 0x0010, 0x557: 0x0010, + 0x559: 0x0010, 0x55b: 0x0010, 0x55d: 0x0010, + 0x55f: 0x0010, 0x561: 0x0010, 0x562: 0x0010, + 0x564: 0x0010, 0x567: 0x0010, 0x568: 0x0010, 0x569: 0x0010, + 0x56a: 0x0010, 0x56c: 0x0010, 0x56d: 0x0010, 0x56e: 0x0010, 0x56f: 0x0010, + 0x570: 0x0010, 0x571: 0x0010, 0x572: 0x0010, 0x574: 0x0010, 0x575: 0x0010, + 0x576: 0x0010, 0x577: 0x0010, 0x579: 0x0010, 0x57a: 0x0010, 0x57b: 0x0010, + 0x57c: 0x0010, 0x57e: 0x0010, +} + +// caseIndex: 25 blocks, 1600 entries, 3200 bytes +// Block 0 is the zero block. +var caseIndex = [1600]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x14, 0xc3: 0x15, 0xc4: 0x16, 0xc5: 0x17, 0xc6: 0x01, 0xc7: 0x02, + 0xc8: 0x18, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x19, 0xcc: 0x1a, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07, + 0xd0: 0x1b, 0xd1: 0x1c, 0xd2: 0x1d, 0xd3: 0x1e, 0xd4: 0x1f, 0xd5: 0x20, 0xd6: 0x08, 0xd7: 0x21, + 0xd8: 0x22, 0xd9: 0x23, 0xda: 0x24, 0xdb: 0x25, 0xdc: 0x26, 0xdd: 0x27, 0xde: 0x28, 0xdf: 0x29, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09, + 0xf0: 0x14, 0xf3: 0x16, + // Block 0x4, offset 0x100 + 0x120: 0x2a, 0x121: 0x2b, 0x122: 0x2c, 0x123: 0x2d, 0x124: 0x2e, 0x125: 0x2f, 0x126: 0x30, 0x127: 0x31, + 0x128: 0x32, 0x129: 0x33, 0x12a: 0x34, 0x12b: 0x35, 0x12c: 0x36, 0x12d: 0x37, 0x12e: 0x38, 0x12f: 0x39, + 0x130: 0x3a, 0x131: 0x3b, 0x132: 0x3c, 0x133: 0x3d, 0x134: 0x3e, 0x135: 0x3f, 0x136: 0x40, 0x137: 0x41, + 0x138: 0x42, 0x139: 0x43, 0x13a: 0x44, 0x13b: 0x45, 0x13c: 0x46, 0x13d: 0x47, 0x13e: 0x48, 0x13f: 0x49, + // Block 0x5, offset 0x140 + 0x140: 0x4a, 0x141: 0x4b, 0x142: 0x4c, 0x143: 0x09, 0x144: 0x24, 0x145: 0x24, 0x146: 0x24, 0x147: 0x24, + 0x148: 0x24, 0x149: 0x4d, 0x14a: 0x4e, 0x14b: 0x4f, 0x14c: 0x50, 0x14d: 0x51, 0x14e: 0x52, 0x14f: 0x53, + 0x150: 0x54, 0x151: 0x24, 0x152: 0x24, 0x153: 0x24, 0x154: 0x24, 0x155: 0x24, 0x156: 0x24, 0x157: 0x24, + 0x158: 0x24, 0x159: 0x55, 0x15a: 0x56, 0x15b: 0x57, 0x15c: 0x58, 0x15d: 0x59, 0x15e: 0x5a, 0x15f: 0x5b, + 0x160: 0x5c, 0x161: 0x5d, 0x162: 0x5e, 0x163: 0x5f, 0x164: 0x60, 0x165: 0x61, 0x167: 0x62, + 0x168: 0x63, 0x169: 0x64, 0x16a: 0x65, 0x16c: 0x66, 0x16d: 0x67, 0x16e: 0x68, 0x16f: 0x69, + 0x170: 0x6a, 0x171: 0x6b, 0x172: 0x6c, 0x173: 0x6d, 0x174: 0x6e, 0x175: 0x6f, 0x176: 0x70, 0x177: 0x71, + 0x178: 0x72, 0x179: 0x72, 0x17a: 0x73, 0x17b: 0x72, 0x17c: 0x74, 0x17d: 0x0a, 0x17e: 0x0b, 0x17f: 0x0c, + // Block 0x6, offset 0x180 + 0x180: 0x75, 0x181: 0x76, 0x182: 0x77, 0x183: 0x78, 0x184: 0x0d, 0x185: 0x79, 0x186: 0x7a, + 0x192: 0x7b, 0x193: 0x0e, + 0x1b0: 0x7c, 0x1b1: 0x0f, 0x1b2: 0x72, 0x1b3: 0x7d, 0x1b4: 0x7e, 0x1b5: 0x7f, 0x1b6: 0x80, 0x1b7: 0x81, + 0x1b8: 0x82, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x83, 0x1c2: 0x84, 0x1c3: 0x85, 0x1c4: 0x86, 0x1c5: 0x24, 0x1c6: 0x87, + // Block 0x8, offset 0x200 + 0x200: 0x88, 0x201: 0x24, 0x202: 0x24, 0x203: 0x24, 0x204: 0x24, 0x205: 0x24, 0x206: 0x24, 0x207: 0x24, + 0x208: 0x24, 0x209: 0x24, 0x20a: 0x24, 0x20b: 0x24, 0x20c: 0x24, 0x20d: 0x24, 0x20e: 0x24, 0x20f: 0x24, + 0x210: 0x24, 0x211: 0x24, 0x212: 0x89, 0x213: 0x8a, 0x214: 0x24, 0x215: 0x24, 0x216: 0x24, 0x217: 0x24, + 0x218: 0x8b, 0x219: 0x8c, 0x21a: 0x8d, 0x21b: 0x8e, 0x21c: 0x8f, 0x21d: 0x90, 0x21e: 0x10, 0x21f: 0x91, + 0x220: 0x92, 0x221: 0x93, 0x222: 0x24, 0x223: 0x94, 0x224: 0x95, 0x225: 0x96, 0x226: 0x97, 0x227: 0x98, + 0x228: 0x99, 0x229: 0x9a, 0x22a: 0x9b, 0x22b: 0x9c, 0x22c: 0x9d, 0x22d: 0x9e, 0x22e: 0x9f, 0x22f: 0xa0, + 0x230: 0x24, 0x231: 0x24, 0x232: 0x24, 0x233: 0x24, 0x234: 0x24, 0x235: 0x24, 0x236: 0x24, 0x237: 0x24, + 0x238: 0x24, 0x239: 0x24, 0x23a: 0x24, 0x23b: 0x24, 0x23c: 0x24, 0x23d: 0x24, 0x23e: 0x24, 0x23f: 0x24, + // Block 0x9, offset 0x240 + 0x240: 0x24, 0x241: 0x24, 0x242: 0x24, 0x243: 0x24, 0x244: 0x24, 0x245: 0x24, 0x246: 0x24, 0x247: 0x24, + 0x248: 0x24, 0x249: 0x24, 0x24a: 0x24, 0x24b: 0x24, 0x24c: 0x24, 0x24d: 0x24, 0x24e: 0x24, 0x24f: 0x24, + 0x250: 0x24, 0x251: 0x24, 0x252: 0x24, 0x253: 0x24, 0x254: 0x24, 0x255: 0x24, 0x256: 0x24, 0x257: 0x24, + 0x258: 0x24, 0x259: 0x24, 0x25a: 0x24, 0x25b: 0x24, 0x25c: 0x24, 0x25d: 0x24, 0x25e: 0x24, 0x25f: 0x24, + 0x260: 0x24, 0x261: 0x24, 0x262: 0x24, 0x263: 0x24, 0x264: 0x24, 0x265: 0x24, 0x266: 0x24, 0x267: 0x24, + 0x268: 0x24, 0x269: 0x24, 0x26a: 0x24, 0x26b: 0x24, 0x26c: 0x24, 0x26d: 0x24, 0x26e: 0x24, 0x26f: 0x24, + 0x270: 0x24, 0x271: 0x24, 0x272: 0x24, 0x273: 0x24, 0x274: 0x24, 0x275: 0x24, 0x276: 0x24, 0x277: 0x24, + 0x278: 0x24, 0x279: 0x24, 0x27a: 0x24, 0x27b: 0x24, 0x27c: 0x24, 0x27d: 0x24, 0x27e: 0x24, 0x27f: 0x24, + // Block 0xa, offset 0x280 + 0x280: 0x24, 0x281: 0x24, 0x282: 0x24, 0x283: 0x24, 0x284: 0x24, 0x285: 0x24, 0x286: 0x24, 0x287: 0x24, + 0x288: 0x24, 0x289: 0x24, 0x28a: 0x24, 0x28b: 0x24, 0x28c: 0x24, 0x28d: 0x24, 0x28e: 0x24, 0x28f: 0x24, + 0x290: 0x24, 0x291: 0x24, 0x292: 0x24, 0x293: 0x24, 0x294: 0x24, 0x295: 0x24, 0x296: 0x24, 0x297: 0x24, + 0x298: 0x24, 0x299: 0x24, 0x29a: 0x24, 0x29b: 0x24, 0x29c: 0x24, 0x29d: 0x24, 0x29e: 0xa1, 0x29f: 0xa2, + // Block 0xb, offset 0x2c0 + 0x2ec: 0x11, 0x2ed: 0xa3, 0x2ee: 0xa4, 0x2ef: 0xa5, + 0x2f0: 0x24, 0x2f1: 0x24, 0x2f2: 0x24, 0x2f3: 0x24, 0x2f4: 0xa6, 0x2f5: 0xa7, 0x2f6: 0xa8, 0x2f7: 0xa9, + 0x2f8: 0xaa, 0x2f9: 0xab, 0x2fa: 0x24, 0x2fb: 0xac, 0x2fc: 0xad, 0x2fd: 0xae, 0x2fe: 0xaf, 0x2ff: 0xb0, + // Block 0xc, offset 0x300 + 0x300: 0xb1, 0x301: 0xb2, 0x302: 0x24, 0x303: 0xb3, 0x305: 0xb4, 0x307: 0xb5, + 0x30a: 0xb6, 0x30b: 0xb7, 0x30c: 0xb8, 0x30d: 0xb9, 0x30e: 0xba, 0x30f: 0xbb, + 0x310: 0xbc, 0x311: 0xbd, 0x312: 0xbe, 0x313: 0xbf, 0x314: 0xc0, 0x315: 0xc1, + 0x318: 0x24, 0x319: 0x24, 0x31a: 0x24, 0x31b: 0x24, 0x31c: 0xc2, 0x31d: 0xc3, + 0x320: 0xc4, 0x321: 0xc5, 0x322: 0xc6, 0x323: 0xc7, 0x324: 0xc8, 0x326: 0xc9, + 0x328: 0xca, 0x329: 0xcb, 0x32a: 0xcc, 0x32b: 0xcd, 0x32c: 0x5f, 0x32d: 0xce, 0x32e: 0xcf, + 0x330: 0x24, 0x331: 0xd0, 0x332: 0xd1, 0x333: 0xd2, 0x334: 0xd3, + 0x33c: 0xd4, 0x33d: 0xd5, 0x33f: 0xd6, + // Block 0xd, offset 0x340 + 0x340: 0xd7, 0x341: 0xd8, 0x342: 0xd9, 0x343: 0xda, 0x344: 0xdb, 0x345: 0xdc, 0x346: 0xdd, 0x347: 0xde, + 0x348: 0xdf, 0x34a: 0xe0, 0x34b: 0xe1, 0x34c: 0xe2, 0x34d: 0xe3, + 0x350: 0xe4, 0x351: 0xe5, 0x352: 0xe6, 0x353: 0xe7, 0x356: 0xe8, 0x357: 0xe9, + 0x358: 0xea, 0x359: 0xeb, 0x35a: 0xec, 0x35b: 0xed, 0x35c: 0xee, + 0x360: 0xef, 0x362: 0xf0, 0x363: 0xf1, 0x366: 0xf2, 0x367: 0xf3, + 0x368: 0xf4, 0x369: 0xf5, 0x36a: 0xf6, 0x36b: 0xf7, + 0x370: 0xf8, 0x371: 0xf9, 0x372: 0xfa, 0x374: 0xfb, 0x375: 0xfc, 0x376: 0xfd, + 0x37b: 0xfe, + // Block 0xe, offset 0x380 + 0x380: 0x24, 0x381: 0x24, 0x382: 0x24, 0x383: 0x24, 0x384: 0x24, 0x385: 0x24, 0x386: 0x24, 0x387: 0x24, + 0x388: 0x24, 0x389: 0x24, 0x38a: 0x24, 0x38b: 0x24, 0x38c: 0x24, 0x38d: 0x24, 0x38e: 0xff, + 0x390: 0x24, 0x391: 0x100, 0x392: 0x24, 0x393: 0x24, 0x394: 0x24, 0x395: 0x101, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x24, 0x3c1: 0x24, 0x3c2: 0x24, 0x3c3: 0x24, 0x3c4: 0x24, 0x3c5: 0x24, 0x3c6: 0x24, 0x3c7: 0x24, + 0x3c8: 0x24, 0x3c9: 0x24, 0x3ca: 0x24, 0x3cb: 0x24, 0x3cc: 0x24, 0x3cd: 0x24, 0x3ce: 0x24, 0x3cf: 0x24, + 0x3d0: 0x102, + // Block 0x10, offset 0x400 + 0x410: 0x24, 0x411: 0x24, 0x412: 0x24, 0x413: 0x24, 0x414: 0x24, 0x415: 0x24, 0x416: 0x24, 0x417: 0x24, + 0x418: 0x24, 0x419: 0x103, + // Block 0x11, offset 0x440 + 0x460: 0x24, 0x461: 0x24, 0x462: 0x24, 0x463: 0x24, 0x464: 0x24, 0x465: 0x24, 0x466: 0x24, 0x467: 0x24, + 0x468: 0xf7, 0x469: 0x104, 0x46b: 0x105, 0x46c: 0x106, 0x46d: 0x107, 0x46e: 0x108, + 0x479: 0x109, 0x47c: 0x24, 0x47d: 0x10a, 0x47e: 0x10b, 0x47f: 0x10c, + // Block 0x12, offset 0x480 + 0x4b0: 0x24, 0x4b1: 0x10d, 0x4b2: 0x10e, + // Block 0x13, offset 0x4c0 + 0x4c5: 0x10f, 0x4c6: 0x110, + 0x4c9: 0x111, + 0x4d0: 0x112, 0x4d1: 0x113, 0x4d2: 0x114, 0x4d3: 0x115, 0x4d4: 0x116, 0x4d5: 0x117, 0x4d6: 0x118, 0x4d7: 0x119, + 0x4d8: 0x11a, 0x4d9: 0x11b, 0x4da: 0x11c, 0x4db: 0x11d, 0x4dc: 0x11e, 0x4dd: 0x11f, 0x4de: 0x120, 0x4df: 0x121, + 0x4e8: 0x122, 0x4e9: 0x123, 0x4ea: 0x124, + // Block 0x14, offset 0x500 + 0x500: 0x125, 0x504: 0x126, 0x505: 0x127, + 0x50b: 0x128, + 0x520: 0x24, 0x521: 0x24, 0x522: 0x24, 0x523: 0x129, 0x524: 0x12, 0x525: 0x12a, + 0x538: 0x12b, 0x539: 0x13, 0x53a: 0x12c, + // Block 0x15, offset 0x540 + 0x544: 0x12d, 0x545: 0x12e, 0x546: 0x12f, + 0x54f: 0x130, + // Block 0x16, offset 0x580 + 0x590: 0x0a, 0x591: 0x0b, 0x592: 0x0c, 0x593: 0x0d, 0x594: 0x0e, 0x596: 0x0f, + 0x59b: 0x10, 0x59d: 0x11, 0x59e: 0x12, 0x59f: 0x13, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x131, 0x5c1: 0x132, 0x5c4: 0x132, 0x5c5: 0x132, 0x5c6: 0x132, 0x5c7: 0x133, + // Block 0x18, offset 0x600 + 0x620: 0x15, +} + +// sparseOffsets: 289 entries, 578 bytes +var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x35, 0x38, 0x3c, 0x3f, 0x43, 0x4d, 0x4f, 0x57, 0x5e, 0x63, 0x71, 0x72, 0x80, 0x8f, 0x99, 0x9c, 0xa3, 0xab, 0xae, 0xb0, 0xbf, 0xc5, 0xd3, 0xde, 0xeb, 0xf6, 0x102, 0x10c, 0x118, 0x123, 0x12f, 0x13b, 0x143, 0x14c, 0x156, 0x161, 0x16d, 0x174, 0x17f, 0x184, 0x18c, 0x18f, 0x194, 0x198, 0x19c, 0x1a3, 0x1ac, 0x1b4, 0x1b5, 0x1be, 0x1c5, 0x1cd, 0x1d3, 0x1d8, 0x1dc, 0x1df, 0x1e1, 0x1e4, 0x1e9, 0x1ea, 0x1ec, 0x1ee, 0x1f0, 0x1f7, 0x1fc, 0x200, 0x209, 0x20c, 0x20f, 0x215, 0x216, 0x221, 0x222, 0x223, 0x228, 0x235, 0x23d, 0x245, 0x24e, 0x257, 0x260, 0x265, 0x268, 0x273, 0x281, 0x283, 0x28a, 0x28e, 0x29a, 0x29b, 0x2a6, 0x2ae, 0x2b6, 0x2bc, 0x2bd, 0x2cb, 0x2d0, 0x2d3, 0x2d8, 0x2dc, 0x2e2, 0x2e7, 0x2ea, 0x2ef, 0x2f4, 0x2f5, 0x2fb, 0x2fd, 0x2fe, 0x300, 0x302, 0x305, 0x306, 0x308, 0x30b, 0x311, 0x315, 0x317, 0x31c, 0x323, 0x32b, 0x334, 0x335, 0x33e, 0x342, 0x347, 0x34f, 0x355, 0x35b, 0x365, 0x36a, 0x373, 0x379, 0x380, 0x384, 0x38c, 0x38e, 0x390, 0x393, 0x395, 0x397, 0x398, 0x399, 0x39b, 0x39d, 0x3a3, 0x3a8, 0x3aa, 0x3b1, 0x3b4, 0x3b6, 0x3bc, 0x3c1, 0x3c3, 0x3c4, 0x3c5, 0x3c6, 0x3c8, 0x3ca, 0x3cc, 0x3cf, 0x3d1, 0x3d4, 0x3dc, 0x3df, 0x3e3, 0x3eb, 0x3ed, 0x3ee, 0x3ef, 0x3f1, 0x3f7, 0x3f9, 0x3fa, 0x3fc, 0x3fe, 0x400, 0x40d, 0x40e, 0x40f, 0x413, 0x415, 0x416, 0x417, 0x418, 0x419, 0x41c, 0x41f, 0x425, 0x426, 0x42a, 0x42e, 0x434, 0x437, 0x43e, 0x442, 0x446, 0x44d, 0x456, 0x45c, 0x462, 0x46c, 0x476, 0x478, 0x481, 0x487, 0x48d, 0x493, 0x496, 0x49c, 0x49f, 0x4a8, 0x4a9, 0x4b0, 0x4b4, 0x4b5, 0x4b8, 0x4ba, 0x4c1, 0x4c9, 0x4cf, 0x4d5, 0x4d6, 0x4dc, 0x4df, 0x4e7, 0x4ee, 0x4f8, 0x500, 0x503, 0x504, 0x505, 0x506, 0x508, 0x509, 0x50b, 0x50d, 0x50f, 0x513, 0x514, 0x516, 0x519, 0x51b, 0x51d, 0x51f, 0x524, 0x529, 0x52d, 0x52e, 0x531, 0x535, 0x540, 0x544, 0x54c, 0x551, 0x555, 0x558, 0x55c, 0x55f, 0x562, 0x567, 0x56b, 0x56f, 0x573, 0x577, 0x579, 0x57b, 0x57e, 0x583, 0x586, 0x588, 0x58b, 0x58d, 0x593, 0x59c, 0x5a1, 0x5a2, 0x5a5, 0x5a6, 0x5a7, 0x5a9, 0x5aa, 0x5ab} + +// sparseValues: 1451 entries, 5804 bytes +var sparseValues = [1451]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0004, lo: 0xa8, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xaa}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0004, lo: 0xaf, hi: 0xaf}, + {value: 0x0004, lo: 0xb4, hi: 0xb4}, + {value: 0x001a, lo: 0xb5, hi: 0xb5}, + {value: 0x0054, lo: 0xb7, hi: 0xb7}, + {value: 0x0004, lo: 0xb8, hi: 0xb8}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + // Block 0x1, offset 0x9 + {value: 0x2013, lo: 0x80, hi: 0x96}, + {value: 0x2013, lo: 0x98, hi: 0x9e}, + {value: 0x009a, lo: 0x9f, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xb6}, + {value: 0x2012, lo: 0xb8, hi: 0xbe}, + {value: 0x0252, lo: 0xbf, hi: 0xbf}, + // Block 0x2, offset 0xf + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x011b, lo: 0xb0, hi: 0xb0}, + {value: 0x019a, lo: 0xb1, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb7}, + {value: 0x0012, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x0553, lo: 0xbf, hi: 0xbf}, + // Block 0x3, offset 0x18 + {value: 0x0552, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x01da, lo: 0x89, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xb7}, + {value: 0x0253, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x028a, lo: 0xbf, hi: 0xbf}, + // Block 0x4, offset 0x24 + {value: 0x0117, lo: 0x80, hi: 0x9f}, + {value: 0x2f53, lo: 0xa0, hi: 0xa0}, + {value: 0x0012, lo: 0xa1, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xb3}, + {value: 0x0012, lo: 0xb4, hi: 0xb9}, + {value: 0x090b, lo: 0xba, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x2953, lo: 0xbd, hi: 0xbd}, + {value: 0x098b, lo: 0xbe, hi: 0xbe}, + {value: 0x0a0a, lo: 0xbf, hi: 0xbf}, + // Block 0x5, offset 0x2e + {value: 0x0015, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x97}, + {value: 0x0004, lo: 0x98, hi: 0x9d}, + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0015, lo: 0xa0, hi: 0xa4}, + {value: 0x0004, lo: 0xa5, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xbf}, + // Block 0x6, offset 0x35 + {value: 0x0024, lo: 0x80, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbf}, + // Block 0x7, offset 0x38 + {value: 0x6553, lo: 0x80, hi: 0x8f}, + {value: 0x2013, lo: 0x90, hi: 0x9f}, + {value: 0x5f53, lo: 0xa0, hi: 0xaf}, + {value: 0x2012, lo: 0xb0, hi: 0xbf}, + // Block 0x8, offset 0x3c + {value: 0x5f52, lo: 0x80, hi: 0x8f}, + {value: 0x6552, lo: 0x90, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x9, offset 0x3f + {value: 0x0117, lo: 0x80, hi: 0x81}, + {value: 0x0024, lo: 0x83, hi: 0x87}, + {value: 0x0014, lo: 0x88, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xbf}, + // Block 0xa, offset 0x43 + {value: 0x0f13, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x0316, lo: 0x89, hi: 0x8a}, + {value: 0x0716, lo: 0x8b, hi: 0x8c}, + {value: 0x0316, lo: 0x8d, hi: 0x8e}, + {value: 0x0f12, lo: 0x8f, hi: 0x8f}, + {value: 0x0117, lo: 0x90, hi: 0xbf}, + // Block 0xb, offset 0x4d + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x6553, lo: 0xb1, hi: 0xbf}, + // Block 0xc, offset 0x4f + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6853, lo: 0x90, hi: 0x96}, + {value: 0x0014, lo: 0x99, hi: 0x99}, + {value: 0x0010, lo: 0x9b, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0012, lo: 0xa0, hi: 0xa0}, + {value: 0x6552, lo: 0xa1, hi: 0xaf}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0xd, offset 0x57 + {value: 0x0034, lo: 0x81, hi: 0x82}, + {value: 0x0024, lo: 0x84, hi: 0x84}, + {value: 0x0034, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0xaa}, + {value: 0x0010, lo: 0xaf, hi: 0xb3}, + {value: 0x0054, lo: 0xb4, hi: 0xb4}, + // Block 0xe, offset 0x5e + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0024, lo: 0x90, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0014, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xf, offset 0x63 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9c}, + {value: 0x0024, lo: 0x9d, hi: 0x9e}, + {value: 0x0034, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0034, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x10, offset 0x71 + {value: 0x0010, lo: 0x80, hi: 0xbf}, + // Block 0x11, offset 0x72 + {value: 0x0010, lo: 0x80, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0024, lo: 0x9f, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xaa, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x12, offset 0x80 + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0034, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0034, lo: 0xb1, hi: 0xb1}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbd}, + {value: 0x0034, lo: 0xbe, hi: 0xbe}, + {value: 0x0024, lo: 0xbf, hi: 0xbf}, + // Block 0x13, offset 0x8f + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0024, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x88}, + {value: 0x0024, lo: 0x89, hi: 0x8a}, + {value: 0x0010, lo: 0x8d, hi: 0xbf}, + // Block 0x14, offset 0x99 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x15, offset 0x9c + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xb1}, + {value: 0x0034, lo: 0xb2, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0x16, offset 0xa3 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x99}, + {value: 0x0014, lo: 0x9a, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0xa3}, + {value: 0x0014, lo: 0xa4, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xad}, + // Block 0x17, offset 0xab + {value: 0x0010, lo: 0x80, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0xa0, hi: 0xaa}, + // Block 0x18, offset 0xae + {value: 0x0010, lo: 0xa0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbd}, + // Block 0x19, offset 0xb0 + {value: 0x0034, lo: 0x93, hi: 0x93}, + {value: 0x0024, lo: 0x94, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0024, lo: 0xaa, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbf}, + // Block 0x1a, offset 0xbf + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1b, offset 0xc5 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0x1c, offset 0xd3 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb6, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1d, offset 0xde + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xb1}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + // Block 0x1e, offset 0xeb + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x1f, offset 0xf6 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x99, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x20, offset 0x102 + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x21, offset 0x10c + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x85}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xbf}, + // Block 0x22, offset 0x118 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x23, offset 0x123 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x24, offset 0x12f + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0010, lo: 0xa8, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x25, offset 0x13b + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x26, offset 0x143 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb9}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbf}, + // Block 0x27, offset 0x14c + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x88}, + {value: 0x0014, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x28, offset 0x156 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x29, offset 0x161 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb2}, + // Block 0x2a, offset 0x16d + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x2b, offset 0x174 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x94, hi: 0x97}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xba, hi: 0xbf}, + // Block 0x2c, offset 0x17f + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x96}, + {value: 0x0010, lo: 0x9a, hi: 0xb1}, + {value: 0x0010, lo: 0xb3, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x2d, offset 0x184 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x94}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9f}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + // Block 0x2e, offset 0x18c + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xba}, + // Block 0x2f, offset 0x18f + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x30, offset 0x194 + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xba}, + {value: 0x0014, lo: 0xbb, hi: 0xbc}, + // Block 0x31, offset 0x198 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x32, offset 0x19c + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0034, lo: 0x98, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0034, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x33, offset 0x1a3 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xac}, + {value: 0x0034, lo: 0xb1, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xba, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x34, offset 0x1ac + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0024, lo: 0x82, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x86, hi: 0x87}, + {value: 0x0010, lo: 0x88, hi: 0x8c}, + {value: 0x0014, lo: 0x8d, hi: 0x97}, + {value: 0x0014, lo: 0x99, hi: 0xbc}, + // Block 0x35, offset 0x1b4 + {value: 0x0034, lo: 0x86, hi: 0x86}, + // Block 0x36, offset 0x1b5 + {value: 0x0010, lo: 0xab, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbe}, + // Block 0x37, offset 0x1be + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x96, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x99}, + {value: 0x0014, lo: 0x9e, hi: 0xa0}, + {value: 0x0010, lo: 0xa2, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xad}, + {value: 0x0014, lo: 0xb1, hi: 0xb4}, + // Block 0x38, offset 0x1c5 + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x6c53, lo: 0xa0, hi: 0xbf}, + // Block 0x39, offset 0x1cd + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x9a, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x3a, offset 0x1d3 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x3b, offset 0x1d8 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x82, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3c, offset 0x1dc + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3d, offset 0x1df + {value: 0x0010, lo: 0x80, hi: 0x9a}, + {value: 0x0024, lo: 0x9d, hi: 0x9f}, + // Block 0x3e, offset 0x1e1 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x7453, lo: 0xa0, hi: 0xaf}, + {value: 0x7853, lo: 0xb0, hi: 0xbf}, + // Block 0x3f, offset 0x1e4 + {value: 0x7c53, lo: 0x80, hi: 0x8f}, + {value: 0x8053, lo: 0x90, hi: 0x9f}, + {value: 0x7c53, lo: 0xa0, hi: 0xaf}, + {value: 0x0813, lo: 0xb0, hi: 0xb5}, + {value: 0x0892, lo: 0xb8, hi: 0xbd}, + // Block 0x40, offset 0x1e9 + {value: 0x0010, lo: 0x81, hi: 0xbf}, + // Block 0x41, offset 0x1ea + {value: 0x0010, lo: 0x80, hi: 0xac}, + {value: 0x0010, lo: 0xaf, hi: 0xbf}, + // Block 0x42, offset 0x1ec + {value: 0x0010, lo: 0x81, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x43, offset 0x1ee + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb8}, + // Block 0x44, offset 0x1f0 + {value: 0x0010, lo: 0x80, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0034, lo: 0x94, hi: 0x94}, + {value: 0x0010, lo: 0xa0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + // Block 0x45, offset 0x1f7 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xac}, + {value: 0x0010, lo: 0xae, hi: 0xb0}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + // Block 0x46, offset 0x1fc + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x47, offset 0x200 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x89, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0014, lo: 0x93, hi: 0x93}, + {value: 0x0004, lo: 0x97, hi: 0x97}, + {value: 0x0024, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0x48, offset 0x209 + {value: 0x0014, lo: 0x8b, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x49, offset 0x20c + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb8}, + // Block 0x4a, offset 0x20f + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x4b, offset 0x215 + {value: 0x0010, lo: 0x80, hi: 0xb5}, + // Block 0x4c, offset 0x216 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbb}, + // Block 0x4d, offset 0x221 + {value: 0x0010, lo: 0x86, hi: 0x8f}, + // Block 0x4e, offset 0x222 + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x4f, offset 0x223 + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + // Block 0x50, offset 0x228 + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x9e}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xac}, + {value: 0x0010, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xbc}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x51, offset 0x235 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xa7, hi: 0xa7}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + {value: 0x0034, lo: 0xb5, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbc}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0x52, offset 0x23d + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x53, offset 0x245 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0030, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8b}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xab, hi: 0xab}, + {value: 0x0034, lo: 0xac, hi: 0xac}, + {value: 0x0024, lo: 0xad, hi: 0xb3}, + // Block 0x54, offset 0x24e + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0030, lo: 0xaa, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbf}, + // Block 0x55, offset 0x257 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0030, lo: 0xb2, hi: 0xb3}, + // Block 0x56, offset 0x260 + {value: 0x0010, lo: 0x80, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0x57, offset 0x265 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8d, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x58, offset 0x268 + {value: 0x31ea, lo: 0x80, hi: 0x80}, + {value: 0x326a, lo: 0x81, hi: 0x81}, + {value: 0x32ea, lo: 0x82, hi: 0x82}, + {value: 0x336a, lo: 0x83, hi: 0x83}, + {value: 0x33ea, lo: 0x84, hi: 0x84}, + {value: 0x346a, lo: 0x85, hi: 0x85}, + {value: 0x34ea, lo: 0x86, hi: 0x86}, + {value: 0x356a, lo: 0x87, hi: 0x87}, + {value: 0x35ea, lo: 0x88, hi: 0x88}, + {value: 0x8353, lo: 0x90, hi: 0xba}, + {value: 0x8353, lo: 0xbd, hi: 0xbf}, + // Block 0x59, offset 0x273 + {value: 0x0024, lo: 0x90, hi: 0x92}, + {value: 0x0034, lo: 0x94, hi: 0x99}, + {value: 0x0024, lo: 0x9a, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9f}, + {value: 0x0024, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0034, lo: 0xa2, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xb3}, + {value: 0x0024, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb7}, + {value: 0x0024, lo: 0xb8, hi: 0xb9}, + {value: 0x0010, lo: 0xba, hi: 0xba}, + // Block 0x5a, offset 0x281 + {value: 0x0012, lo: 0x80, hi: 0xab}, + {value: 0x0015, lo: 0xac, hi: 0xbf}, + // Block 0x5b, offset 0x283 + {value: 0x0015, lo: 0x80, hi: 0xaa}, + {value: 0x0012, lo: 0xab, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb8}, + {value: 0x8752, lo: 0xb9, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbc}, + {value: 0x8b52, lo: 0xbd, hi: 0xbd}, + {value: 0x0012, lo: 0xbe, hi: 0xbf}, + // Block 0x5c, offset 0x28a + {value: 0x0012, lo: 0x80, hi: 0x8d}, + {value: 0x8f52, lo: 0x8e, hi: 0x8e}, + {value: 0x0012, lo: 0x8f, hi: 0x9a}, + {value: 0x0015, lo: 0x9b, hi: 0xbf}, + // Block 0x5d, offset 0x28e + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0024, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb9}, + {value: 0x0024, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbd}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x5e, offset 0x29a + {value: 0x0117, lo: 0x80, hi: 0xbf}, + // Block 0x5f, offset 0x29b + {value: 0x0117, lo: 0x80, hi: 0x95}, + {value: 0x369a, lo: 0x96, hi: 0x96}, + {value: 0x374a, lo: 0x97, hi: 0x97}, + {value: 0x37fa, lo: 0x98, hi: 0x98}, + {value: 0x38aa, lo: 0x99, hi: 0x99}, + {value: 0x395a, lo: 0x9a, hi: 0x9a}, + {value: 0x3a0a, lo: 0x9b, hi: 0x9b}, + {value: 0x0012, lo: 0x9c, hi: 0x9d}, + {value: 0x3abb, lo: 0x9e, hi: 0x9e}, + {value: 0x0012, lo: 0x9f, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x60, offset 0x2a6 + {value: 0x0812, lo: 0x80, hi: 0x87}, + {value: 0x0813, lo: 0x88, hi: 0x8f}, + {value: 0x0812, lo: 0x90, hi: 0x95}, + {value: 0x0813, lo: 0x98, hi: 0x9d}, + {value: 0x0812, lo: 0xa0, hi: 0xa7}, + {value: 0x0813, lo: 0xa8, hi: 0xaf}, + {value: 0x0812, lo: 0xb0, hi: 0xb7}, + {value: 0x0813, lo: 0xb8, hi: 0xbf}, + // Block 0x61, offset 0x2ae + {value: 0x0004, lo: 0x8b, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8f}, + {value: 0x0054, lo: 0x98, hi: 0x99}, + {value: 0x0054, lo: 0xa4, hi: 0xa4}, + {value: 0x0054, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xaa, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xaf}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x62, offset 0x2b6 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x94, hi: 0x94}, + {value: 0x0014, lo: 0xa0, hi: 0xa4}, + {value: 0x0014, lo: 0xa6, hi: 0xaf}, + {value: 0x0015, lo: 0xb1, hi: 0xb1}, + {value: 0x0015, lo: 0xbf, hi: 0xbf}, + // Block 0x63, offset 0x2bc + {value: 0x0015, lo: 0x90, hi: 0x9c}, + // Block 0x64, offset 0x2bd + {value: 0x0024, lo: 0x90, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x93}, + {value: 0x0024, lo: 0x94, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0xa0}, + {value: 0x0024, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa4}, + {value: 0x0034, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa7}, + {value: 0x0034, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xa9}, + {value: 0x0034, lo: 0xaa, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + // Block 0x65, offset 0x2cb + {value: 0x0016, lo: 0x85, hi: 0x86}, + {value: 0x0012, lo: 0x87, hi: 0x89}, + {value: 0xa452, lo: 0x8e, hi: 0x8e}, + {value: 0x1013, lo: 0xa0, hi: 0xaf}, + {value: 0x1012, lo: 0xb0, hi: 0xbf}, + // Block 0x66, offset 0x2d0 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x88}, + // Block 0x67, offset 0x2d3 + {value: 0xa753, lo: 0xb6, hi: 0xb7}, + {value: 0xaa53, lo: 0xb8, hi: 0xb9}, + {value: 0xad53, lo: 0xba, hi: 0xbb}, + {value: 0xaa53, lo: 0xbc, hi: 0xbd}, + {value: 0xa753, lo: 0xbe, hi: 0xbf}, + // Block 0x68, offset 0x2d8 + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6553, lo: 0x90, hi: 0x9f}, + {value: 0xb053, lo: 0xa0, hi: 0xae}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0x69, offset 0x2dc + {value: 0x0117, lo: 0x80, hi: 0xa3}, + {value: 0x0012, lo: 0xa4, hi: 0xa4}, + {value: 0x0716, lo: 0xab, hi: 0xac}, + {value: 0x0316, lo: 0xad, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb3}, + // Block 0x6a, offset 0x2e2 + {value: 0x6c52, lo: 0x80, hi: 0x9f}, + {value: 0x7052, lo: 0xa0, hi: 0xa5}, + {value: 0x7052, lo: 0xa7, hi: 0xa7}, + {value: 0x7052, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x6b, offset 0x2e7 + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x6c, offset 0x2ea + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0010, lo: 0xb0, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x6d, offset 0x2ef + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9e}, + {value: 0x0024, lo: 0xa0, hi: 0xbf}, + // Block 0x6e, offset 0x2f4 + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + // Block 0x6f, offset 0x2f5 + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0xaa, hi: 0xad}, + {value: 0x0030, lo: 0xae, hi: 0xaf}, + {value: 0x0004, lo: 0xb1, hi: 0xb5}, + {value: 0x0014, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + // Block 0x70, offset 0x2fb + {value: 0x0034, lo: 0x99, hi: 0x9a}, + {value: 0x0004, lo: 0x9b, hi: 0x9e}, + // Block 0x71, offset 0x2fd + {value: 0x0004, lo: 0xbc, hi: 0xbe}, + // Block 0x72, offset 0x2fe + {value: 0x0010, lo: 0x85, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x73, offset 0x300 + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0010, lo: 0xa0, hi: 0xba}, + // Block 0x74, offset 0x302 + {value: 0x0010, lo: 0x80, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0xbf}, + // Block 0x75, offset 0x305 + {value: 0x0010, lo: 0x80, hi: 0x8c}, + // Block 0x76, offset 0x306 + {value: 0x0010, lo: 0x90, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x77, offset 0x308 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0xab}, + // Block 0x78, offset 0x30b + {value: 0x0117, lo: 0x80, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb2}, + {value: 0x0024, lo: 0xb4, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x79, offset 0x311 + {value: 0x0117, lo: 0x80, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9d}, + {value: 0x0024, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x7a, offset 0x315 + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb1}, + // Block 0x7b, offset 0x317 + {value: 0x0004, lo: 0x80, hi: 0x96}, + {value: 0x0014, lo: 0x97, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xaf}, + {value: 0x0012, lo: 0xb0, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xbf}, + // Block 0x7c, offset 0x31c + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x0015, lo: 0xb0, hi: 0xb0}, + {value: 0x0012, lo: 0xb1, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x8753, lo: 0xbd, hi: 0xbd}, + {value: 0x0117, lo: 0xbe, hi: 0xbf}, + // Block 0x7d, offset 0x323 + {value: 0x0117, lo: 0x82, hi: 0x83}, + {value: 0x6553, lo: 0x84, hi: 0x84}, + {value: 0x908b, lo: 0x85, hi: 0x85}, + {value: 0x8f53, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0xb7, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbf}, + // Block 0x7e, offset 0x32b + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8b}, + {value: 0x0010, lo: 0x8c, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + // Block 0x7f, offset 0x334 + {value: 0x0010, lo: 0x80, hi: 0xb3}, + // Block 0x80, offset 0x335 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xa0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb7}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x81, offset 0x33e + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x82, offset 0x342 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0x92}, + {value: 0x0030, lo: 0x93, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0x83, offset 0x347 + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb9}, + {value: 0x0010, lo: 0xba, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x84, offset 0x34f + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0004, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x85, offset 0x355 + {value: 0x0010, lo: 0x80, hi: 0xa8}, + {value: 0x0014, lo: 0xa9, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0x86, offset 0x35b + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x87, offset 0x365 + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0024, lo: 0xbe, hi: 0xbf}, + // Block 0x88, offset 0x36a + {value: 0x0024, lo: 0x81, hi: 0x81}, + {value: 0x0004, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + // Block 0x89, offset 0x373 + {value: 0x0010, lo: 0x81, hi: 0x86}, + {value: 0x0010, lo: 0x89, hi: 0x8e}, + {value: 0x0010, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x8a, offset 0x379 + {value: 0x0012, lo: 0x80, hi: 0x92}, + {value: 0xb352, lo: 0x93, hi: 0x93}, + {value: 0x0012, lo: 0x94, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9f}, + {value: 0x0012, lo: 0xa0, hi: 0xa7}, + {value: 0x74d2, lo: 0xb0, hi: 0xbf}, + // Block 0x8b, offset 0x380 + {value: 0x78d2, lo: 0x80, hi: 0x8f}, + {value: 0x7cd2, lo: 0x90, hi: 0x9f}, + {value: 0x80d2, lo: 0xa0, hi: 0xaf}, + {value: 0x7cd2, lo: 0xb0, hi: 0xbf}, + // Block 0x8c, offset 0x384 + {value: 0x0010, lo: 0x80, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x8d, offset 0x38c + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x8e, offset 0x38e + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x8b, hi: 0xbb}, + // Block 0x8f, offset 0x390 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0xbf}, + // Block 0x90, offset 0x393 + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0004, lo: 0xb2, hi: 0xbf}, + // Block 0x91, offset 0x395 + {value: 0x0004, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x93, hi: 0xbf}, + // Block 0x92, offset 0x397 + {value: 0x0010, lo: 0x80, hi: 0xbd}, + // Block 0x93, offset 0x398 + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0x94, offset 0x399 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0xbf}, + // Block 0x95, offset 0x39b + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0xb0, hi: 0xbb}, + // Block 0x96, offset 0x39d + {value: 0x0014, lo: 0x80, hi: 0x8f}, + {value: 0x0054, lo: 0x93, hi: 0x93}, + {value: 0x0024, lo: 0xa0, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xad}, + {value: 0x0024, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + // Block 0x97, offset 0x3a3 + {value: 0x0010, lo: 0x8d, hi: 0x8f}, + {value: 0x0054, lo: 0x92, hi: 0x92}, + {value: 0x0054, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0xb0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0x98, offset 0x3a8 + {value: 0x0010, lo: 0x80, hi: 0xbc}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x99, offset 0x3aa + {value: 0x0054, lo: 0x87, hi: 0x87}, + {value: 0x0054, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0054, lo: 0x9a, hi: 0x9a}, + {value: 0x5f53, lo: 0xa1, hi: 0xba}, + {value: 0x0004, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9a, offset 0x3b1 + {value: 0x0004, lo: 0x80, hi: 0x80}, + {value: 0x5f52, lo: 0x81, hi: 0x9a}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + // Block 0x9b, offset 0x3b4 + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbe}, + // Block 0x9c, offset 0x3b6 + {value: 0x0010, lo: 0x82, hi: 0x87}, + {value: 0x0010, lo: 0x8a, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0x97}, + {value: 0x0010, lo: 0x9a, hi: 0x9c}, + {value: 0x0004, lo: 0xa3, hi: 0xa3}, + {value: 0x0014, lo: 0xb9, hi: 0xbb}, + // Block 0x9d, offset 0x3bc + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0010, lo: 0x8d, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xba}, + {value: 0x0010, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9e, offset 0x3c1 + {value: 0x0010, lo: 0x80, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x9d}, + // Block 0x9f, offset 0x3c3 + {value: 0x0010, lo: 0x80, hi: 0xba}, + // Block 0xa0, offset 0x3c4 + {value: 0x0010, lo: 0x80, hi: 0xb4}, + // Block 0xa1, offset 0x3c5 + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0xa2, offset 0x3c6 + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa3, offset 0x3c8 + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + // Block 0xa4, offset 0x3ca + {value: 0x0010, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xad, hi: 0xbf}, + // Block 0xa5, offset 0x3cc + {value: 0x0010, lo: 0x80, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0xb5}, + {value: 0x0024, lo: 0xb6, hi: 0xba}, + // Block 0xa6, offset 0x3cf + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa7, offset 0x3d1 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x91, hi: 0x95}, + // Block 0xa8, offset 0x3d4 + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x97}, + {value: 0xb653, lo: 0x98, hi: 0x9f}, + {value: 0xb953, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbf}, + // Block 0xa9, offset 0x3dc + {value: 0xb652, lo: 0x80, hi: 0x87}, + {value: 0xb952, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0xaa, offset 0x3df + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0xb953, lo: 0xb0, hi: 0xb7}, + {value: 0xb653, lo: 0xb8, hi: 0xbf}, + // Block 0xab, offset 0x3e3 + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x93}, + {value: 0xb952, lo: 0x98, hi: 0x9f}, + {value: 0xb652, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbb}, + // Block 0xac, offset 0x3eb + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xad, offset 0x3ed + {value: 0x0010, lo: 0x80, hi: 0xa3}, + // Block 0xae, offset 0x3ee + {value: 0x0010, lo: 0x80, hi: 0xb6}, + // Block 0xaf, offset 0x3ef + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xa7}, + // Block 0xb0, offset 0x3f1 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xb5}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xb1, offset 0x3f7 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb6}, + // Block 0xb2, offset 0x3f9 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + // Block 0xb3, offset 0x3fa + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + // Block 0xb4, offset 0x3fc + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb9}, + // Block 0xb5, offset 0x3fe + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0xb6, offset 0x400 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x8e, hi: 0x8e}, + {value: 0x0024, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x99, hi: 0xb5}, + {value: 0x0024, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xb7, offset 0x40d + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0xb8, offset 0x40e + {value: 0x0010, lo: 0x80, hi: 0x9c}, + // Block 0xb9, offset 0x40f + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + // Block 0xba, offset 0x413 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + // Block 0xbb, offset 0x415 + {value: 0x0010, lo: 0x80, hi: 0x91}, + // Block 0xbc, offset 0x416 + {value: 0x0010, lo: 0x80, hi: 0x88}, + // Block 0xbd, offset 0x417 + {value: 0x5653, lo: 0x80, hi: 0xb2}, + // Block 0xbe, offset 0x418 + {value: 0x5652, lo: 0x80, hi: 0xb2}, + // Block 0xbf, offset 0x419 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xc0, offset 0x41c + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xc1, offset 0x41f + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x87}, + {value: 0x0024, lo: 0x88, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x8b}, + {value: 0x0024, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + // Block 0xc2, offset 0x425 + {value: 0x0010, lo: 0xa0, hi: 0xb6}, + // Block 0xc3, offset 0x426 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xc4, offset 0x42a + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xc5, offset 0x42e + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb6}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + // Block 0xc6, offset 0x434 + {value: 0x0014, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xc7, offset 0x437 + {value: 0x0024, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0xc8, offset 0x43e + {value: 0x0010, lo: 0x84, hi: 0x86}, + {value: 0x0010, lo: 0x90, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + // Block 0xc9, offset 0x442 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xca, offset 0x446 + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x89, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + // Block 0xcb, offset 0x44d + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb4}, + {value: 0x0030, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xb7}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0xcc, offset 0x456 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xcd, offset 0x45c + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa2}, + {value: 0x0014, lo: 0xa3, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xce, offset 0x462 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xcf, offset 0x46c + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0030, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9d, hi: 0xa3}, + {value: 0x0024, lo: 0xa6, hi: 0xac}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + // Block 0xd0, offset 0x476 + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xd1, offset 0x478 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0x9f, hi: 0x9f}, + // Block 0xd2, offset 0x481 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xd3, offset 0x487 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd4, offset 0x48d + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd5, offset 0x493 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x98, hi: 0x9b}, + {value: 0x0014, lo: 0x9c, hi: 0x9d}, + // Block 0xd6, offset 0x496 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd7, offset 0x49c + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd8, offset 0x49f + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0014, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb5}, + {value: 0x0030, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + // Block 0xd9, offset 0x4a8 + {value: 0x0010, lo: 0x80, hi: 0x89}, + // Block 0xda, offset 0x4a9 + {value: 0x0014, lo: 0x9d, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xdb, offset 0x4b0 + {value: 0x0010, lo: 0x80, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + // Block 0xdc, offset 0x4b4 + {value: 0x5f53, lo: 0xa0, hi: 0xbf}, + // Block 0xdd, offset 0x4b5 + {value: 0x5f52, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xde, offset 0x4b8 + {value: 0x0010, lo: 0xa0, hi: 0xa7}, + {value: 0x0010, lo: 0xaa, hi: 0xbf}, + // Block 0xdf, offset 0x4ba + {value: 0x0010, lo: 0x80, hi: 0x93}, + {value: 0x0014, lo: 0x94, hi: 0x97}, + {value: 0x0014, lo: 0x9a, hi: 0x9b}, + {value: 0x0010, lo: 0x9c, hi: 0x9f}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + // Block 0xe0, offset 0x4c1 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x8a}, + {value: 0x0010, lo: 0x8b, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbb, hi: 0xbe}, + // Block 0xe1, offset 0x4c9 + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0014, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x98}, + {value: 0x0014, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0x9c, hi: 0xbf}, + // Block 0xe2, offset 0x4cf + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0014, lo: 0x8a, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x99}, + {value: 0x0010, lo: 0x9d, hi: 0x9d}, + // Block 0xe3, offset 0x4d5 + {value: 0x0010, lo: 0x80, hi: 0xb8}, + // Block 0xe4, offset 0x4d6 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb6}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xe5, offset 0x4dc + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0xe6, offset 0x4df + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0014, lo: 0x92, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xa9}, + {value: 0x0014, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0xe7, offset 0x4e7 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb6}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xe8, offset 0x4ee + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa5}, + {value: 0x0010, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xbf}, + // Block 0xe9, offset 0x4f8 + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0014, lo: 0x90, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0x96}, + {value: 0x0034, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0xea, offset 0x500 + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + // Block 0xeb, offset 0x503 + {value: 0x0010, lo: 0x80, hi: 0x99}, + // Block 0xec, offset 0x504 + {value: 0x0010, lo: 0x80, hi: 0xae}, + // Block 0xed, offset 0x505 + {value: 0x0010, lo: 0x80, hi: 0x83}, + // Block 0xee, offset 0x506 + {value: 0x0010, lo: 0x80, hi: 0xae}, + {value: 0x0014, lo: 0xb0, hi: 0xb8}, + // Block 0xef, offset 0x508 + {value: 0x0010, lo: 0x80, hi: 0x86}, + // Block 0xf0, offset 0x509 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0xf1, offset 0x50b + {value: 0x0010, lo: 0x90, hi: 0xad}, + {value: 0x0034, lo: 0xb0, hi: 0xb4}, + // Block 0xf2, offset 0x50d + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb6}, + // Block 0xf3, offset 0x50f + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa3, hi: 0xb7}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xf4, offset 0x513 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + // Block 0xf5, offset 0x514 + {value: 0x2013, lo: 0x80, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xbf}, + // Block 0xf6, offset 0x516 + {value: 0x0010, lo: 0x80, hi: 0x8a}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0xf7, offset 0x519 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0014, lo: 0x8f, hi: 0x9f}, + // Block 0xf8, offset 0x51b + {value: 0x0014, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa3, hi: 0xa3}, + // Block 0xf9, offset 0x51d + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbc}, + // Block 0xfa, offset 0x51f + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0034, lo: 0x9e, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa3}, + // Block 0xfb, offset 0x524 + {value: 0x0030, lo: 0xa5, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xa9}, + {value: 0x0030, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbf}, + // Block 0xfc, offset 0x529 + {value: 0x0034, lo: 0x80, hi: 0x82}, + {value: 0x0024, lo: 0x85, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8b}, + {value: 0x0024, lo: 0xaa, hi: 0xad}, + // Block 0xfd, offset 0x52d + {value: 0x0024, lo: 0x82, hi: 0x84}, + // Block 0xfe, offset 0x52e + {value: 0x0013, lo: 0x80, hi: 0x99}, + {value: 0x0012, lo: 0x9a, hi: 0xb3}, + {value: 0x0013, lo: 0xb4, hi: 0xbf}, + // Block 0xff, offset 0x531 + {value: 0x0013, lo: 0x80, hi: 0x8d}, + {value: 0x0012, lo: 0x8e, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0xa7}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0x100, offset 0x535 + {value: 0x0013, lo: 0x80, hi: 0x81}, + {value: 0x0012, lo: 0x82, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0x9c}, + {value: 0x0013, lo: 0x9e, hi: 0x9f}, + {value: 0x0013, lo: 0xa2, hi: 0xa2}, + {value: 0x0013, lo: 0xa5, hi: 0xa6}, + {value: 0x0013, lo: 0xa9, hi: 0xac}, + {value: 0x0013, lo: 0xae, hi: 0xb5}, + {value: 0x0012, lo: 0xb6, hi: 0xb9}, + {value: 0x0012, lo: 0xbb, hi: 0xbb}, + {value: 0x0012, lo: 0xbd, hi: 0xbf}, + // Block 0x101, offset 0x540 + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0012, lo: 0x85, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0x102, offset 0x544 + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0013, lo: 0x84, hi: 0x85}, + {value: 0x0013, lo: 0x87, hi: 0x8a}, + {value: 0x0013, lo: 0x8d, hi: 0x94}, + {value: 0x0013, lo: 0x96, hi: 0x9c}, + {value: 0x0012, lo: 0x9e, hi: 0xb7}, + {value: 0x0013, lo: 0xb8, hi: 0xb9}, + {value: 0x0013, lo: 0xbb, hi: 0xbe}, + // Block 0x103, offset 0x54c + {value: 0x0013, lo: 0x80, hi: 0x84}, + {value: 0x0013, lo: 0x86, hi: 0x86}, + {value: 0x0013, lo: 0x8a, hi: 0x90}, + {value: 0x0012, lo: 0x92, hi: 0xab}, + {value: 0x0013, lo: 0xac, hi: 0xbf}, + // Block 0x104, offset 0x551 + {value: 0x0013, lo: 0x80, hi: 0x85}, + {value: 0x0012, lo: 0x86, hi: 0x9f}, + {value: 0x0013, lo: 0xa0, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbf}, + // Block 0x105, offset 0x555 + {value: 0x0012, lo: 0x80, hi: 0x93}, + {value: 0x0013, lo: 0x94, hi: 0xad}, + {value: 0x0012, lo: 0xae, hi: 0xbf}, + // Block 0x106, offset 0x558 + {value: 0x0012, lo: 0x80, hi: 0x87}, + {value: 0x0013, lo: 0x88, hi: 0xa1}, + {value: 0x0012, lo: 0xa2, hi: 0xbb}, + {value: 0x0013, lo: 0xbc, hi: 0xbf}, + // Block 0x107, offset 0x55c + {value: 0x0013, lo: 0x80, hi: 0x95}, + {value: 0x0012, lo: 0x96, hi: 0xaf}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x108, offset 0x55f + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0012, lo: 0x8a, hi: 0xa5}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0x109, offset 0x562 + {value: 0x0013, lo: 0x80, hi: 0x80}, + {value: 0x0012, lo: 0x82, hi: 0x9a}, + {value: 0x0012, lo: 0x9c, hi: 0xa1}, + {value: 0x0013, lo: 0xa2, hi: 0xba}, + {value: 0x0012, lo: 0xbc, hi: 0xbf}, + // Block 0x10a, offset 0x567 + {value: 0x0012, lo: 0x80, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0xb4}, + {value: 0x0012, lo: 0xb6, hi: 0xbf}, + // Block 0x10b, offset 0x56b + {value: 0x0012, lo: 0x80, hi: 0x8e}, + {value: 0x0012, lo: 0x90, hi: 0x95}, + {value: 0x0013, lo: 0x96, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x10c, offset 0x56f + {value: 0x0012, lo: 0x80, hi: 0x88}, + {value: 0x0012, lo: 0x8a, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0x10d, offset 0x573 + {value: 0x0012, lo: 0x80, hi: 0x82}, + {value: 0x0012, lo: 0x84, hi: 0x89}, + {value: 0x0017, lo: 0x8a, hi: 0x8b}, + {value: 0x0010, lo: 0x8e, hi: 0xbf}, + // Block 0x10e, offset 0x577 + {value: 0x0014, lo: 0x80, hi: 0xb6}, + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x10f, offset 0x579 + {value: 0x0014, lo: 0x80, hi: 0xac}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x110, offset 0x57b + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x9b, hi: 0x9f}, + {value: 0x0014, lo: 0xa1, hi: 0xaf}, + // Block 0x111, offset 0x57e + {value: 0x0024, lo: 0x80, hi: 0x86}, + {value: 0x0024, lo: 0x88, hi: 0x98}, + {value: 0x0024, lo: 0x9b, hi: 0xa1}, + {value: 0x0024, lo: 0xa3, hi: 0xa4}, + {value: 0x0024, lo: 0xa6, hi: 0xaa}, + // Block 0x112, offset 0x583 + {value: 0x0010, lo: 0x80, hi: 0xac}, + {value: 0x0024, lo: 0xb0, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xbd}, + // Block 0x113, offset 0x586 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + // Block 0x114, offset 0x588 + {value: 0x0010, lo: 0x80, hi: 0xab}, + {value: 0x0024, lo: 0xac, hi: 0xaf}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x115, offset 0x58b + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0034, lo: 0x90, hi: 0x96}, + // Block 0x116, offset 0x58d + {value: 0xbc52, lo: 0x80, hi: 0x81}, + {value: 0xbf52, lo: 0x82, hi: 0x83}, + {value: 0x0024, lo: 0x84, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8b}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x117, offset 0x593 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x9f}, + {value: 0x0010, lo: 0xa1, hi: 0xa2}, + {value: 0x0010, lo: 0xa4, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb7}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + // Block 0x118, offset 0x59c + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x9b}, + {value: 0x0010, lo: 0xa1, hi: 0xa3}, + {value: 0x0010, lo: 0xa5, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xbb}, + // Block 0x119, offset 0x5a1 + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x11a, offset 0x5a2 + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x11b, offset 0x5a5 + {value: 0x0013, lo: 0x80, hi: 0x89}, + // Block 0x11c, offset 0x5a6 + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x11d, offset 0x5a7 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0014, lo: 0xa0, hi: 0xbf}, + // Block 0x11e, offset 0x5a9 + {value: 0x0014, lo: 0x80, hi: 0xbf}, + // Block 0x11f, offset 0x5aa + {value: 0x0014, lo: 0x80, hi: 0xaf}, +} + +// Total table size 15070 bytes (14KiB); checksum: 1EB13752 diff --git a/vendor/golang.org/x/text/cases/tables13.0.0.go b/vendor/golang.org/x/text/cases/tables13.0.0.go new file mode 100644 index 0000000..cd87477 --- /dev/null +++ b/vendor/golang.org/x/text/cases/tables13.0.0.go @@ -0,0 +1,2400 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.16 +// +build go1.16 + +package cases + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "13.0.0" + +var xorData string = "" + // Size: 192 bytes + "\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" + + "\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" + + "\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" + + "\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" + + "\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" + + "\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" + + "\x0b!\x10\x00\x0b!0\x001\x00\x00\x0b(\x04\x00\x03\x04\x1e\x00\x0b)\x08" + + "\x00\x03\x0a\x00\x02:\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<" + + "\x00\x01&\x00\x01*\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x01" + + "\x1e\x00\x01\x22" + +var exceptions string = "" + // Size: 2450 bytes + "\x00\x12\x12μΜΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x09II\x13\x1bʼnʼNʼN\x11" + + "\x09sSS\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ\x10\x12LJLj" + + "\x12\x12njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x1bǰJ̌J̌\x12\x12dzdzDz\x12\x12dzdzDZ\x10" + + "\x12DZDz\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x1bⱾⱾ\x10\x1bⱿⱿ\x10\x1bⱯⱯ\x10\x1bⱭⱭ\x10" + + "\x1bⱰⱰ\x10\x1bꞫꞫ\x10\x1bꞬꞬ\x10\x1bꞍꞍ\x10\x1bꞪꞪ\x10\x1bꞮꞮ\x10\x1bⱢⱢ\x10" + + "\x1bꞭꞭ\x10\x1bⱮⱮ\x10\x1bⱤⱤ\x10\x1bꟅꟅ\x10\x1bꞱꞱ\x10\x1bꞲꞲ\x10\x1bꞰꞰ2\x12ι" + + "ΙΙ\x166ΐΪ́Ϊ́\x166ΰΫ́Ϋ́\x12\x12σΣΣ\x12\x12βΒΒ\x12\x12θΘΘ\x12\x12" + + "φΦΦ\x12\x12πΠΠ\x12\x12κΚΚ\x12\x12ρΡΡ\x12\x12εΕΕ\x14$եւԵՒԵւ\x10\x1bᲐა" + + "\x10\x1bᲑბ\x10\x1bᲒგ\x10\x1bᲓდ\x10\x1bᲔე\x10\x1bᲕვ\x10\x1bᲖზ\x10\x1bᲗთ" + + "\x10\x1bᲘი\x10\x1bᲙკ\x10\x1bᲚლ\x10\x1bᲛმ\x10\x1bᲜნ\x10\x1bᲝო\x10\x1bᲞპ" + + "\x10\x1bᲟჟ\x10\x1bᲠრ\x10\x1bᲡს\x10\x1bᲢტ\x10\x1bᲣუ\x10\x1bᲤფ\x10\x1bᲥქ" + + "\x10\x1bᲦღ\x10\x1bᲧყ\x10\x1bᲨშ\x10\x1bᲩჩ\x10\x1bᲪც\x10\x1bᲫძ\x10\x1bᲬწ" + + "\x10\x1bᲭჭ\x10\x1bᲮხ\x10\x1bᲯჯ\x10\x1bᲰჰ\x10\x1bᲱჱ\x10\x1bᲲჲ\x10\x1bᲳჳ" + + "\x10\x1bᲴჴ\x10\x1bᲵჵ\x10\x1bᲶჶ\x10\x1bᲷჷ\x10\x1bᲸჸ\x10\x1bᲹჹ\x10\x1bᲺჺ" + + "\x10\x1bᲽჽ\x10\x1bᲾჾ\x10\x1bᲿჿ\x12\x12вВВ\x12\x12дДД\x12\x12оОО\x12\x12с" + + "СС\x12\x12тТТ\x12\x12тТТ\x12\x12ъЪЪ\x12\x12ѣѢѢ\x13\x1bꙋꙊꙊ\x13\x1bẖH̱H̱" + + "\x13\x1bẗT̈T̈\x13\x1bẘW̊W̊\x13\x1bẙY̊Y̊\x13\x1baʾAʾAʾ\x13\x1bṡṠṠ\x12" + + "\x10ssß\x14$ὐΥ̓Υ̓\x166ὒΥ̓̀Υ̓̀\x166ὔΥ̓́Υ̓́\x166ὖΥ̓͂Υ̓͂\x15+ἀιἈΙᾈ" + + "\x15+ἁιἉΙᾉ\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ" + + "\x15\x1dἀιᾀἈΙ\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ\x15\x1dἄιᾄἌΙ\x15" + + "\x1dἅιᾅἍΙ\x15\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ\x15+ἢιἪΙᾚ\x15+ἣι" + + "ἫΙᾛ\x15+ἤιἬΙᾜ\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨΙ\x15\x1dἡιᾑἩΙ" + + "\x15\x1dἢιᾒἪΙ\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15\x1dἦιᾖἮΙ\x15" + + "\x1dἧιᾗἯΙ\x15+ὠιὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ\x15+ὥιὭΙᾭ" + + "\x15+ὦιὮΙᾮ\x15+ὧιὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ\x15\x1dὣιᾣὫΙ" + + "\x15\x1dὤιᾤὬΙ\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰιᾺΙᾺͅ\x14#αιΑΙ" + + "ᾼ\x14$άιΆΙΆͅ\x14$ᾶΑ͂Α͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12\x12ιΙΙ\x15-ὴιῊΙ" + + "Ὴͅ\x14#ηιΗΙῌ\x14$ήιΉΙΉͅ\x14$ῆΗ͂Η͂\x166ῆιΗ͂Ιῌ͂\x14\x1cηιῃΗΙ\x166ῒΙ" + + "̈̀Ϊ̀\x166ΐΪ́Ϊ́\x14$ῖΙ͂Ι͂\x166ῗΪ͂Ϊ͂\x166ῢΫ̀Ϋ̀\x166ΰΫ́Ϋ" + + "́\x14$ῤΡ̓Ρ̓\x14$ῦΥ͂Υ͂\x166ῧΫ͂Ϋ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙῼ\x14$ώιΏΙΏͅ" + + "\x14$ῶΩ͂Ω͂\x166ῶιΩ͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk\x12\x10åå\x12" + + "\x10ɫɫ\x12\x10ɽɽ\x10\x12ȺȺ\x10\x12ȾȾ\x12\x10ɑɑ\x12\x10ɱɱ\x12\x10ɐɐ\x12" + + "\x10ɒɒ\x12\x10ȿȿ\x12\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ\x12\x10ɡɡ\x12" + + "\x10ɬɬ\x12\x10ɪɪ\x12\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x10ʂʂ\x12\x12ffFFFf" + + "\x12\x12fiFIFi\x12\x12flFLFl\x13\x1bffiFFIFfi\x13\x1bfflFFLFfl\x12\x12st" + + "STSt\x12\x12stSTSt\x14$մնՄՆՄն\x14$մեՄԵՄե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄԽՄ" + + "խ" + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// caseTrie. Total size: 12538 bytes (12.24 KiB). Checksum: af4dfa7d60c71d4c. +type caseTrie struct{} + +func newCaseTrie(i int) *caseTrie { + return &caseTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *caseTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 20: + return uint16(caseValues[n<<6+uint32(b)]) + default: + n -= 20 + return uint16(sparse.lookup(n, b)) + } +} + +// caseValues: 22 blocks, 1408 entries, 2816 bytes +// The third block is the zero block. +var caseValues = [1408]uint16{ + // Block 0x0, offset 0x0 + 0x27: 0x0054, + 0x2e: 0x0054, + 0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010, + 0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054, + // Block 0x1, offset 0x40 + 0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013, + 0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013, + 0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013, + 0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013, + 0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013, + 0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012, + 0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012, + 0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012, + 0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012, + 0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112, + 0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713, + 0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313, + 0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653, + 0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x0012, 0xdc: 0x1d53, 0xdd: 0x2c53, + 0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112, + 0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853, + 0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13, + 0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313, + 0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010, + 0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452, + // Block 0x4, offset 0x100 + 0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x02db, 0x105: 0x0359, + 0x106: 0x03da, 0x107: 0x043b, 0x108: 0x04b9, 0x109: 0x053a, 0x10a: 0x059b, 0x10b: 0x0619, + 0x10c: 0x069a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313, + 0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13, + 0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452, + 0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112, + 0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112, + 0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112, + 0x130: 0x06fa, 0x131: 0x07ab, 0x132: 0x0829, 0x133: 0x08aa, 0x134: 0x0113, 0x135: 0x0112, + 0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112, + 0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112, + // Block 0x5, offset 0x140 + 0x140: 0x0a8a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53, + 0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112, + 0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x0b0a, 0x151: 0x0b8a, + 0x152: 0x0c0a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152, + 0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x0c8a, 0x15d: 0x0012, + 0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x0d0a, 0x162: 0x0012, 0x163: 0x2052, + 0x164: 0x0012, 0x165: 0x0d8a, 0x166: 0x0e0a, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652, + 0x16a: 0x0e8a, 0x16b: 0x0f0a, 0x16c: 0x0f8a, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52, + 0x170: 0x0012, 0x171: 0x100a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252, + 0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012, + 0x17c: 0x0012, 0x17d: 0x108a, 0x17e: 0x0012, 0x17f: 0x0012, + // Block 0x6, offset 0x180 + 0x180: 0x3552, 0x181: 0x0012, 0x182: 0x110a, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012, + 0x186: 0x0012, 0x187: 0x118a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52, + 0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012, + 0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0012, 0x196: 0x0012, 0x197: 0x0012, + 0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x120a, + 0x19e: 0x128a, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012, + 0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012, + 0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012, + 0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015, + 0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014, + 0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x130d, + 0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024, + 0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024, + 0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024, + 0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034, + 0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024, + 0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024, + 0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024, + 0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004, + 0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52, + 0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353, + // Block 0x8, offset 0x200 + 0x204: 0x0004, 0x205: 0x0004, + 0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513, + 0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x138a, 0x211: 0x2013, + 0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013, + 0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013, + 0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53, + 0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53, + 0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512, + 0x230: 0x14ca, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012, + 0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012, + 0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012, + // Block 0x9, offset 0x240 + 0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x160a, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52, + 0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52, + 0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x168a, 0x251: 0x170a, + 0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x178a, 0x256: 0x180a, 0x257: 0x1812, + 0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112, + 0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112, + 0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112, + 0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112, + 0x270: 0x188a, 0x271: 0x190a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x198a, + 0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112, + 0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053, + // Block 0xa, offset 0x280 + 0x280: 0x6852, 0x281: 0x6852, 0x282: 0x6852, 0x283: 0x6852, 0x284: 0x6852, 0x285: 0x6852, + 0x286: 0x6852, 0x287: 0x1a0a, 0x288: 0x0012, 0x28a: 0x0010, + 0x291: 0x0034, + 0x292: 0x0024, 0x293: 0x0024, 0x294: 0x0024, 0x295: 0x0024, 0x296: 0x0034, 0x297: 0x0024, + 0x298: 0x0024, 0x299: 0x0024, 0x29a: 0x0034, 0x29b: 0x0034, 0x29c: 0x0024, 0x29d: 0x0024, + 0x29e: 0x0024, 0x29f: 0x0024, 0x2a0: 0x0024, 0x2a1: 0x0024, 0x2a2: 0x0034, 0x2a3: 0x0034, + 0x2a4: 0x0034, 0x2a5: 0x0034, 0x2a6: 0x0034, 0x2a7: 0x0034, 0x2a8: 0x0024, 0x2a9: 0x0024, + 0x2aa: 0x0034, 0x2ab: 0x0024, 0x2ac: 0x0024, 0x2ad: 0x0034, 0x2ae: 0x0034, 0x2af: 0x0024, + 0x2b0: 0x0034, 0x2b1: 0x0034, 0x2b2: 0x0034, 0x2b3: 0x0034, 0x2b4: 0x0034, 0x2b5: 0x0034, + 0x2b6: 0x0034, 0x2b7: 0x0034, 0x2b8: 0x0034, 0x2b9: 0x0034, 0x2ba: 0x0034, 0x2bb: 0x0034, + 0x2bc: 0x0034, 0x2bd: 0x0034, 0x2bf: 0x0034, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x7053, 0x2c1: 0x7053, 0x2c2: 0x7053, 0x2c3: 0x7053, 0x2c4: 0x7053, 0x2c5: 0x7053, + 0x2c7: 0x7053, + 0x2cd: 0x7053, 0x2d0: 0x1aea, 0x2d1: 0x1b6a, + 0x2d2: 0x1bea, 0x2d3: 0x1c6a, 0x2d4: 0x1cea, 0x2d5: 0x1d6a, 0x2d6: 0x1dea, 0x2d7: 0x1e6a, + 0x2d8: 0x1eea, 0x2d9: 0x1f6a, 0x2da: 0x1fea, 0x2db: 0x206a, 0x2dc: 0x20ea, 0x2dd: 0x216a, + 0x2de: 0x21ea, 0x2df: 0x226a, 0x2e0: 0x22ea, 0x2e1: 0x236a, 0x2e2: 0x23ea, 0x2e3: 0x246a, + 0x2e4: 0x24ea, 0x2e5: 0x256a, 0x2e6: 0x25ea, 0x2e7: 0x266a, 0x2e8: 0x26ea, 0x2e9: 0x276a, + 0x2ea: 0x27ea, 0x2eb: 0x286a, 0x2ec: 0x28ea, 0x2ed: 0x296a, 0x2ee: 0x29ea, 0x2ef: 0x2a6a, + 0x2f0: 0x2aea, 0x2f1: 0x2b6a, 0x2f2: 0x2bea, 0x2f3: 0x2c6a, 0x2f4: 0x2cea, 0x2f5: 0x2d6a, + 0x2f6: 0x2dea, 0x2f7: 0x2e6a, 0x2f8: 0x2eea, 0x2f9: 0x2f6a, 0x2fa: 0x2fea, + 0x2fc: 0x0014, 0x2fd: 0x306a, 0x2fe: 0x30ea, 0x2ff: 0x316a, + // Block 0xc, offset 0x300 + 0x300: 0x0812, 0x301: 0x0812, 0x302: 0x0812, 0x303: 0x0812, 0x304: 0x0812, 0x305: 0x0812, + 0x308: 0x0813, 0x309: 0x0813, 0x30a: 0x0813, 0x30b: 0x0813, + 0x30c: 0x0813, 0x30d: 0x0813, 0x310: 0x3b1a, 0x311: 0x0812, + 0x312: 0x3bfa, 0x313: 0x0812, 0x314: 0x3d3a, 0x315: 0x0812, 0x316: 0x3e7a, 0x317: 0x0812, + 0x319: 0x0813, 0x31b: 0x0813, 0x31d: 0x0813, + 0x31f: 0x0813, 0x320: 0x0812, 0x321: 0x0812, 0x322: 0x0812, 0x323: 0x0812, + 0x324: 0x0812, 0x325: 0x0812, 0x326: 0x0812, 0x327: 0x0812, 0x328: 0x0813, 0x329: 0x0813, + 0x32a: 0x0813, 0x32b: 0x0813, 0x32c: 0x0813, 0x32d: 0x0813, 0x32e: 0x0813, 0x32f: 0x0813, + 0x330: 0x9252, 0x331: 0x9252, 0x332: 0x9552, 0x333: 0x9552, 0x334: 0x9852, 0x335: 0x9852, + 0x336: 0x9b52, 0x337: 0x9b52, 0x338: 0x9e52, 0x339: 0x9e52, 0x33a: 0xa152, 0x33b: 0xa152, + 0x33c: 0x4d52, 0x33d: 0x4d52, + // Block 0xd, offset 0x340 + 0x340: 0x3fba, 0x341: 0x40aa, 0x342: 0x419a, 0x343: 0x428a, 0x344: 0x437a, 0x345: 0x446a, + 0x346: 0x455a, 0x347: 0x464a, 0x348: 0x4739, 0x349: 0x4829, 0x34a: 0x4919, 0x34b: 0x4a09, + 0x34c: 0x4af9, 0x34d: 0x4be9, 0x34e: 0x4cd9, 0x34f: 0x4dc9, 0x350: 0x4eba, 0x351: 0x4faa, + 0x352: 0x509a, 0x353: 0x518a, 0x354: 0x527a, 0x355: 0x536a, 0x356: 0x545a, 0x357: 0x554a, + 0x358: 0x5639, 0x359: 0x5729, 0x35a: 0x5819, 0x35b: 0x5909, 0x35c: 0x59f9, 0x35d: 0x5ae9, + 0x35e: 0x5bd9, 0x35f: 0x5cc9, 0x360: 0x5dba, 0x361: 0x5eaa, 0x362: 0x5f9a, 0x363: 0x608a, + 0x364: 0x617a, 0x365: 0x626a, 0x366: 0x635a, 0x367: 0x644a, 0x368: 0x6539, 0x369: 0x6629, + 0x36a: 0x6719, 0x36b: 0x6809, 0x36c: 0x68f9, 0x36d: 0x69e9, 0x36e: 0x6ad9, 0x36f: 0x6bc9, + 0x370: 0x0812, 0x371: 0x0812, 0x372: 0x6cba, 0x373: 0x6dca, 0x374: 0x6e9a, + 0x376: 0x6f7a, 0x377: 0x705a, 0x378: 0x0813, 0x379: 0x0813, 0x37a: 0x9253, 0x37b: 0x9253, + 0x37c: 0x7199, 0x37d: 0x0004, 0x37e: 0x726a, 0x37f: 0x0004, + // Block 0xe, offset 0x380 + 0x380: 0x0004, 0x381: 0x0004, 0x382: 0x72ea, 0x383: 0x73fa, 0x384: 0x74ca, + 0x386: 0x75aa, 0x387: 0x768a, 0x388: 0x9553, 0x389: 0x9553, 0x38a: 0x9853, 0x38b: 0x9853, + 0x38c: 0x77c9, 0x38d: 0x0004, 0x38e: 0x0004, 0x38f: 0x0004, 0x390: 0x0812, 0x391: 0x0812, + 0x392: 0x789a, 0x393: 0x79da, 0x396: 0x7b1a, 0x397: 0x7bfa, + 0x398: 0x0813, 0x399: 0x0813, 0x39a: 0x9b53, 0x39b: 0x9b53, 0x39d: 0x0004, + 0x39e: 0x0004, 0x39f: 0x0004, 0x3a0: 0x0812, 0x3a1: 0x0812, 0x3a2: 0x7d3a, 0x3a3: 0x7e7a, + 0x3a4: 0x7fba, 0x3a5: 0x0912, 0x3a6: 0x809a, 0x3a7: 0x817a, 0x3a8: 0x0813, 0x3a9: 0x0813, + 0x3aa: 0xa153, 0x3ab: 0xa153, 0x3ac: 0x0913, 0x3ad: 0x0004, 0x3ae: 0x0004, 0x3af: 0x0004, + 0x3b2: 0x82ba, 0x3b3: 0x83ca, 0x3b4: 0x849a, + 0x3b6: 0x857a, 0x3b7: 0x865a, 0x3b8: 0x9e53, 0x3b9: 0x9e53, 0x3ba: 0x4d53, 0x3bb: 0x4d53, + 0x3bc: 0x8799, 0x3bd: 0x0004, 0x3be: 0x0004, + // Block 0xf, offset 0x3c0 + 0x3c2: 0x0013, + 0x3c7: 0x0013, 0x3ca: 0x0012, 0x3cb: 0x0013, + 0x3cc: 0x0013, 0x3cd: 0x0013, 0x3ce: 0x0012, 0x3cf: 0x0012, 0x3d0: 0x0013, 0x3d1: 0x0013, + 0x3d2: 0x0013, 0x3d3: 0x0012, 0x3d5: 0x0013, + 0x3d9: 0x0013, 0x3da: 0x0013, 0x3db: 0x0013, 0x3dc: 0x0013, 0x3dd: 0x0013, + 0x3e4: 0x0013, 0x3e6: 0x886b, 0x3e8: 0x0013, + 0x3ea: 0x88cb, 0x3eb: 0x890b, 0x3ec: 0x0013, 0x3ed: 0x0013, 0x3ef: 0x0012, + 0x3f0: 0x0013, 0x3f1: 0x0013, 0x3f2: 0xa453, 0x3f3: 0x0013, 0x3f4: 0x0012, 0x3f5: 0x0010, + 0x3f6: 0x0010, 0x3f7: 0x0010, 0x3f8: 0x0010, 0x3f9: 0x0012, + 0x3fc: 0x0012, 0x3fd: 0x0012, 0x3fe: 0x0013, 0x3ff: 0x0013, + // Block 0x10, offset 0x400 + 0x400: 0x1a13, 0x401: 0x1a13, 0x402: 0x1e13, 0x403: 0x1e13, 0x404: 0x1a13, 0x405: 0x1a13, + 0x406: 0x2613, 0x407: 0x2613, 0x408: 0x2a13, 0x409: 0x2a13, 0x40a: 0x2e13, 0x40b: 0x2e13, + 0x40c: 0x2a13, 0x40d: 0x2a13, 0x40e: 0x2613, 0x40f: 0x2613, 0x410: 0xa752, 0x411: 0xa752, + 0x412: 0xaa52, 0x413: 0xaa52, 0x414: 0xad52, 0x415: 0xad52, 0x416: 0xaa52, 0x417: 0xaa52, + 0x418: 0xa752, 0x419: 0xa752, 0x41a: 0x1a12, 0x41b: 0x1a12, 0x41c: 0x1e12, 0x41d: 0x1e12, + 0x41e: 0x1a12, 0x41f: 0x1a12, 0x420: 0x2612, 0x421: 0x2612, 0x422: 0x2a12, 0x423: 0x2a12, + 0x424: 0x2e12, 0x425: 0x2e12, 0x426: 0x2a12, 0x427: 0x2a12, 0x428: 0x2612, 0x429: 0x2612, + // Block 0x11, offset 0x440 + 0x440: 0x6552, 0x441: 0x6552, 0x442: 0x6552, 0x443: 0x6552, 0x444: 0x6552, 0x445: 0x6552, + 0x446: 0x6552, 0x447: 0x6552, 0x448: 0x6552, 0x449: 0x6552, 0x44a: 0x6552, 0x44b: 0x6552, + 0x44c: 0x6552, 0x44d: 0x6552, 0x44e: 0x6552, 0x44f: 0x6552, 0x450: 0xb052, 0x451: 0xb052, + 0x452: 0xb052, 0x453: 0xb052, 0x454: 0xb052, 0x455: 0xb052, 0x456: 0xb052, 0x457: 0xb052, + 0x458: 0xb052, 0x459: 0xb052, 0x45a: 0xb052, 0x45b: 0xb052, 0x45c: 0xb052, 0x45d: 0xb052, + 0x45e: 0xb052, 0x460: 0x0113, 0x461: 0x0112, 0x462: 0x896b, 0x463: 0x8b53, + 0x464: 0x89cb, 0x465: 0x8a2a, 0x466: 0x8a8a, 0x467: 0x0f13, 0x468: 0x0f12, 0x469: 0x0313, + 0x46a: 0x0312, 0x46b: 0x0713, 0x46c: 0x0712, 0x46d: 0x8aeb, 0x46e: 0x8b4b, 0x46f: 0x8bab, + 0x470: 0x8c0b, 0x471: 0x0012, 0x472: 0x0113, 0x473: 0x0112, 0x474: 0x0012, 0x475: 0x0313, + 0x476: 0x0312, 0x477: 0x0012, 0x478: 0x0012, 0x479: 0x0012, 0x47a: 0x0012, 0x47b: 0x0012, + 0x47c: 0x0015, 0x47d: 0x0015, 0x47e: 0x8c6b, 0x47f: 0x8ccb, + // Block 0x12, offset 0x480 + 0x480: 0x0113, 0x481: 0x0112, 0x482: 0x0113, 0x483: 0x0112, 0x484: 0x0113, 0x485: 0x0112, + 0x486: 0x0113, 0x487: 0x0112, 0x488: 0x0014, 0x489: 0x0014, 0x48a: 0x0014, 0x48b: 0x0713, + 0x48c: 0x0712, 0x48d: 0x8d2b, 0x48e: 0x0012, 0x48f: 0x0010, 0x490: 0x0113, 0x491: 0x0112, + 0x492: 0x0113, 0x493: 0x0112, 0x494: 0x6552, 0x495: 0x0012, 0x496: 0x0113, 0x497: 0x0112, + 0x498: 0x0113, 0x499: 0x0112, 0x49a: 0x0113, 0x49b: 0x0112, 0x49c: 0x0113, 0x49d: 0x0112, + 0x49e: 0x0113, 0x49f: 0x0112, 0x4a0: 0x0113, 0x4a1: 0x0112, 0x4a2: 0x0113, 0x4a3: 0x0112, + 0x4a4: 0x0113, 0x4a5: 0x0112, 0x4a6: 0x0113, 0x4a7: 0x0112, 0x4a8: 0x0113, 0x4a9: 0x0112, + 0x4aa: 0x8d8b, 0x4ab: 0x8deb, 0x4ac: 0x8e4b, 0x4ad: 0x8eab, 0x4ae: 0x8f0b, 0x4af: 0x0012, + 0x4b0: 0x8f6b, 0x4b1: 0x8fcb, 0x4b2: 0x902b, 0x4b3: 0xb353, 0x4b4: 0x0113, 0x4b5: 0x0112, + 0x4b6: 0x0113, 0x4b7: 0x0112, 0x4b8: 0x0113, 0x4b9: 0x0112, 0x4ba: 0x0113, 0x4bb: 0x0112, + 0x4bc: 0x0113, 0x4bd: 0x0112, 0x4be: 0x0113, 0x4bf: 0x0112, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x90ea, 0x4c1: 0x916a, 0x4c2: 0x91ea, 0x4c3: 0x926a, 0x4c4: 0x931a, 0x4c5: 0x93ca, + 0x4c6: 0x944a, + 0x4d3: 0x94ca, 0x4d4: 0x95aa, 0x4d5: 0x968a, 0x4d6: 0x976a, 0x4d7: 0x984a, + 0x4dd: 0x0010, + 0x4de: 0x0034, 0x4df: 0x0010, 0x4e0: 0x0010, 0x4e1: 0x0010, 0x4e2: 0x0010, 0x4e3: 0x0010, + 0x4e4: 0x0010, 0x4e5: 0x0010, 0x4e6: 0x0010, 0x4e7: 0x0010, 0x4e8: 0x0010, + 0x4ea: 0x0010, 0x4eb: 0x0010, 0x4ec: 0x0010, 0x4ed: 0x0010, 0x4ee: 0x0010, 0x4ef: 0x0010, + 0x4f0: 0x0010, 0x4f1: 0x0010, 0x4f2: 0x0010, 0x4f3: 0x0010, 0x4f4: 0x0010, 0x4f5: 0x0010, + 0x4f6: 0x0010, 0x4f8: 0x0010, 0x4f9: 0x0010, 0x4fa: 0x0010, 0x4fb: 0x0010, + 0x4fc: 0x0010, 0x4fe: 0x0010, + // Block 0x14, offset 0x500 + 0x500: 0x2213, 0x501: 0x2213, 0x502: 0x2613, 0x503: 0x2613, 0x504: 0x2213, 0x505: 0x2213, + 0x506: 0x2e13, 0x507: 0x2e13, 0x508: 0x2213, 0x509: 0x2213, 0x50a: 0x2613, 0x50b: 0x2613, + 0x50c: 0x2213, 0x50d: 0x2213, 0x50e: 0x3e13, 0x50f: 0x3e13, 0x510: 0x2213, 0x511: 0x2213, + 0x512: 0x2613, 0x513: 0x2613, 0x514: 0x2213, 0x515: 0x2213, 0x516: 0x2e13, 0x517: 0x2e13, + 0x518: 0x2213, 0x519: 0x2213, 0x51a: 0x2613, 0x51b: 0x2613, 0x51c: 0x2213, 0x51d: 0x2213, + 0x51e: 0xbc53, 0x51f: 0xbc53, 0x520: 0xbf53, 0x521: 0xbf53, 0x522: 0x2212, 0x523: 0x2212, + 0x524: 0x2612, 0x525: 0x2612, 0x526: 0x2212, 0x527: 0x2212, 0x528: 0x2e12, 0x529: 0x2e12, + 0x52a: 0x2212, 0x52b: 0x2212, 0x52c: 0x2612, 0x52d: 0x2612, 0x52e: 0x2212, 0x52f: 0x2212, + 0x530: 0x3e12, 0x531: 0x3e12, 0x532: 0x2212, 0x533: 0x2212, 0x534: 0x2612, 0x535: 0x2612, + 0x536: 0x2212, 0x537: 0x2212, 0x538: 0x2e12, 0x539: 0x2e12, 0x53a: 0x2212, 0x53b: 0x2212, + 0x53c: 0x2612, 0x53d: 0x2612, 0x53e: 0x2212, 0x53f: 0x2212, + // Block 0x15, offset 0x540 + 0x542: 0x0010, + 0x547: 0x0010, 0x549: 0x0010, 0x54b: 0x0010, + 0x54d: 0x0010, 0x54e: 0x0010, 0x54f: 0x0010, 0x551: 0x0010, + 0x552: 0x0010, 0x554: 0x0010, 0x557: 0x0010, + 0x559: 0x0010, 0x55b: 0x0010, 0x55d: 0x0010, + 0x55f: 0x0010, 0x561: 0x0010, 0x562: 0x0010, + 0x564: 0x0010, 0x567: 0x0010, 0x568: 0x0010, 0x569: 0x0010, + 0x56a: 0x0010, 0x56c: 0x0010, 0x56d: 0x0010, 0x56e: 0x0010, 0x56f: 0x0010, + 0x570: 0x0010, 0x571: 0x0010, 0x572: 0x0010, 0x574: 0x0010, 0x575: 0x0010, + 0x576: 0x0010, 0x577: 0x0010, 0x579: 0x0010, 0x57a: 0x0010, 0x57b: 0x0010, + 0x57c: 0x0010, 0x57e: 0x0010, +} + +// caseIndex: 25 blocks, 1600 entries, 3200 bytes +// Block 0 is the zero block. +var caseIndex = [1600]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x14, 0xc3: 0x15, 0xc4: 0x16, 0xc5: 0x17, 0xc6: 0x01, 0xc7: 0x02, + 0xc8: 0x18, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x19, 0xcc: 0x1a, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07, + 0xd0: 0x1b, 0xd1: 0x1c, 0xd2: 0x1d, 0xd3: 0x1e, 0xd4: 0x1f, 0xd5: 0x20, 0xd6: 0x08, 0xd7: 0x21, + 0xd8: 0x22, 0xd9: 0x23, 0xda: 0x24, 0xdb: 0x25, 0xdc: 0x26, 0xdd: 0x27, 0xde: 0x28, 0xdf: 0x29, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09, + 0xf0: 0x14, 0xf3: 0x16, + // Block 0x4, offset 0x100 + 0x120: 0x2a, 0x121: 0x2b, 0x122: 0x2c, 0x123: 0x2d, 0x124: 0x2e, 0x125: 0x2f, 0x126: 0x30, 0x127: 0x31, + 0x128: 0x32, 0x129: 0x33, 0x12a: 0x34, 0x12b: 0x35, 0x12c: 0x36, 0x12d: 0x37, 0x12e: 0x38, 0x12f: 0x39, + 0x130: 0x3a, 0x131: 0x3b, 0x132: 0x3c, 0x133: 0x3d, 0x134: 0x3e, 0x135: 0x3f, 0x136: 0x40, 0x137: 0x41, + 0x138: 0x42, 0x139: 0x43, 0x13a: 0x44, 0x13b: 0x45, 0x13c: 0x46, 0x13d: 0x47, 0x13e: 0x48, 0x13f: 0x49, + // Block 0x5, offset 0x140 + 0x140: 0x4a, 0x141: 0x4b, 0x142: 0x4c, 0x143: 0x09, 0x144: 0x24, 0x145: 0x24, 0x146: 0x24, 0x147: 0x24, + 0x148: 0x24, 0x149: 0x4d, 0x14a: 0x4e, 0x14b: 0x4f, 0x14c: 0x50, 0x14d: 0x51, 0x14e: 0x52, 0x14f: 0x53, + 0x150: 0x54, 0x151: 0x24, 0x152: 0x24, 0x153: 0x24, 0x154: 0x24, 0x155: 0x24, 0x156: 0x24, 0x157: 0x24, + 0x158: 0x24, 0x159: 0x55, 0x15a: 0x56, 0x15b: 0x57, 0x15c: 0x58, 0x15d: 0x59, 0x15e: 0x5a, 0x15f: 0x5b, + 0x160: 0x5c, 0x161: 0x5d, 0x162: 0x5e, 0x163: 0x5f, 0x164: 0x60, 0x165: 0x61, 0x167: 0x62, + 0x168: 0x63, 0x169: 0x64, 0x16a: 0x65, 0x16b: 0x66, 0x16c: 0x67, 0x16d: 0x68, 0x16e: 0x69, 0x16f: 0x6a, + 0x170: 0x6b, 0x171: 0x6c, 0x172: 0x6d, 0x173: 0x6e, 0x174: 0x6f, 0x175: 0x70, 0x176: 0x71, 0x177: 0x72, + 0x178: 0x73, 0x179: 0x73, 0x17a: 0x74, 0x17b: 0x73, 0x17c: 0x75, 0x17d: 0x0a, 0x17e: 0x0b, 0x17f: 0x0c, + // Block 0x6, offset 0x180 + 0x180: 0x76, 0x181: 0x77, 0x182: 0x78, 0x183: 0x79, 0x184: 0x0d, 0x185: 0x7a, 0x186: 0x7b, + 0x192: 0x7c, 0x193: 0x0e, + 0x1b0: 0x7d, 0x1b1: 0x0f, 0x1b2: 0x73, 0x1b3: 0x7e, 0x1b4: 0x7f, 0x1b5: 0x80, 0x1b6: 0x81, 0x1b7: 0x82, + 0x1b8: 0x83, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x84, 0x1c2: 0x85, 0x1c3: 0x86, 0x1c4: 0x87, 0x1c5: 0x24, 0x1c6: 0x88, + // Block 0x8, offset 0x200 + 0x200: 0x89, 0x201: 0x24, 0x202: 0x24, 0x203: 0x24, 0x204: 0x24, 0x205: 0x24, 0x206: 0x24, 0x207: 0x24, + 0x208: 0x24, 0x209: 0x24, 0x20a: 0x24, 0x20b: 0x24, 0x20c: 0x24, 0x20d: 0x24, 0x20e: 0x24, 0x20f: 0x24, + 0x210: 0x24, 0x211: 0x24, 0x212: 0x8a, 0x213: 0x8b, 0x214: 0x24, 0x215: 0x24, 0x216: 0x24, 0x217: 0x24, + 0x218: 0x8c, 0x219: 0x8d, 0x21a: 0x8e, 0x21b: 0x8f, 0x21c: 0x90, 0x21d: 0x91, 0x21e: 0x10, 0x21f: 0x92, + 0x220: 0x93, 0x221: 0x94, 0x222: 0x24, 0x223: 0x95, 0x224: 0x96, 0x225: 0x97, 0x226: 0x98, 0x227: 0x99, + 0x228: 0x9a, 0x229: 0x9b, 0x22a: 0x9c, 0x22b: 0x9d, 0x22c: 0x9e, 0x22d: 0x9f, 0x22e: 0xa0, 0x22f: 0xa1, + 0x230: 0x24, 0x231: 0x24, 0x232: 0x24, 0x233: 0x24, 0x234: 0x24, 0x235: 0x24, 0x236: 0x24, 0x237: 0x24, + 0x238: 0x24, 0x239: 0x24, 0x23a: 0x24, 0x23b: 0x24, 0x23c: 0x24, 0x23d: 0x24, 0x23e: 0x24, 0x23f: 0x24, + // Block 0x9, offset 0x240 + 0x240: 0x24, 0x241: 0x24, 0x242: 0x24, 0x243: 0x24, 0x244: 0x24, 0x245: 0x24, 0x246: 0x24, 0x247: 0x24, + 0x248: 0x24, 0x249: 0x24, 0x24a: 0x24, 0x24b: 0x24, 0x24c: 0x24, 0x24d: 0x24, 0x24e: 0x24, 0x24f: 0x24, + 0x250: 0x24, 0x251: 0x24, 0x252: 0x24, 0x253: 0x24, 0x254: 0x24, 0x255: 0x24, 0x256: 0x24, 0x257: 0x24, + 0x258: 0x24, 0x259: 0x24, 0x25a: 0x24, 0x25b: 0x24, 0x25c: 0x24, 0x25d: 0x24, 0x25e: 0x24, 0x25f: 0x24, + 0x260: 0x24, 0x261: 0x24, 0x262: 0x24, 0x263: 0x24, 0x264: 0x24, 0x265: 0x24, 0x266: 0x24, 0x267: 0x24, + 0x268: 0x24, 0x269: 0x24, 0x26a: 0x24, 0x26b: 0x24, 0x26c: 0x24, 0x26d: 0x24, 0x26e: 0x24, 0x26f: 0x24, + 0x270: 0x24, 0x271: 0x24, 0x272: 0x24, 0x273: 0x24, 0x274: 0x24, 0x275: 0x24, 0x276: 0x24, 0x277: 0x24, + 0x278: 0x24, 0x279: 0x24, 0x27a: 0x24, 0x27b: 0x24, 0x27c: 0x24, 0x27d: 0x24, 0x27e: 0x24, 0x27f: 0x24, + // Block 0xa, offset 0x280 + 0x280: 0x24, 0x281: 0x24, 0x282: 0x24, 0x283: 0x24, 0x284: 0x24, 0x285: 0x24, 0x286: 0x24, 0x287: 0x24, + 0x288: 0x24, 0x289: 0x24, 0x28a: 0x24, 0x28b: 0x24, 0x28c: 0x24, 0x28d: 0x24, 0x28e: 0x24, 0x28f: 0x24, + 0x290: 0x24, 0x291: 0x24, 0x292: 0x24, 0x293: 0x24, 0x294: 0x24, 0x295: 0x24, 0x296: 0x24, 0x297: 0x24, + 0x298: 0x24, 0x299: 0x24, 0x29a: 0x24, 0x29b: 0x24, 0x29c: 0x24, 0x29d: 0x24, 0x29e: 0xa2, 0x29f: 0xa3, + // Block 0xb, offset 0x2c0 + 0x2ec: 0x11, 0x2ed: 0xa4, 0x2ee: 0xa5, 0x2ef: 0xa6, + 0x2f0: 0x24, 0x2f1: 0x24, 0x2f2: 0x24, 0x2f3: 0x24, 0x2f4: 0xa7, 0x2f5: 0xa8, 0x2f6: 0xa9, 0x2f7: 0xaa, + 0x2f8: 0xab, 0x2f9: 0xac, 0x2fa: 0x24, 0x2fb: 0xad, 0x2fc: 0xae, 0x2fd: 0xaf, 0x2fe: 0xb0, 0x2ff: 0xb1, + // Block 0xc, offset 0x300 + 0x300: 0xb2, 0x301: 0xb3, 0x302: 0x24, 0x303: 0xb4, 0x305: 0xb5, 0x307: 0xb6, + 0x30a: 0xb7, 0x30b: 0xb8, 0x30c: 0xb9, 0x30d: 0xba, 0x30e: 0xbb, 0x30f: 0xbc, + 0x310: 0xbd, 0x311: 0xbe, 0x312: 0xbf, 0x313: 0xc0, 0x314: 0xc1, 0x315: 0xc2, + 0x318: 0x24, 0x319: 0x24, 0x31a: 0x24, 0x31b: 0x24, 0x31c: 0xc3, 0x31d: 0xc4, + 0x320: 0xc5, 0x321: 0xc6, 0x322: 0xc7, 0x323: 0xc8, 0x324: 0xc9, 0x326: 0xca, + 0x328: 0xcb, 0x329: 0xcc, 0x32a: 0xcd, 0x32b: 0xce, 0x32c: 0x5f, 0x32d: 0xcf, 0x32e: 0xd0, + 0x330: 0x24, 0x331: 0xd1, 0x332: 0xd2, 0x333: 0xd3, 0x334: 0xd4, + 0x33a: 0xd5, 0x33c: 0xd6, 0x33d: 0xd7, 0x33e: 0xd8, 0x33f: 0xd9, + // Block 0xd, offset 0x340 + 0x340: 0xda, 0x341: 0xdb, 0x342: 0xdc, 0x343: 0xdd, 0x344: 0xde, 0x345: 0xdf, 0x346: 0xe0, 0x347: 0xe1, + 0x348: 0xe2, 0x34a: 0xe3, 0x34b: 0xe4, 0x34c: 0xe5, 0x34d: 0xe6, + 0x350: 0xe7, 0x351: 0xe8, 0x352: 0xe9, 0x353: 0xea, 0x356: 0xeb, 0x357: 0xec, + 0x358: 0xed, 0x359: 0xee, 0x35a: 0xef, 0x35b: 0xf0, 0x35c: 0xf1, + 0x360: 0xf2, 0x362: 0xf3, 0x363: 0xf4, 0x364: 0xf5, 0x365: 0xf6, 0x366: 0xf7, 0x367: 0xf8, + 0x368: 0xf9, 0x369: 0xfa, 0x36a: 0xfb, 0x36b: 0xfc, + 0x370: 0xfd, 0x371: 0xfe, 0x372: 0xff, 0x374: 0x100, 0x375: 0x101, 0x376: 0x102, + 0x37b: 0x103, 0x37e: 0x104, + // Block 0xe, offset 0x380 + 0x380: 0x24, 0x381: 0x24, 0x382: 0x24, 0x383: 0x24, 0x384: 0x24, 0x385: 0x24, 0x386: 0x24, 0x387: 0x24, + 0x388: 0x24, 0x389: 0x24, 0x38a: 0x24, 0x38b: 0x24, 0x38c: 0x24, 0x38d: 0x24, 0x38e: 0x105, + 0x390: 0x24, 0x391: 0x106, 0x392: 0x24, 0x393: 0x24, 0x394: 0x24, 0x395: 0x107, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x24, 0x3c1: 0x24, 0x3c2: 0x24, 0x3c3: 0x24, 0x3c4: 0x24, 0x3c5: 0x24, 0x3c6: 0x24, 0x3c7: 0x24, + 0x3c8: 0x24, 0x3c9: 0x24, 0x3ca: 0x24, 0x3cb: 0x24, 0x3cc: 0x24, 0x3cd: 0x24, 0x3ce: 0x24, 0x3cf: 0x24, + 0x3d0: 0x108, + // Block 0x10, offset 0x400 + 0x410: 0x24, 0x411: 0x24, 0x412: 0x24, 0x413: 0x24, 0x414: 0x24, 0x415: 0x24, 0x416: 0x24, 0x417: 0x24, + 0x418: 0x24, 0x419: 0x109, + // Block 0x11, offset 0x440 + 0x460: 0x24, 0x461: 0x24, 0x462: 0x24, 0x463: 0x24, 0x464: 0x24, 0x465: 0x24, 0x466: 0x24, 0x467: 0x24, + 0x468: 0xfc, 0x469: 0x10a, 0x46b: 0x10b, 0x46c: 0x10c, 0x46d: 0x10d, 0x46e: 0x10e, + 0x479: 0x10f, 0x47c: 0x24, 0x47d: 0x110, 0x47e: 0x111, 0x47f: 0x112, + // Block 0x12, offset 0x480 + 0x4b0: 0x24, 0x4b1: 0x113, 0x4b2: 0x114, + // Block 0x13, offset 0x4c0 + 0x4c5: 0x115, 0x4c6: 0x116, + 0x4c9: 0x117, + 0x4d0: 0x118, 0x4d1: 0x119, 0x4d2: 0x11a, 0x4d3: 0x11b, 0x4d4: 0x11c, 0x4d5: 0x11d, 0x4d6: 0x11e, 0x4d7: 0x11f, + 0x4d8: 0x120, 0x4d9: 0x121, 0x4da: 0x122, 0x4db: 0x123, 0x4dc: 0x124, 0x4dd: 0x125, 0x4de: 0x126, 0x4df: 0x127, + 0x4e8: 0x128, 0x4e9: 0x129, 0x4ea: 0x12a, + // Block 0x14, offset 0x500 + 0x500: 0x12b, 0x504: 0x12c, 0x505: 0x12d, + 0x50b: 0x12e, + 0x520: 0x24, 0x521: 0x24, 0x522: 0x24, 0x523: 0x12f, 0x524: 0x12, 0x525: 0x130, + 0x538: 0x131, 0x539: 0x13, 0x53a: 0x132, + // Block 0x15, offset 0x540 + 0x544: 0x133, 0x545: 0x134, 0x546: 0x135, + 0x54f: 0x136, + 0x56f: 0x137, + // Block 0x16, offset 0x580 + 0x590: 0x0a, 0x591: 0x0b, 0x592: 0x0c, 0x593: 0x0d, 0x594: 0x0e, 0x596: 0x0f, + 0x59b: 0x10, 0x59d: 0x11, 0x59e: 0x12, 0x59f: 0x13, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x138, 0x5c1: 0x139, 0x5c4: 0x139, 0x5c5: 0x139, 0x5c6: 0x139, 0x5c7: 0x13a, + // Block 0x18, offset 0x600 + 0x620: 0x15, +} + +// sparseOffsets: 296 entries, 592 bytes +var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x34, 0x37, 0x3b, 0x3e, 0x42, 0x4c, 0x4e, 0x57, 0x5e, 0x63, 0x71, 0x72, 0x80, 0x8f, 0x99, 0x9c, 0xa3, 0xab, 0xae, 0xb0, 0xc0, 0xc6, 0xd4, 0xdf, 0xec, 0xf7, 0x103, 0x10d, 0x119, 0x124, 0x130, 0x13c, 0x144, 0x14d, 0x157, 0x162, 0x16e, 0x174, 0x17f, 0x185, 0x18d, 0x190, 0x195, 0x199, 0x19d, 0x1a4, 0x1ad, 0x1b5, 0x1b6, 0x1bf, 0x1c6, 0x1ce, 0x1d4, 0x1d9, 0x1dd, 0x1e0, 0x1e2, 0x1e5, 0x1ea, 0x1eb, 0x1ed, 0x1ef, 0x1f1, 0x1f8, 0x1fd, 0x201, 0x20a, 0x20d, 0x210, 0x216, 0x217, 0x222, 0x223, 0x224, 0x229, 0x236, 0x23f, 0x240, 0x248, 0x251, 0x25a, 0x263, 0x268, 0x26b, 0x276, 0x284, 0x286, 0x28d, 0x291, 0x29d, 0x29e, 0x2a9, 0x2b1, 0x2b9, 0x2bf, 0x2c0, 0x2ce, 0x2d3, 0x2d6, 0x2db, 0x2df, 0x2e5, 0x2ea, 0x2ed, 0x2f2, 0x2f7, 0x2f8, 0x2fe, 0x300, 0x301, 0x303, 0x305, 0x308, 0x309, 0x30b, 0x30e, 0x314, 0x318, 0x31a, 0x31f, 0x326, 0x331, 0x33b, 0x33c, 0x345, 0x349, 0x34e, 0x356, 0x35c, 0x362, 0x36c, 0x371, 0x37a, 0x380, 0x389, 0x38d, 0x395, 0x397, 0x399, 0x39c, 0x39e, 0x3a0, 0x3a1, 0x3a2, 0x3a4, 0x3a6, 0x3ac, 0x3b1, 0x3b3, 0x3ba, 0x3bd, 0x3bf, 0x3c5, 0x3ca, 0x3cc, 0x3cd, 0x3ce, 0x3cf, 0x3d1, 0x3d3, 0x3d5, 0x3d8, 0x3da, 0x3dd, 0x3e5, 0x3e8, 0x3ec, 0x3f4, 0x3f6, 0x3f7, 0x3f8, 0x3fa, 0x400, 0x402, 0x403, 0x405, 0x407, 0x409, 0x416, 0x417, 0x418, 0x41c, 0x41e, 0x41f, 0x420, 0x421, 0x422, 0x425, 0x428, 0x42b, 0x431, 0x432, 0x434, 0x438, 0x43c, 0x442, 0x445, 0x44c, 0x450, 0x454, 0x45d, 0x466, 0x46c, 0x472, 0x47c, 0x486, 0x488, 0x491, 0x497, 0x49d, 0x4a3, 0x4a6, 0x4ac, 0x4af, 0x4b8, 0x4b9, 0x4c0, 0x4c4, 0x4c5, 0x4c8, 0x4d2, 0x4d5, 0x4d7, 0x4de, 0x4e6, 0x4ec, 0x4f2, 0x4f3, 0x4f9, 0x4fc, 0x504, 0x50b, 0x515, 0x51d, 0x520, 0x521, 0x522, 0x523, 0x524, 0x526, 0x527, 0x529, 0x52b, 0x52d, 0x531, 0x532, 0x534, 0x537, 0x539, 0x53c, 0x53e, 0x543, 0x548, 0x54c, 0x54d, 0x550, 0x554, 0x55f, 0x563, 0x56b, 0x570, 0x574, 0x577, 0x57b, 0x57e, 0x581, 0x586, 0x58a, 0x58e, 0x592, 0x596, 0x598, 0x59a, 0x59d, 0x5a2, 0x5a5, 0x5a7, 0x5aa, 0x5ac, 0x5b2, 0x5bb, 0x5c0, 0x5c1, 0x5c4, 0x5c5, 0x5c6, 0x5c7, 0x5c9, 0x5ca, 0x5cb} + +// sparseValues: 1483 entries, 5932 bytes +var sparseValues = [1483]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0004, lo: 0xa8, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xaa}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0004, lo: 0xaf, hi: 0xaf}, + {value: 0x0004, lo: 0xb4, hi: 0xb4}, + {value: 0x001a, lo: 0xb5, hi: 0xb5}, + {value: 0x0054, lo: 0xb7, hi: 0xb7}, + {value: 0x0004, lo: 0xb8, hi: 0xb8}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + // Block 0x1, offset 0x9 + {value: 0x2013, lo: 0x80, hi: 0x96}, + {value: 0x2013, lo: 0x98, hi: 0x9e}, + {value: 0x009a, lo: 0x9f, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xb6}, + {value: 0x2012, lo: 0xb8, hi: 0xbe}, + {value: 0x0252, lo: 0xbf, hi: 0xbf}, + // Block 0x2, offset 0xf + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x011b, lo: 0xb0, hi: 0xb0}, + {value: 0x019a, lo: 0xb1, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb7}, + {value: 0x0012, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x0553, lo: 0xbf, hi: 0xbf}, + // Block 0x3, offset 0x18 + {value: 0x0552, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x01da, lo: 0x89, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xb7}, + {value: 0x0253, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x028a, lo: 0xbf, hi: 0xbf}, + // Block 0x4, offset 0x24 + {value: 0x0117, lo: 0x80, hi: 0x9f}, + {value: 0x2f53, lo: 0xa0, hi: 0xa0}, + {value: 0x0012, lo: 0xa1, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xb3}, + {value: 0x0012, lo: 0xb4, hi: 0xb9}, + {value: 0x090b, lo: 0xba, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x2953, lo: 0xbd, hi: 0xbd}, + {value: 0x098b, lo: 0xbe, hi: 0xbe}, + {value: 0x0a0a, lo: 0xbf, hi: 0xbf}, + // Block 0x5, offset 0x2e + {value: 0x0015, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x97}, + {value: 0x0004, lo: 0x98, hi: 0x9d}, + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0015, lo: 0xa0, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xbf}, + // Block 0x6, offset 0x34 + {value: 0x0024, lo: 0x80, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbf}, + // Block 0x7, offset 0x37 + {value: 0x6553, lo: 0x80, hi: 0x8f}, + {value: 0x2013, lo: 0x90, hi: 0x9f}, + {value: 0x5f53, lo: 0xa0, hi: 0xaf}, + {value: 0x2012, lo: 0xb0, hi: 0xbf}, + // Block 0x8, offset 0x3b + {value: 0x5f52, lo: 0x80, hi: 0x8f}, + {value: 0x6552, lo: 0x90, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x9, offset 0x3e + {value: 0x0117, lo: 0x80, hi: 0x81}, + {value: 0x0024, lo: 0x83, hi: 0x87}, + {value: 0x0014, lo: 0x88, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xbf}, + // Block 0xa, offset 0x42 + {value: 0x0f13, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x0316, lo: 0x89, hi: 0x8a}, + {value: 0x0716, lo: 0x8b, hi: 0x8c}, + {value: 0x0316, lo: 0x8d, hi: 0x8e}, + {value: 0x0f12, lo: 0x8f, hi: 0x8f}, + {value: 0x0117, lo: 0x90, hi: 0xbf}, + // Block 0xb, offset 0x4c + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x6553, lo: 0xb1, hi: 0xbf}, + // Block 0xc, offset 0x4e + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6853, lo: 0x90, hi: 0x96}, + {value: 0x0014, lo: 0x99, hi: 0x99}, + {value: 0x0010, lo: 0x9a, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0054, lo: 0x9f, hi: 0x9f}, + {value: 0x0012, lo: 0xa0, hi: 0xa0}, + {value: 0x6552, lo: 0xa1, hi: 0xaf}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0xd, offset 0x57 + {value: 0x0034, lo: 0x81, hi: 0x82}, + {value: 0x0024, lo: 0x84, hi: 0x84}, + {value: 0x0034, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0xaa}, + {value: 0x0010, lo: 0xaf, hi: 0xb3}, + {value: 0x0054, lo: 0xb4, hi: 0xb4}, + // Block 0xe, offset 0x5e + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0024, lo: 0x90, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0014, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xf, offset 0x63 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9c}, + {value: 0x0024, lo: 0x9d, hi: 0x9e}, + {value: 0x0034, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0034, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x10, offset 0x71 + {value: 0x0010, lo: 0x80, hi: 0xbf}, + // Block 0x11, offset 0x72 + {value: 0x0010, lo: 0x80, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0024, lo: 0x9f, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xaa, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x12, offset 0x80 + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0034, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0034, lo: 0xb1, hi: 0xb1}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbd}, + {value: 0x0034, lo: 0xbe, hi: 0xbe}, + {value: 0x0024, lo: 0xbf, hi: 0xbf}, + // Block 0x13, offset 0x8f + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0024, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x88}, + {value: 0x0024, lo: 0x89, hi: 0x8a}, + {value: 0x0010, lo: 0x8d, hi: 0xbf}, + // Block 0x14, offset 0x99 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x15, offset 0x9c + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xb1}, + {value: 0x0034, lo: 0xb2, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0x16, offset 0xa3 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x99}, + {value: 0x0014, lo: 0x9a, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0xa3}, + {value: 0x0014, lo: 0xa4, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xad}, + // Block 0x17, offset 0xab + {value: 0x0010, lo: 0x80, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0xa0, hi: 0xaa}, + // Block 0x18, offset 0xae + {value: 0x0010, lo: 0xa0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0x19, offset 0xb0 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0034, lo: 0x93, hi: 0x93}, + {value: 0x0024, lo: 0x94, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0024, lo: 0xaa, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbf}, + // Block 0x1a, offset 0xc0 + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1b, offset 0xc6 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0x1c, offset 0xd4 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb6, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1d, offset 0xdf + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xb1}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + // Block 0x1e, offset 0xec + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x1f, offset 0xf7 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x99, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x20, offset 0x103 + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x21, offset 0x10d + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x85}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xbf}, + // Block 0x22, offset 0x119 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x23, offset 0x124 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x24, offset 0x130 + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0010, lo: 0xa8, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x25, offset 0x13c + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x26, offset 0x144 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb9}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbf}, + // Block 0x27, offset 0x14d + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x88}, + {value: 0x0014, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x28, offset 0x157 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x29, offset 0x162 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb2}, + // Block 0x2a, offset 0x16e + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x2b, offset 0x174 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x94, hi: 0x97}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xba, hi: 0xbf}, + // Block 0x2c, offset 0x17f + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x96}, + {value: 0x0010, lo: 0x9a, hi: 0xb1}, + {value: 0x0010, lo: 0xb3, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x2d, offset 0x185 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x94}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9f}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + // Block 0x2e, offset 0x18d + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xba}, + // Block 0x2f, offset 0x190 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x30, offset 0x195 + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xba}, + {value: 0x0014, lo: 0xbb, hi: 0xbc}, + // Block 0x31, offset 0x199 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x32, offset 0x19d + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0034, lo: 0x98, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0034, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x33, offset 0x1a4 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xac}, + {value: 0x0034, lo: 0xb1, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xba, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x34, offset 0x1ad + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0024, lo: 0x82, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x86, hi: 0x87}, + {value: 0x0010, lo: 0x88, hi: 0x8c}, + {value: 0x0014, lo: 0x8d, hi: 0x97}, + {value: 0x0014, lo: 0x99, hi: 0xbc}, + // Block 0x35, offset 0x1b5 + {value: 0x0034, lo: 0x86, hi: 0x86}, + // Block 0x36, offset 0x1b6 + {value: 0x0010, lo: 0xab, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbe}, + // Block 0x37, offset 0x1bf + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x96, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x99}, + {value: 0x0014, lo: 0x9e, hi: 0xa0}, + {value: 0x0010, lo: 0xa2, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xad}, + {value: 0x0014, lo: 0xb1, hi: 0xb4}, + // Block 0x38, offset 0x1c6 + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x6c53, lo: 0xa0, hi: 0xbf}, + // Block 0x39, offset 0x1ce + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x9a, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x3a, offset 0x1d4 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x3b, offset 0x1d9 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x82, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3c, offset 0x1dd + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3d, offset 0x1e0 + {value: 0x0010, lo: 0x80, hi: 0x9a}, + {value: 0x0024, lo: 0x9d, hi: 0x9f}, + // Block 0x3e, offset 0x1e2 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x7453, lo: 0xa0, hi: 0xaf}, + {value: 0x7853, lo: 0xb0, hi: 0xbf}, + // Block 0x3f, offset 0x1e5 + {value: 0x7c53, lo: 0x80, hi: 0x8f}, + {value: 0x8053, lo: 0x90, hi: 0x9f}, + {value: 0x7c53, lo: 0xa0, hi: 0xaf}, + {value: 0x0813, lo: 0xb0, hi: 0xb5}, + {value: 0x0892, lo: 0xb8, hi: 0xbd}, + // Block 0x40, offset 0x1ea + {value: 0x0010, lo: 0x81, hi: 0xbf}, + // Block 0x41, offset 0x1eb + {value: 0x0010, lo: 0x80, hi: 0xac}, + {value: 0x0010, lo: 0xaf, hi: 0xbf}, + // Block 0x42, offset 0x1ed + {value: 0x0010, lo: 0x81, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x43, offset 0x1ef + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb8}, + // Block 0x44, offset 0x1f1 + {value: 0x0010, lo: 0x80, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0034, lo: 0x94, hi: 0x94}, + {value: 0x0010, lo: 0xa0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + // Block 0x45, offset 0x1f8 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xac}, + {value: 0x0010, lo: 0xae, hi: 0xb0}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + // Block 0x46, offset 0x1fd + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x47, offset 0x201 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x89, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0014, lo: 0x93, hi: 0x93}, + {value: 0x0004, lo: 0x97, hi: 0x97}, + {value: 0x0024, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0x48, offset 0x20a + {value: 0x0014, lo: 0x8b, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x49, offset 0x20d + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb8}, + // Block 0x4a, offset 0x210 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x4b, offset 0x216 + {value: 0x0010, lo: 0x80, hi: 0xb5}, + // Block 0x4c, offset 0x217 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbb}, + // Block 0x4d, offset 0x222 + {value: 0x0010, lo: 0x86, hi: 0x8f}, + // Block 0x4e, offset 0x223 + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x4f, offset 0x224 + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + // Block 0x50, offset 0x229 + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x9e}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xac}, + {value: 0x0010, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xbc}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x51, offset 0x236 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xa7, hi: 0xa7}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + {value: 0x0034, lo: 0xb5, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbc}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x52, offset 0x23f + {value: 0x0034, lo: 0x80, hi: 0x80}, + // Block 0x53, offset 0x240 + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x54, offset 0x248 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0030, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8b}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xab, hi: 0xab}, + {value: 0x0034, lo: 0xac, hi: 0xac}, + {value: 0x0024, lo: 0xad, hi: 0xb3}, + // Block 0x55, offset 0x251 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0030, lo: 0xaa, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbf}, + // Block 0x56, offset 0x25a + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0030, lo: 0xb2, hi: 0xb3}, + // Block 0x57, offset 0x263 + {value: 0x0010, lo: 0x80, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0x58, offset 0x268 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8d, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x59, offset 0x26b + {value: 0x31ea, lo: 0x80, hi: 0x80}, + {value: 0x326a, lo: 0x81, hi: 0x81}, + {value: 0x32ea, lo: 0x82, hi: 0x82}, + {value: 0x336a, lo: 0x83, hi: 0x83}, + {value: 0x33ea, lo: 0x84, hi: 0x84}, + {value: 0x346a, lo: 0x85, hi: 0x85}, + {value: 0x34ea, lo: 0x86, hi: 0x86}, + {value: 0x356a, lo: 0x87, hi: 0x87}, + {value: 0x35ea, lo: 0x88, hi: 0x88}, + {value: 0x8353, lo: 0x90, hi: 0xba}, + {value: 0x8353, lo: 0xbd, hi: 0xbf}, + // Block 0x5a, offset 0x276 + {value: 0x0024, lo: 0x90, hi: 0x92}, + {value: 0x0034, lo: 0x94, hi: 0x99}, + {value: 0x0024, lo: 0x9a, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9f}, + {value: 0x0024, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0034, lo: 0xa2, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xb3}, + {value: 0x0024, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb7}, + {value: 0x0024, lo: 0xb8, hi: 0xb9}, + {value: 0x0010, lo: 0xba, hi: 0xba}, + // Block 0x5b, offset 0x284 + {value: 0x0012, lo: 0x80, hi: 0xab}, + {value: 0x0015, lo: 0xac, hi: 0xbf}, + // Block 0x5c, offset 0x286 + {value: 0x0015, lo: 0x80, hi: 0xaa}, + {value: 0x0012, lo: 0xab, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb8}, + {value: 0x8752, lo: 0xb9, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbc}, + {value: 0x8b52, lo: 0xbd, hi: 0xbd}, + {value: 0x0012, lo: 0xbe, hi: 0xbf}, + // Block 0x5d, offset 0x28d + {value: 0x0012, lo: 0x80, hi: 0x8d}, + {value: 0x8f52, lo: 0x8e, hi: 0x8e}, + {value: 0x0012, lo: 0x8f, hi: 0x9a}, + {value: 0x0015, lo: 0x9b, hi: 0xbf}, + // Block 0x5e, offset 0x291 + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0024, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb9}, + {value: 0x0024, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbd}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x5f, offset 0x29d + {value: 0x0117, lo: 0x80, hi: 0xbf}, + // Block 0x60, offset 0x29e + {value: 0x0117, lo: 0x80, hi: 0x95}, + {value: 0x369a, lo: 0x96, hi: 0x96}, + {value: 0x374a, lo: 0x97, hi: 0x97}, + {value: 0x37fa, lo: 0x98, hi: 0x98}, + {value: 0x38aa, lo: 0x99, hi: 0x99}, + {value: 0x395a, lo: 0x9a, hi: 0x9a}, + {value: 0x3a0a, lo: 0x9b, hi: 0x9b}, + {value: 0x0012, lo: 0x9c, hi: 0x9d}, + {value: 0x3abb, lo: 0x9e, hi: 0x9e}, + {value: 0x0012, lo: 0x9f, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x61, offset 0x2a9 + {value: 0x0812, lo: 0x80, hi: 0x87}, + {value: 0x0813, lo: 0x88, hi: 0x8f}, + {value: 0x0812, lo: 0x90, hi: 0x95}, + {value: 0x0813, lo: 0x98, hi: 0x9d}, + {value: 0x0812, lo: 0xa0, hi: 0xa7}, + {value: 0x0813, lo: 0xa8, hi: 0xaf}, + {value: 0x0812, lo: 0xb0, hi: 0xb7}, + {value: 0x0813, lo: 0xb8, hi: 0xbf}, + // Block 0x62, offset 0x2b1 + {value: 0x0004, lo: 0x8b, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8f}, + {value: 0x0054, lo: 0x98, hi: 0x99}, + {value: 0x0054, lo: 0xa4, hi: 0xa4}, + {value: 0x0054, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xaa, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xaf}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x63, offset 0x2b9 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x94, hi: 0x94}, + {value: 0x0014, lo: 0xa0, hi: 0xa4}, + {value: 0x0014, lo: 0xa6, hi: 0xaf}, + {value: 0x0015, lo: 0xb1, hi: 0xb1}, + {value: 0x0015, lo: 0xbf, hi: 0xbf}, + // Block 0x64, offset 0x2bf + {value: 0x0015, lo: 0x90, hi: 0x9c}, + // Block 0x65, offset 0x2c0 + {value: 0x0024, lo: 0x90, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x93}, + {value: 0x0024, lo: 0x94, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0xa0}, + {value: 0x0024, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa4}, + {value: 0x0034, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa7}, + {value: 0x0034, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xa9}, + {value: 0x0034, lo: 0xaa, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + // Block 0x66, offset 0x2ce + {value: 0x0016, lo: 0x85, hi: 0x86}, + {value: 0x0012, lo: 0x87, hi: 0x89}, + {value: 0xa452, lo: 0x8e, hi: 0x8e}, + {value: 0x1013, lo: 0xa0, hi: 0xaf}, + {value: 0x1012, lo: 0xb0, hi: 0xbf}, + // Block 0x67, offset 0x2d3 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x88}, + // Block 0x68, offset 0x2d6 + {value: 0xa753, lo: 0xb6, hi: 0xb7}, + {value: 0xaa53, lo: 0xb8, hi: 0xb9}, + {value: 0xad53, lo: 0xba, hi: 0xbb}, + {value: 0xaa53, lo: 0xbc, hi: 0xbd}, + {value: 0xa753, lo: 0xbe, hi: 0xbf}, + // Block 0x69, offset 0x2db + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6553, lo: 0x90, hi: 0x9f}, + {value: 0xb053, lo: 0xa0, hi: 0xae}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0x6a, offset 0x2df + {value: 0x0117, lo: 0x80, hi: 0xa3}, + {value: 0x0012, lo: 0xa4, hi: 0xa4}, + {value: 0x0716, lo: 0xab, hi: 0xac}, + {value: 0x0316, lo: 0xad, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb3}, + // Block 0x6b, offset 0x2e5 + {value: 0x6c52, lo: 0x80, hi: 0x9f}, + {value: 0x7052, lo: 0xa0, hi: 0xa5}, + {value: 0x7052, lo: 0xa7, hi: 0xa7}, + {value: 0x7052, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x6c, offset 0x2ea + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x6d, offset 0x2ed + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0010, lo: 0xb0, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x6e, offset 0x2f2 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9e}, + {value: 0x0024, lo: 0xa0, hi: 0xbf}, + // Block 0x6f, offset 0x2f7 + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + // Block 0x70, offset 0x2f8 + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0xaa, hi: 0xad}, + {value: 0x0030, lo: 0xae, hi: 0xaf}, + {value: 0x0004, lo: 0xb1, hi: 0xb5}, + {value: 0x0014, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + // Block 0x71, offset 0x2fe + {value: 0x0034, lo: 0x99, hi: 0x9a}, + {value: 0x0004, lo: 0x9b, hi: 0x9e}, + // Block 0x72, offset 0x300 + {value: 0x0004, lo: 0xbc, hi: 0xbe}, + // Block 0x73, offset 0x301 + {value: 0x0010, lo: 0x85, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x74, offset 0x303 + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x75, offset 0x305 + {value: 0x0010, lo: 0x80, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0xbf}, + // Block 0x76, offset 0x308 + {value: 0x0010, lo: 0x80, hi: 0x8c}, + // Block 0x77, offset 0x309 + {value: 0x0010, lo: 0x90, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x78, offset 0x30b + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0xab}, + // Block 0x79, offset 0x30e + {value: 0x0117, lo: 0x80, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb2}, + {value: 0x0024, lo: 0xb4, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x7a, offset 0x314 + {value: 0x0117, lo: 0x80, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9d}, + {value: 0x0024, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x7b, offset 0x318 + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb1}, + // Block 0x7c, offset 0x31a + {value: 0x0004, lo: 0x80, hi: 0x87}, + {value: 0x0014, lo: 0x88, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xaf}, + {value: 0x0012, lo: 0xb0, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xbf}, + // Block 0x7d, offset 0x31f + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x0015, lo: 0xb0, hi: 0xb0}, + {value: 0x0012, lo: 0xb1, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x8753, lo: 0xbd, hi: 0xbd}, + {value: 0x0117, lo: 0xbe, hi: 0xbf}, + // Block 0x7e, offset 0x326 + {value: 0x0117, lo: 0x82, hi: 0x83}, + {value: 0x6553, lo: 0x84, hi: 0x84}, + {value: 0x908b, lo: 0x85, hi: 0x85}, + {value: 0x8f53, lo: 0x86, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x0316, lo: 0x89, hi: 0x8a}, + {value: 0x0316, lo: 0xb5, hi: 0xb6}, + {value: 0x0010, lo: 0xb7, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbf}, + // Block 0x7f, offset 0x331 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8b}, + {value: 0x0010, lo: 0x8c, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0034, lo: 0xac, hi: 0xac}, + // Block 0x80, offset 0x33b + {value: 0x0010, lo: 0x80, hi: 0xb3}, + // Block 0x81, offset 0x33c + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xa0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb7}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x82, offset 0x345 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x83, offset 0x349 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0x92}, + {value: 0x0030, lo: 0x93, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0x84, offset 0x34e + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb9}, + {value: 0x0010, lo: 0xba, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x85, offset 0x356 + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0004, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x86, offset 0x35c + {value: 0x0010, lo: 0x80, hi: 0xa8}, + {value: 0x0014, lo: 0xa9, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0x87, offset 0x362 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x88, offset 0x36c + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0024, lo: 0xbe, hi: 0xbf}, + // Block 0x89, offset 0x371 + {value: 0x0024, lo: 0x81, hi: 0x81}, + {value: 0x0004, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + // Block 0x8a, offset 0x37a + {value: 0x0010, lo: 0x81, hi: 0x86}, + {value: 0x0010, lo: 0x89, hi: 0x8e}, + {value: 0x0010, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x8b, offset 0x380 + {value: 0x0012, lo: 0x80, hi: 0x92}, + {value: 0xb352, lo: 0x93, hi: 0x93}, + {value: 0x0012, lo: 0x94, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9f}, + {value: 0x0012, lo: 0xa0, hi: 0xa8}, + {value: 0x0014, lo: 0xa9, hi: 0xa9}, + {value: 0x0004, lo: 0xaa, hi: 0xab}, + {value: 0x74d2, lo: 0xb0, hi: 0xbf}, + // Block 0x8c, offset 0x389 + {value: 0x78d2, lo: 0x80, hi: 0x8f}, + {value: 0x7cd2, lo: 0x90, hi: 0x9f}, + {value: 0x80d2, lo: 0xa0, hi: 0xaf}, + {value: 0x7cd2, lo: 0xb0, hi: 0xbf}, + // Block 0x8d, offset 0x38d + {value: 0x0010, lo: 0x80, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x8e, offset 0x395 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x8f, offset 0x397 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x8b, hi: 0xbb}, + // Block 0x90, offset 0x399 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0xbf}, + // Block 0x91, offset 0x39c + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0004, lo: 0xb2, hi: 0xbf}, + // Block 0x92, offset 0x39e + {value: 0x0004, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x93, hi: 0xbf}, + // Block 0x93, offset 0x3a0 + {value: 0x0010, lo: 0x80, hi: 0xbd}, + // Block 0x94, offset 0x3a1 + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0x95, offset 0x3a2 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0xbf}, + // Block 0x96, offset 0x3a4 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0xb0, hi: 0xbb}, + // Block 0x97, offset 0x3a6 + {value: 0x0014, lo: 0x80, hi: 0x8f}, + {value: 0x0054, lo: 0x93, hi: 0x93}, + {value: 0x0024, lo: 0xa0, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xad}, + {value: 0x0024, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + // Block 0x98, offset 0x3ac + {value: 0x0010, lo: 0x8d, hi: 0x8f}, + {value: 0x0054, lo: 0x92, hi: 0x92}, + {value: 0x0054, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0xb0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0x99, offset 0x3b1 + {value: 0x0010, lo: 0x80, hi: 0xbc}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x9a, offset 0x3b3 + {value: 0x0054, lo: 0x87, hi: 0x87}, + {value: 0x0054, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0054, lo: 0x9a, hi: 0x9a}, + {value: 0x5f53, lo: 0xa1, hi: 0xba}, + {value: 0x0004, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9b, offset 0x3ba + {value: 0x0004, lo: 0x80, hi: 0x80}, + {value: 0x5f52, lo: 0x81, hi: 0x9a}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + // Block 0x9c, offset 0x3bd + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbe}, + // Block 0x9d, offset 0x3bf + {value: 0x0010, lo: 0x82, hi: 0x87}, + {value: 0x0010, lo: 0x8a, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0x97}, + {value: 0x0010, lo: 0x9a, hi: 0x9c}, + {value: 0x0004, lo: 0xa3, hi: 0xa3}, + {value: 0x0014, lo: 0xb9, hi: 0xbb}, + // Block 0x9e, offset 0x3c5 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0010, lo: 0x8d, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xba}, + {value: 0x0010, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9f, offset 0x3ca + {value: 0x0010, lo: 0x80, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x9d}, + // Block 0xa0, offset 0x3cc + {value: 0x0010, lo: 0x80, hi: 0xba}, + // Block 0xa1, offset 0x3cd + {value: 0x0010, lo: 0x80, hi: 0xb4}, + // Block 0xa2, offset 0x3ce + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0xa3, offset 0x3cf + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa4, offset 0x3d1 + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + // Block 0xa5, offset 0x3d3 + {value: 0x0010, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xad, hi: 0xbf}, + // Block 0xa6, offset 0x3d5 + {value: 0x0010, lo: 0x80, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0xb5}, + {value: 0x0024, lo: 0xb6, hi: 0xba}, + // Block 0xa7, offset 0x3d8 + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa8, offset 0x3da + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x91, hi: 0x95}, + // Block 0xa9, offset 0x3dd + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x97}, + {value: 0xb653, lo: 0x98, hi: 0x9f}, + {value: 0xb953, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbf}, + // Block 0xaa, offset 0x3e5 + {value: 0xb652, lo: 0x80, hi: 0x87}, + {value: 0xb952, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0xab, offset 0x3e8 + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0xb953, lo: 0xb0, hi: 0xb7}, + {value: 0xb653, lo: 0xb8, hi: 0xbf}, + // Block 0xac, offset 0x3ec + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x93}, + {value: 0xb952, lo: 0x98, hi: 0x9f}, + {value: 0xb652, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbb}, + // Block 0xad, offset 0x3f4 + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xae, offset 0x3f6 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + // Block 0xaf, offset 0x3f7 + {value: 0x0010, lo: 0x80, hi: 0xb6}, + // Block 0xb0, offset 0x3f8 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xa7}, + // Block 0xb1, offset 0x3fa + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xb5}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xb2, offset 0x400 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb6}, + // Block 0xb3, offset 0x402 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + // Block 0xb4, offset 0x403 + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + // Block 0xb5, offset 0x405 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb9}, + // Block 0xb6, offset 0x407 + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0xb7, offset 0x409 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x8e, hi: 0x8e}, + {value: 0x0024, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x99, hi: 0xb5}, + {value: 0x0024, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xb8, offset 0x416 + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0xb9, offset 0x417 + {value: 0x0010, lo: 0x80, hi: 0x9c}, + // Block 0xba, offset 0x418 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + // Block 0xbb, offset 0x41c + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + // Block 0xbc, offset 0x41e + {value: 0x0010, lo: 0x80, hi: 0x91}, + // Block 0xbd, offset 0x41f + {value: 0x0010, lo: 0x80, hi: 0x88}, + // Block 0xbe, offset 0x420 + {value: 0x5653, lo: 0x80, hi: 0xb2}, + // Block 0xbf, offset 0x421 + {value: 0x5652, lo: 0x80, hi: 0xb2}, + // Block 0xc0, offset 0x422 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xc1, offset 0x425 + {value: 0x0010, lo: 0x80, hi: 0xa9}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0010, lo: 0xb0, hi: 0xb1}, + // Block 0xc2, offset 0x428 + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xc3, offset 0x42b + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x87}, + {value: 0x0024, lo: 0x88, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x8b}, + {value: 0x0024, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + // Block 0xc4, offset 0x431 + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xc5, offset 0x432 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0010, lo: 0xa0, hi: 0xb6}, + // Block 0xc6, offset 0x434 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xc7, offset 0x438 + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xc8, offset 0x43c + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb6}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + // Block 0xc9, offset 0x442 + {value: 0x0014, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xca, offset 0x445 + {value: 0x0024, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0xcb, offset 0x44c + {value: 0x0010, lo: 0x84, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + // Block 0xcc, offset 0x450 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xcd, offset 0x454 + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x89, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + // Block 0xce, offset 0x45d + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb4}, + {value: 0x0030, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xb7}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0xcf, offset 0x466 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xd0, offset 0x46c + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa2}, + {value: 0x0014, lo: 0xa3, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xd1, offset 0x472 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xd2, offset 0x47c + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0030, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9d, hi: 0xa3}, + {value: 0x0024, lo: 0xa6, hi: 0xac}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + // Block 0xd3, offset 0x486 + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xd4, offset 0x488 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + // Block 0xd5, offset 0x491 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xd6, offset 0x497 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd7, offset 0x49d + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd8, offset 0x4a3 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x98, hi: 0x9b}, + {value: 0x0014, lo: 0x9c, hi: 0x9d}, + // Block 0xd9, offset 0x4a6 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xda, offset 0x4ac + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xdb, offset 0x4af + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0014, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb5}, + {value: 0x0030, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + // Block 0xdc, offset 0x4b8 + {value: 0x0010, lo: 0x80, hi: 0x89}, + // Block 0xdd, offset 0x4b9 + {value: 0x0014, lo: 0x9d, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xde, offset 0x4c0 + {value: 0x0010, lo: 0x80, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + // Block 0xdf, offset 0x4c4 + {value: 0x5f53, lo: 0xa0, hi: 0xbf}, + // Block 0xe0, offset 0x4c5 + {value: 0x5f52, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xe1, offset 0x4c8 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x89, hi: 0x89}, + {value: 0x0010, lo: 0x8c, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0xb5}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0014, lo: 0xbb, hi: 0xbc}, + {value: 0x0030, lo: 0xbd, hi: 0xbd}, + {value: 0x0034, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xe2, offset 0x4d2 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0034, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xe3, offset 0x4d5 + {value: 0x0010, lo: 0xa0, hi: 0xa7}, + {value: 0x0010, lo: 0xaa, hi: 0xbf}, + // Block 0xe4, offset 0x4d7 + {value: 0x0010, lo: 0x80, hi: 0x93}, + {value: 0x0014, lo: 0x94, hi: 0x97}, + {value: 0x0014, lo: 0x9a, hi: 0x9b}, + {value: 0x0010, lo: 0x9c, hi: 0x9f}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + // Block 0xe5, offset 0x4de + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x8a}, + {value: 0x0010, lo: 0x8b, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbb, hi: 0xbe}, + // Block 0xe6, offset 0x4e6 + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0014, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x98}, + {value: 0x0014, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0x9c, hi: 0xbf}, + // Block 0xe7, offset 0x4ec + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0014, lo: 0x8a, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x99}, + {value: 0x0010, lo: 0x9d, hi: 0x9d}, + // Block 0xe8, offset 0x4f2 + {value: 0x0010, lo: 0x80, hi: 0xb8}, + // Block 0xe9, offset 0x4f3 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb6}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xea, offset 0x4f9 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0xeb, offset 0x4fc + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0014, lo: 0x92, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xa9}, + {value: 0x0014, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0xec, offset 0x504 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb6}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xed, offset 0x50b + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa5}, + {value: 0x0010, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xbf}, + // Block 0xee, offset 0x515 + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0014, lo: 0x90, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0x96}, + {value: 0x0034, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0xef, offset 0x51d + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + // Block 0xf0, offset 0x520 + {value: 0x0010, lo: 0xb0, hi: 0xb0}, + // Block 0xf1, offset 0x521 + {value: 0x0010, lo: 0x80, hi: 0x99}, + // Block 0xf2, offset 0x522 + {value: 0x0010, lo: 0x80, hi: 0xae}, + // Block 0xf3, offset 0x523 + {value: 0x0010, lo: 0x80, hi: 0x83}, + // Block 0xf4, offset 0x524 + {value: 0x0010, lo: 0x80, hi: 0xae}, + {value: 0x0014, lo: 0xb0, hi: 0xb8}, + // Block 0xf5, offset 0x526 + {value: 0x0010, lo: 0x80, hi: 0x86}, + // Block 0xf6, offset 0x527 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0xf7, offset 0x529 + {value: 0x0010, lo: 0x90, hi: 0xad}, + {value: 0x0034, lo: 0xb0, hi: 0xb4}, + // Block 0xf8, offset 0x52b + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb6}, + // Block 0xf9, offset 0x52d + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa3, hi: 0xb7}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xfa, offset 0x531 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + // Block 0xfb, offset 0x532 + {value: 0x2013, lo: 0x80, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xbf}, + // Block 0xfc, offset 0x534 + {value: 0x0010, lo: 0x80, hi: 0x8a}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0xfd, offset 0x537 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0014, lo: 0x8f, hi: 0x9f}, + // Block 0xfe, offset 0x539 + {value: 0x0014, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa3, hi: 0xa4}, + {value: 0x0030, lo: 0xb0, hi: 0xb1}, + // Block 0xff, offset 0x53c + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbc}, + // Block 0x100, offset 0x53e + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0034, lo: 0x9e, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa3}, + // Block 0x101, offset 0x543 + {value: 0x0030, lo: 0xa5, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xa9}, + {value: 0x0030, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbf}, + // Block 0x102, offset 0x548 + {value: 0x0034, lo: 0x80, hi: 0x82}, + {value: 0x0024, lo: 0x85, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8b}, + {value: 0x0024, lo: 0xaa, hi: 0xad}, + // Block 0x103, offset 0x54c + {value: 0x0024, lo: 0x82, hi: 0x84}, + // Block 0x104, offset 0x54d + {value: 0x0013, lo: 0x80, hi: 0x99}, + {value: 0x0012, lo: 0x9a, hi: 0xb3}, + {value: 0x0013, lo: 0xb4, hi: 0xbf}, + // Block 0x105, offset 0x550 + {value: 0x0013, lo: 0x80, hi: 0x8d}, + {value: 0x0012, lo: 0x8e, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0xa7}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0x106, offset 0x554 + {value: 0x0013, lo: 0x80, hi: 0x81}, + {value: 0x0012, lo: 0x82, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0x9c}, + {value: 0x0013, lo: 0x9e, hi: 0x9f}, + {value: 0x0013, lo: 0xa2, hi: 0xa2}, + {value: 0x0013, lo: 0xa5, hi: 0xa6}, + {value: 0x0013, lo: 0xa9, hi: 0xac}, + {value: 0x0013, lo: 0xae, hi: 0xb5}, + {value: 0x0012, lo: 0xb6, hi: 0xb9}, + {value: 0x0012, lo: 0xbb, hi: 0xbb}, + {value: 0x0012, lo: 0xbd, hi: 0xbf}, + // Block 0x107, offset 0x55f + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0012, lo: 0x85, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0x108, offset 0x563 + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0013, lo: 0x84, hi: 0x85}, + {value: 0x0013, lo: 0x87, hi: 0x8a}, + {value: 0x0013, lo: 0x8d, hi: 0x94}, + {value: 0x0013, lo: 0x96, hi: 0x9c}, + {value: 0x0012, lo: 0x9e, hi: 0xb7}, + {value: 0x0013, lo: 0xb8, hi: 0xb9}, + {value: 0x0013, lo: 0xbb, hi: 0xbe}, + // Block 0x109, offset 0x56b + {value: 0x0013, lo: 0x80, hi: 0x84}, + {value: 0x0013, lo: 0x86, hi: 0x86}, + {value: 0x0013, lo: 0x8a, hi: 0x90}, + {value: 0x0012, lo: 0x92, hi: 0xab}, + {value: 0x0013, lo: 0xac, hi: 0xbf}, + // Block 0x10a, offset 0x570 + {value: 0x0013, lo: 0x80, hi: 0x85}, + {value: 0x0012, lo: 0x86, hi: 0x9f}, + {value: 0x0013, lo: 0xa0, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbf}, + // Block 0x10b, offset 0x574 + {value: 0x0012, lo: 0x80, hi: 0x93}, + {value: 0x0013, lo: 0x94, hi: 0xad}, + {value: 0x0012, lo: 0xae, hi: 0xbf}, + // Block 0x10c, offset 0x577 + {value: 0x0012, lo: 0x80, hi: 0x87}, + {value: 0x0013, lo: 0x88, hi: 0xa1}, + {value: 0x0012, lo: 0xa2, hi: 0xbb}, + {value: 0x0013, lo: 0xbc, hi: 0xbf}, + // Block 0x10d, offset 0x57b + {value: 0x0013, lo: 0x80, hi: 0x95}, + {value: 0x0012, lo: 0x96, hi: 0xaf}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x10e, offset 0x57e + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0012, lo: 0x8a, hi: 0xa5}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0x10f, offset 0x581 + {value: 0x0013, lo: 0x80, hi: 0x80}, + {value: 0x0012, lo: 0x82, hi: 0x9a}, + {value: 0x0012, lo: 0x9c, hi: 0xa1}, + {value: 0x0013, lo: 0xa2, hi: 0xba}, + {value: 0x0012, lo: 0xbc, hi: 0xbf}, + // Block 0x110, offset 0x586 + {value: 0x0012, lo: 0x80, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0xb4}, + {value: 0x0012, lo: 0xb6, hi: 0xbf}, + // Block 0x111, offset 0x58a + {value: 0x0012, lo: 0x80, hi: 0x8e}, + {value: 0x0012, lo: 0x90, hi: 0x95}, + {value: 0x0013, lo: 0x96, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x112, offset 0x58e + {value: 0x0012, lo: 0x80, hi: 0x88}, + {value: 0x0012, lo: 0x8a, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0x113, offset 0x592 + {value: 0x0012, lo: 0x80, hi: 0x82}, + {value: 0x0012, lo: 0x84, hi: 0x89}, + {value: 0x0017, lo: 0x8a, hi: 0x8b}, + {value: 0x0010, lo: 0x8e, hi: 0xbf}, + // Block 0x114, offset 0x596 + {value: 0x0014, lo: 0x80, hi: 0xb6}, + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x115, offset 0x598 + {value: 0x0014, lo: 0x80, hi: 0xac}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x116, offset 0x59a + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x9b, hi: 0x9f}, + {value: 0x0014, lo: 0xa1, hi: 0xaf}, + // Block 0x117, offset 0x59d + {value: 0x0024, lo: 0x80, hi: 0x86}, + {value: 0x0024, lo: 0x88, hi: 0x98}, + {value: 0x0024, lo: 0x9b, hi: 0xa1}, + {value: 0x0024, lo: 0xa3, hi: 0xa4}, + {value: 0x0024, lo: 0xa6, hi: 0xaa}, + // Block 0x118, offset 0x5a2 + {value: 0x0010, lo: 0x80, hi: 0xac}, + {value: 0x0024, lo: 0xb0, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xbd}, + // Block 0x119, offset 0x5a5 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + // Block 0x11a, offset 0x5a7 + {value: 0x0010, lo: 0x80, hi: 0xab}, + {value: 0x0024, lo: 0xac, hi: 0xaf}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x11b, offset 0x5aa + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0034, lo: 0x90, hi: 0x96}, + // Block 0x11c, offset 0x5ac + {value: 0xbc52, lo: 0x80, hi: 0x81}, + {value: 0xbf52, lo: 0x82, hi: 0x83}, + {value: 0x0024, lo: 0x84, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8b}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x11d, offset 0x5b2 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x9f}, + {value: 0x0010, lo: 0xa1, hi: 0xa2}, + {value: 0x0010, lo: 0xa4, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb7}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + // Block 0x11e, offset 0x5bb + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x9b}, + {value: 0x0010, lo: 0xa1, hi: 0xa3}, + {value: 0x0010, lo: 0xa5, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xbb}, + // Block 0x11f, offset 0x5c0 + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x120, offset 0x5c1 + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x121, offset 0x5c4 + {value: 0x0013, lo: 0x80, hi: 0x89}, + // Block 0x122, offset 0x5c5 + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x123, offset 0x5c6 + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x124, offset 0x5c7 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0014, lo: 0xa0, hi: 0xbf}, + // Block 0x125, offset 0x5c9 + {value: 0x0014, lo: 0x80, hi: 0xbf}, + // Block 0x126, offset 0x5ca + {value: 0x0014, lo: 0x80, hi: 0xaf}, +} + +// Total table size 15212 bytes (14KiB); checksum: 1EB13752 diff --git a/vendor/golang.org/x/text/cases/tables9.0.0.go b/vendor/golang.org/x/text/cases/tables9.0.0.go new file mode 100644 index 0000000..636d5d1 --- /dev/null +++ b/vendor/golang.org/x/text/cases/tables9.0.0.go @@ -0,0 +1,2216 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build !go1.10 +// +build !go1.10 + +package cases + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "9.0.0" + +var xorData string = "" + // Size: 185 bytes + "\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" + + "\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" + + "\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" + + "\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" + + "\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" + + "\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" + + "\x0b!\x10\x00\x0b!0\x00\x0b(\x04\x00\x03\x04\x1e\x00\x03\x0a\x00\x02:" + + "\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<\x00\x01&\x00\x01*" + + "\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x01\x1e\x00\x01\x22" + +var exceptions string = "" + // Size: 2068 bytes + "\x00\x12\x12μΜΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x09II\x13\x1bʼnʼNʼN\x11" + + "\x09sSS\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ\x10\x12LJLj" + + "\x12\x12njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x1bǰJ̌J̌\x12\x12dzdzDz\x12\x12dzdzDZ\x10" + + "\x12DZDz\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x1bⱾⱾ\x10\x1bⱿⱿ\x10\x1bⱯⱯ\x10\x1bⱭⱭ\x10" + + "\x1bⱰⱰ\x10\x1bꞫꞫ\x10\x1bꞬꞬ\x10\x1bꞍꞍ\x10\x1bꞪꞪ\x10\x1bꞮꞮ\x10\x1bⱢⱢ\x10" + + "\x1bꞭꞭ\x10\x1bⱮⱮ\x10\x1bⱤⱤ\x10\x1bꞱꞱ\x10\x1bꞲꞲ\x10\x1bꞰꞰ2\x12ιΙΙ\x166ΐ" + + "Ϊ́Ϊ́\x166ΰΫ́Ϋ́\x12\x12σΣΣ\x12\x12βΒΒ\x12\x12θΘΘ\x12\x12φΦΦ\x12" + + "\x12πΠΠ\x12\x12κΚΚ\x12\x12ρΡΡ\x12\x12εΕΕ\x14$եւԵՒԵւ\x12\x12вВВ\x12\x12дД" + + "Д\x12\x12оОО\x12\x12сСС\x12\x12тТТ\x12\x12тТТ\x12\x12ъЪЪ\x12\x12ѣѢѢ\x13" + + "\x1bꙋꙊꙊ\x13\x1bẖH̱H̱\x13\x1bẗT̈T̈\x13\x1bẘW̊W̊\x13\x1bẙY̊Y̊\x13\x1ba" + + "ʾAʾAʾ\x13\x1bṡṠṠ\x12\x10ssß\x14$ὐΥ̓Υ̓\x166ὒΥ̓̀Υ̓̀\x166ὔΥ̓́Υ̓́\x166" + + "ὖΥ̓͂Υ̓͂\x15+ἀιἈΙᾈ\x15+ἁιἉΙᾉ\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ" + + "\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ\x15\x1dἀιᾀἈΙ\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ" + + "\x15\x1dἄιᾄἌΙ\x15\x1dἅιᾅἍΙ\x15\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ" + + "\x15+ἢιἪΙᾚ\x15+ἣιἫΙᾛ\x15+ἤιἬΙᾜ\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨ" + + "Ι\x15\x1dἡιᾑἩΙ\x15\x1dἢιᾒἪΙ\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15" + + "\x1dἦιᾖἮΙ\x15\x1dἧιᾗἯΙ\x15+ὠιὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ" + + "\x15+ὥιὭΙᾭ\x15+ὦιὮΙᾮ\x15+ὧιὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ" + + "\x15\x1dὣιᾣὫΙ\x15\x1dὤιᾤὬΙ\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰι" + + "ᾺΙᾺͅ\x14#αιΑΙᾼ\x14$άιΆΙΆͅ\x14$ᾶΑ͂Α͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12" + + "\x12ιΙΙ\x15-ὴιῊΙῊͅ\x14#ηιΗΙῌ\x14$ήιΉΙΉͅ\x14$ῆΗ͂Η͂\x166ῆιΗ͂Ιῌ͂\x14\x1c" + + "ηιῃΗΙ\x166ῒΪ̀Ϊ̀\x166ΐΪ́Ϊ́\x14$ῖΙ͂Ι͂\x166ῗΪ͂Ϊ͂\x166ῢΫ̀Ϋ" + + "̀\x166ΰΫ́Ϋ́\x14$ῤΡ̓Ρ̓\x14$ῦΥ͂Υ͂\x166ῧΫ͂Ϋ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙ" + + "ῼ\x14$ώιΏΙΏͅ\x14$ῶΩ͂Ω͂\x166ῶιΩ͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk" + + "\x12\x10åå\x12\x10ɫɫ\x12\x10ɽɽ\x10\x12ȺȺ\x10\x12ȾȾ\x12\x10ɑɑ\x12\x10ɱɱ" + + "\x12\x10ɐɐ\x12\x10ɒɒ\x12\x10ȿȿ\x12\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ" + + "\x12\x10ɡɡ\x12\x10ɬɬ\x12\x10ɪɪ\x12\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x12ffFF" + + "Ff\x12\x12fiFIFi\x12\x12flFLFl\x13\x1bffiFFIFfi\x13\x1bfflFFLFfl\x12\x12" + + "stSTSt\x12\x12stSTSt\x14$մնՄՆՄն\x14$մեՄԵՄե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄ" + + "ԽՄխ" + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// caseTrie. Total size: 11742 bytes (11.47 KiB). Checksum: 795fe57ee5135873. +type caseTrie struct{} + +func newCaseTrie(i int) *caseTrie { + return &caseTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *caseTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 18: + return uint16(caseValues[n<<6+uint32(b)]) + default: + n -= 18 + return uint16(sparse.lookup(n, b)) + } +} + +// caseValues: 20 blocks, 1280 entries, 2560 bytes +// The third block is the zero block. +var caseValues = [1280]uint16{ + // Block 0x0, offset 0x0 + 0x27: 0x0054, + 0x2e: 0x0054, + 0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010, + 0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054, + // Block 0x1, offset 0x40 + 0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013, + 0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013, + 0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013, + 0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013, + 0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013, + 0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012, + 0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012, + 0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012, + 0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012, + 0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112, + 0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713, + 0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313, + 0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653, + 0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x0012, 0xdc: 0x1d53, 0xdd: 0x2c53, + 0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112, + 0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853, + 0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13, + 0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313, + 0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010, + 0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452, + // Block 0x4, offset 0x100 + 0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x02db, 0x105: 0x0359, + 0x106: 0x03da, 0x107: 0x043b, 0x108: 0x04b9, 0x109: 0x053a, 0x10a: 0x059b, 0x10b: 0x0619, + 0x10c: 0x069a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313, + 0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13, + 0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452, + 0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112, + 0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112, + 0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112, + 0x130: 0x06fa, 0x131: 0x07ab, 0x132: 0x0829, 0x133: 0x08aa, 0x134: 0x0113, 0x135: 0x0112, + 0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112, + 0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112, + // Block 0x5, offset 0x140 + 0x140: 0x0a8a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53, + 0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112, + 0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x0b0a, 0x151: 0x0b8a, + 0x152: 0x0c0a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152, + 0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x0c8a, 0x15d: 0x0012, + 0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x0d0a, 0x162: 0x0012, 0x163: 0x2052, + 0x164: 0x0012, 0x165: 0x0d8a, 0x166: 0x0e0a, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652, + 0x16a: 0x0e8a, 0x16b: 0x0f0a, 0x16c: 0x0f8a, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52, + 0x170: 0x0012, 0x171: 0x100a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252, + 0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012, + 0x17c: 0x0012, 0x17d: 0x108a, 0x17e: 0x0012, 0x17f: 0x0012, + // Block 0x6, offset 0x180 + 0x180: 0x3552, 0x181: 0x0012, 0x182: 0x0012, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012, + 0x186: 0x0012, 0x187: 0x110a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52, + 0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012, + 0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0012, 0x196: 0x0012, 0x197: 0x0012, + 0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x118a, + 0x19e: 0x120a, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012, + 0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012, + 0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012, + 0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015, + 0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014, + 0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x128d, + 0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024, + 0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024, + 0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024, + 0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034, + 0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024, + 0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024, + 0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024, + 0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004, + 0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52, + 0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353, + // Block 0x8, offset 0x200 + 0x204: 0x0004, 0x205: 0x0004, + 0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513, + 0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x130a, 0x211: 0x2013, + 0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013, + 0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013, + 0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53, + 0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53, + 0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512, + 0x230: 0x144a, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012, + 0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012, + 0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012, + // Block 0x9, offset 0x240 + 0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x158a, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52, + 0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52, + 0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x160a, 0x251: 0x168a, + 0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x170a, 0x256: 0x178a, 0x257: 0x1812, + 0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112, + 0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112, + 0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112, + 0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112, + 0x270: 0x180a, 0x271: 0x188a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x190a, + 0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112, + 0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053, + // Block 0xa, offset 0x280 + 0x280: 0x0812, 0x281: 0x0812, 0x282: 0x0812, 0x283: 0x0812, 0x284: 0x0812, 0x285: 0x0812, + 0x288: 0x0813, 0x289: 0x0813, 0x28a: 0x0813, 0x28b: 0x0813, + 0x28c: 0x0813, 0x28d: 0x0813, 0x290: 0x239a, 0x291: 0x0812, + 0x292: 0x247a, 0x293: 0x0812, 0x294: 0x25ba, 0x295: 0x0812, 0x296: 0x26fa, 0x297: 0x0812, + 0x299: 0x0813, 0x29b: 0x0813, 0x29d: 0x0813, + 0x29f: 0x0813, 0x2a0: 0x0812, 0x2a1: 0x0812, 0x2a2: 0x0812, 0x2a3: 0x0812, + 0x2a4: 0x0812, 0x2a5: 0x0812, 0x2a6: 0x0812, 0x2a7: 0x0812, 0x2a8: 0x0813, 0x2a9: 0x0813, + 0x2aa: 0x0813, 0x2ab: 0x0813, 0x2ac: 0x0813, 0x2ad: 0x0813, 0x2ae: 0x0813, 0x2af: 0x0813, + 0x2b0: 0x8b52, 0x2b1: 0x8b52, 0x2b2: 0x8e52, 0x2b3: 0x8e52, 0x2b4: 0x9152, 0x2b5: 0x9152, + 0x2b6: 0x9452, 0x2b7: 0x9452, 0x2b8: 0x9752, 0x2b9: 0x9752, 0x2ba: 0x9a52, 0x2bb: 0x9a52, + 0x2bc: 0x4d52, 0x2bd: 0x4d52, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x283a, 0x2c1: 0x292a, 0x2c2: 0x2a1a, 0x2c3: 0x2b0a, 0x2c4: 0x2bfa, 0x2c5: 0x2cea, + 0x2c6: 0x2dda, 0x2c7: 0x2eca, 0x2c8: 0x2fb9, 0x2c9: 0x30a9, 0x2ca: 0x3199, 0x2cb: 0x3289, + 0x2cc: 0x3379, 0x2cd: 0x3469, 0x2ce: 0x3559, 0x2cf: 0x3649, 0x2d0: 0x373a, 0x2d1: 0x382a, + 0x2d2: 0x391a, 0x2d3: 0x3a0a, 0x2d4: 0x3afa, 0x2d5: 0x3bea, 0x2d6: 0x3cda, 0x2d7: 0x3dca, + 0x2d8: 0x3eb9, 0x2d9: 0x3fa9, 0x2da: 0x4099, 0x2db: 0x4189, 0x2dc: 0x4279, 0x2dd: 0x4369, + 0x2de: 0x4459, 0x2df: 0x4549, 0x2e0: 0x463a, 0x2e1: 0x472a, 0x2e2: 0x481a, 0x2e3: 0x490a, + 0x2e4: 0x49fa, 0x2e5: 0x4aea, 0x2e6: 0x4bda, 0x2e7: 0x4cca, 0x2e8: 0x4db9, 0x2e9: 0x4ea9, + 0x2ea: 0x4f99, 0x2eb: 0x5089, 0x2ec: 0x5179, 0x2ed: 0x5269, 0x2ee: 0x5359, 0x2ef: 0x5449, + 0x2f0: 0x0812, 0x2f1: 0x0812, 0x2f2: 0x553a, 0x2f3: 0x564a, 0x2f4: 0x571a, + 0x2f6: 0x57fa, 0x2f7: 0x58da, 0x2f8: 0x0813, 0x2f9: 0x0813, 0x2fa: 0x8b53, 0x2fb: 0x8b53, + 0x2fc: 0x5a19, 0x2fd: 0x0004, 0x2fe: 0x5aea, 0x2ff: 0x0004, + // Block 0xc, offset 0x300 + 0x300: 0x0004, 0x301: 0x0004, 0x302: 0x5b6a, 0x303: 0x5c7a, 0x304: 0x5d4a, + 0x306: 0x5e2a, 0x307: 0x5f0a, 0x308: 0x8e53, 0x309: 0x8e53, 0x30a: 0x9153, 0x30b: 0x9153, + 0x30c: 0x6049, 0x30d: 0x0004, 0x30e: 0x0004, 0x30f: 0x0004, 0x310: 0x0812, 0x311: 0x0812, + 0x312: 0x611a, 0x313: 0x625a, 0x316: 0x639a, 0x317: 0x647a, + 0x318: 0x0813, 0x319: 0x0813, 0x31a: 0x9453, 0x31b: 0x9453, 0x31d: 0x0004, + 0x31e: 0x0004, 0x31f: 0x0004, 0x320: 0x0812, 0x321: 0x0812, 0x322: 0x65ba, 0x323: 0x66fa, + 0x324: 0x683a, 0x325: 0x0912, 0x326: 0x691a, 0x327: 0x69fa, 0x328: 0x0813, 0x329: 0x0813, + 0x32a: 0x9a53, 0x32b: 0x9a53, 0x32c: 0x0913, 0x32d: 0x0004, 0x32e: 0x0004, 0x32f: 0x0004, + 0x332: 0x6b3a, 0x333: 0x6c4a, 0x334: 0x6d1a, + 0x336: 0x6dfa, 0x337: 0x6eda, 0x338: 0x9753, 0x339: 0x9753, 0x33a: 0x4d53, 0x33b: 0x4d53, + 0x33c: 0x7019, 0x33d: 0x0004, 0x33e: 0x0004, + // Block 0xd, offset 0x340 + 0x342: 0x0013, + 0x347: 0x0013, 0x34a: 0x0012, 0x34b: 0x0013, + 0x34c: 0x0013, 0x34d: 0x0013, 0x34e: 0x0012, 0x34f: 0x0012, 0x350: 0x0013, 0x351: 0x0013, + 0x352: 0x0013, 0x353: 0x0012, 0x355: 0x0013, + 0x359: 0x0013, 0x35a: 0x0013, 0x35b: 0x0013, 0x35c: 0x0013, 0x35d: 0x0013, + 0x364: 0x0013, 0x366: 0x70eb, 0x368: 0x0013, + 0x36a: 0x714b, 0x36b: 0x718b, 0x36c: 0x0013, 0x36d: 0x0013, 0x36f: 0x0012, + 0x370: 0x0013, 0x371: 0x0013, 0x372: 0x9d53, 0x373: 0x0013, 0x374: 0x0012, 0x375: 0x0010, + 0x376: 0x0010, 0x377: 0x0010, 0x378: 0x0010, 0x379: 0x0012, + 0x37c: 0x0012, 0x37d: 0x0012, 0x37e: 0x0013, 0x37f: 0x0013, + // Block 0xe, offset 0x380 + 0x380: 0x1a13, 0x381: 0x1a13, 0x382: 0x1e13, 0x383: 0x1e13, 0x384: 0x1a13, 0x385: 0x1a13, + 0x386: 0x2613, 0x387: 0x2613, 0x388: 0x2a13, 0x389: 0x2a13, 0x38a: 0x2e13, 0x38b: 0x2e13, + 0x38c: 0x2a13, 0x38d: 0x2a13, 0x38e: 0x2613, 0x38f: 0x2613, 0x390: 0xa052, 0x391: 0xa052, + 0x392: 0xa352, 0x393: 0xa352, 0x394: 0xa652, 0x395: 0xa652, 0x396: 0xa352, 0x397: 0xa352, + 0x398: 0xa052, 0x399: 0xa052, 0x39a: 0x1a12, 0x39b: 0x1a12, 0x39c: 0x1e12, 0x39d: 0x1e12, + 0x39e: 0x1a12, 0x39f: 0x1a12, 0x3a0: 0x2612, 0x3a1: 0x2612, 0x3a2: 0x2a12, 0x3a3: 0x2a12, + 0x3a4: 0x2e12, 0x3a5: 0x2e12, 0x3a6: 0x2a12, 0x3a7: 0x2a12, 0x3a8: 0x2612, 0x3a9: 0x2612, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x6552, 0x3c1: 0x6552, 0x3c2: 0x6552, 0x3c3: 0x6552, 0x3c4: 0x6552, 0x3c5: 0x6552, + 0x3c6: 0x6552, 0x3c7: 0x6552, 0x3c8: 0x6552, 0x3c9: 0x6552, 0x3ca: 0x6552, 0x3cb: 0x6552, + 0x3cc: 0x6552, 0x3cd: 0x6552, 0x3ce: 0x6552, 0x3cf: 0x6552, 0x3d0: 0xa952, 0x3d1: 0xa952, + 0x3d2: 0xa952, 0x3d3: 0xa952, 0x3d4: 0xa952, 0x3d5: 0xa952, 0x3d6: 0xa952, 0x3d7: 0xa952, + 0x3d8: 0xa952, 0x3d9: 0xa952, 0x3da: 0xa952, 0x3db: 0xa952, 0x3dc: 0xa952, 0x3dd: 0xa952, + 0x3de: 0xa952, 0x3e0: 0x0113, 0x3e1: 0x0112, 0x3e2: 0x71eb, 0x3e3: 0x8853, + 0x3e4: 0x724b, 0x3e5: 0x72aa, 0x3e6: 0x730a, 0x3e7: 0x0f13, 0x3e8: 0x0f12, 0x3e9: 0x0313, + 0x3ea: 0x0312, 0x3eb: 0x0713, 0x3ec: 0x0712, 0x3ed: 0x736b, 0x3ee: 0x73cb, 0x3ef: 0x742b, + 0x3f0: 0x748b, 0x3f1: 0x0012, 0x3f2: 0x0113, 0x3f3: 0x0112, 0x3f4: 0x0012, 0x3f5: 0x0313, + 0x3f6: 0x0312, 0x3f7: 0x0012, 0x3f8: 0x0012, 0x3f9: 0x0012, 0x3fa: 0x0012, 0x3fb: 0x0012, + 0x3fc: 0x0015, 0x3fd: 0x0015, 0x3fe: 0x74eb, 0x3ff: 0x754b, + // Block 0x10, offset 0x400 + 0x400: 0x0113, 0x401: 0x0112, 0x402: 0x0113, 0x403: 0x0112, 0x404: 0x0113, 0x405: 0x0112, + 0x406: 0x0113, 0x407: 0x0112, 0x408: 0x0014, 0x409: 0x0004, 0x40a: 0x0004, 0x40b: 0x0713, + 0x40c: 0x0712, 0x40d: 0x75ab, 0x40e: 0x0012, 0x40f: 0x0010, 0x410: 0x0113, 0x411: 0x0112, + 0x412: 0x0113, 0x413: 0x0112, 0x414: 0x0012, 0x415: 0x0012, 0x416: 0x0113, 0x417: 0x0112, + 0x418: 0x0113, 0x419: 0x0112, 0x41a: 0x0113, 0x41b: 0x0112, 0x41c: 0x0113, 0x41d: 0x0112, + 0x41e: 0x0113, 0x41f: 0x0112, 0x420: 0x0113, 0x421: 0x0112, 0x422: 0x0113, 0x423: 0x0112, + 0x424: 0x0113, 0x425: 0x0112, 0x426: 0x0113, 0x427: 0x0112, 0x428: 0x0113, 0x429: 0x0112, + 0x42a: 0x760b, 0x42b: 0x766b, 0x42c: 0x76cb, 0x42d: 0x772b, 0x42e: 0x778b, + 0x430: 0x77eb, 0x431: 0x784b, 0x432: 0x78ab, 0x433: 0xac53, 0x434: 0x0113, 0x435: 0x0112, + 0x436: 0x0113, 0x437: 0x0112, + // Block 0x11, offset 0x440 + 0x440: 0x790a, 0x441: 0x798a, 0x442: 0x7a0a, 0x443: 0x7a8a, 0x444: 0x7b3a, 0x445: 0x7bea, + 0x446: 0x7c6a, + 0x453: 0x7cea, 0x454: 0x7dca, 0x455: 0x7eaa, 0x456: 0x7f8a, 0x457: 0x806a, + 0x45d: 0x0010, + 0x45e: 0x0034, 0x45f: 0x0010, 0x460: 0x0010, 0x461: 0x0010, 0x462: 0x0010, 0x463: 0x0010, + 0x464: 0x0010, 0x465: 0x0010, 0x466: 0x0010, 0x467: 0x0010, 0x468: 0x0010, + 0x46a: 0x0010, 0x46b: 0x0010, 0x46c: 0x0010, 0x46d: 0x0010, 0x46e: 0x0010, 0x46f: 0x0010, + 0x470: 0x0010, 0x471: 0x0010, 0x472: 0x0010, 0x473: 0x0010, 0x474: 0x0010, 0x475: 0x0010, + 0x476: 0x0010, 0x478: 0x0010, 0x479: 0x0010, 0x47a: 0x0010, 0x47b: 0x0010, + 0x47c: 0x0010, 0x47e: 0x0010, + // Block 0x12, offset 0x480 + 0x480: 0x2213, 0x481: 0x2213, 0x482: 0x2613, 0x483: 0x2613, 0x484: 0x2213, 0x485: 0x2213, + 0x486: 0x2e13, 0x487: 0x2e13, 0x488: 0x2213, 0x489: 0x2213, 0x48a: 0x2613, 0x48b: 0x2613, + 0x48c: 0x2213, 0x48d: 0x2213, 0x48e: 0x3e13, 0x48f: 0x3e13, 0x490: 0x2213, 0x491: 0x2213, + 0x492: 0x2613, 0x493: 0x2613, 0x494: 0x2213, 0x495: 0x2213, 0x496: 0x2e13, 0x497: 0x2e13, + 0x498: 0x2213, 0x499: 0x2213, 0x49a: 0x2613, 0x49b: 0x2613, 0x49c: 0x2213, 0x49d: 0x2213, + 0x49e: 0xb553, 0x49f: 0xb553, 0x4a0: 0xb853, 0x4a1: 0xb853, 0x4a2: 0x2212, 0x4a3: 0x2212, + 0x4a4: 0x2612, 0x4a5: 0x2612, 0x4a6: 0x2212, 0x4a7: 0x2212, 0x4a8: 0x2e12, 0x4a9: 0x2e12, + 0x4aa: 0x2212, 0x4ab: 0x2212, 0x4ac: 0x2612, 0x4ad: 0x2612, 0x4ae: 0x2212, 0x4af: 0x2212, + 0x4b0: 0x3e12, 0x4b1: 0x3e12, 0x4b2: 0x2212, 0x4b3: 0x2212, 0x4b4: 0x2612, 0x4b5: 0x2612, + 0x4b6: 0x2212, 0x4b7: 0x2212, 0x4b8: 0x2e12, 0x4b9: 0x2e12, 0x4ba: 0x2212, 0x4bb: 0x2212, + 0x4bc: 0x2612, 0x4bd: 0x2612, 0x4be: 0x2212, 0x4bf: 0x2212, + // Block 0x13, offset 0x4c0 + 0x4c2: 0x0010, + 0x4c7: 0x0010, 0x4c9: 0x0010, 0x4cb: 0x0010, + 0x4cd: 0x0010, 0x4ce: 0x0010, 0x4cf: 0x0010, 0x4d1: 0x0010, + 0x4d2: 0x0010, 0x4d4: 0x0010, 0x4d7: 0x0010, + 0x4d9: 0x0010, 0x4db: 0x0010, 0x4dd: 0x0010, + 0x4df: 0x0010, 0x4e1: 0x0010, 0x4e2: 0x0010, + 0x4e4: 0x0010, 0x4e7: 0x0010, 0x4e8: 0x0010, 0x4e9: 0x0010, + 0x4ea: 0x0010, 0x4ec: 0x0010, 0x4ed: 0x0010, 0x4ee: 0x0010, 0x4ef: 0x0010, + 0x4f0: 0x0010, 0x4f1: 0x0010, 0x4f2: 0x0010, 0x4f4: 0x0010, 0x4f5: 0x0010, + 0x4f6: 0x0010, 0x4f7: 0x0010, 0x4f9: 0x0010, 0x4fa: 0x0010, 0x4fb: 0x0010, + 0x4fc: 0x0010, 0x4fe: 0x0010, +} + +// caseIndex: 25 blocks, 1600 entries, 3200 bytes +// Block 0 is the zero block. +var caseIndex = [1600]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x12, 0xc3: 0x13, 0xc4: 0x14, 0xc5: 0x15, 0xc6: 0x01, 0xc7: 0x02, + 0xc8: 0x16, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x17, 0xcc: 0x18, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07, + 0xd0: 0x19, 0xd1: 0x1a, 0xd2: 0x1b, 0xd3: 0x1c, 0xd4: 0x1d, 0xd5: 0x1e, 0xd6: 0x1f, 0xd7: 0x20, + 0xd8: 0x21, 0xd9: 0x22, 0xda: 0x23, 0xdb: 0x24, 0xdc: 0x25, 0xdd: 0x26, 0xde: 0x27, 0xdf: 0x28, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09, + 0xf0: 0x14, 0xf3: 0x16, + // Block 0x4, offset 0x100 + 0x120: 0x29, 0x121: 0x2a, 0x122: 0x2b, 0x123: 0x2c, 0x124: 0x2d, 0x125: 0x2e, 0x126: 0x2f, 0x127: 0x30, + 0x128: 0x31, 0x129: 0x32, 0x12a: 0x33, 0x12b: 0x34, 0x12c: 0x35, 0x12d: 0x36, 0x12e: 0x37, 0x12f: 0x38, + 0x130: 0x39, 0x131: 0x3a, 0x132: 0x3b, 0x133: 0x3c, 0x134: 0x3d, 0x135: 0x3e, 0x136: 0x3f, 0x137: 0x40, + 0x138: 0x41, 0x139: 0x42, 0x13a: 0x43, 0x13b: 0x44, 0x13c: 0x45, 0x13d: 0x46, 0x13e: 0x47, 0x13f: 0x48, + // Block 0x5, offset 0x140 + 0x140: 0x49, 0x141: 0x4a, 0x142: 0x4b, 0x143: 0x4c, 0x144: 0x23, 0x145: 0x23, 0x146: 0x23, 0x147: 0x23, + 0x148: 0x23, 0x149: 0x4d, 0x14a: 0x4e, 0x14b: 0x4f, 0x14c: 0x50, 0x14d: 0x51, 0x14e: 0x52, 0x14f: 0x53, + 0x150: 0x54, 0x151: 0x23, 0x152: 0x23, 0x153: 0x23, 0x154: 0x23, 0x155: 0x23, 0x156: 0x23, 0x157: 0x23, + 0x158: 0x23, 0x159: 0x55, 0x15a: 0x56, 0x15b: 0x57, 0x15c: 0x58, 0x15d: 0x59, 0x15e: 0x5a, 0x15f: 0x5b, + 0x160: 0x5c, 0x161: 0x5d, 0x162: 0x5e, 0x163: 0x5f, 0x164: 0x60, 0x165: 0x61, 0x167: 0x62, + 0x168: 0x63, 0x169: 0x64, 0x16a: 0x65, 0x16c: 0x66, 0x16d: 0x67, 0x16e: 0x68, 0x16f: 0x69, + 0x170: 0x6a, 0x171: 0x6b, 0x172: 0x6c, 0x173: 0x6d, 0x174: 0x6e, 0x175: 0x6f, 0x176: 0x70, 0x177: 0x71, + 0x178: 0x72, 0x179: 0x72, 0x17a: 0x73, 0x17b: 0x72, 0x17c: 0x74, 0x17d: 0x08, 0x17e: 0x09, 0x17f: 0x0a, + // Block 0x6, offset 0x180 + 0x180: 0x75, 0x181: 0x76, 0x182: 0x77, 0x183: 0x78, 0x184: 0x0b, 0x185: 0x79, 0x186: 0x7a, + 0x192: 0x7b, 0x193: 0x0c, + 0x1b0: 0x7c, 0x1b1: 0x0d, 0x1b2: 0x72, 0x1b3: 0x7d, 0x1b4: 0x7e, 0x1b5: 0x7f, 0x1b6: 0x80, 0x1b7: 0x81, + 0x1b8: 0x82, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x83, 0x1c2: 0x84, 0x1c3: 0x85, 0x1c4: 0x86, 0x1c5: 0x23, 0x1c6: 0x87, + // Block 0x8, offset 0x200 + 0x200: 0x88, 0x201: 0x23, 0x202: 0x23, 0x203: 0x23, 0x204: 0x23, 0x205: 0x23, 0x206: 0x23, 0x207: 0x23, + 0x208: 0x23, 0x209: 0x23, 0x20a: 0x23, 0x20b: 0x23, 0x20c: 0x23, 0x20d: 0x23, 0x20e: 0x23, 0x20f: 0x23, + 0x210: 0x23, 0x211: 0x23, 0x212: 0x89, 0x213: 0x8a, 0x214: 0x23, 0x215: 0x23, 0x216: 0x23, 0x217: 0x23, + 0x218: 0x8b, 0x219: 0x8c, 0x21a: 0x8d, 0x21b: 0x8e, 0x21c: 0x8f, 0x21d: 0x90, 0x21e: 0x0e, 0x21f: 0x91, + 0x220: 0x92, 0x221: 0x93, 0x222: 0x23, 0x223: 0x94, 0x224: 0x95, 0x225: 0x96, 0x226: 0x97, 0x227: 0x98, + 0x228: 0x99, 0x229: 0x9a, 0x22a: 0x9b, 0x22b: 0x9c, 0x22c: 0x9d, 0x22d: 0x9e, 0x22e: 0x9f, 0x22f: 0xa0, + 0x230: 0x23, 0x231: 0x23, 0x232: 0x23, 0x233: 0x23, 0x234: 0x23, 0x235: 0x23, 0x236: 0x23, 0x237: 0x23, + 0x238: 0x23, 0x239: 0x23, 0x23a: 0x23, 0x23b: 0x23, 0x23c: 0x23, 0x23d: 0x23, 0x23e: 0x23, 0x23f: 0x23, + // Block 0x9, offset 0x240 + 0x240: 0x23, 0x241: 0x23, 0x242: 0x23, 0x243: 0x23, 0x244: 0x23, 0x245: 0x23, 0x246: 0x23, 0x247: 0x23, + 0x248: 0x23, 0x249: 0x23, 0x24a: 0x23, 0x24b: 0x23, 0x24c: 0x23, 0x24d: 0x23, 0x24e: 0x23, 0x24f: 0x23, + 0x250: 0x23, 0x251: 0x23, 0x252: 0x23, 0x253: 0x23, 0x254: 0x23, 0x255: 0x23, 0x256: 0x23, 0x257: 0x23, + 0x258: 0x23, 0x259: 0x23, 0x25a: 0x23, 0x25b: 0x23, 0x25c: 0x23, 0x25d: 0x23, 0x25e: 0x23, 0x25f: 0x23, + 0x260: 0x23, 0x261: 0x23, 0x262: 0x23, 0x263: 0x23, 0x264: 0x23, 0x265: 0x23, 0x266: 0x23, 0x267: 0x23, + 0x268: 0x23, 0x269: 0x23, 0x26a: 0x23, 0x26b: 0x23, 0x26c: 0x23, 0x26d: 0x23, 0x26e: 0x23, 0x26f: 0x23, + 0x270: 0x23, 0x271: 0x23, 0x272: 0x23, 0x273: 0x23, 0x274: 0x23, 0x275: 0x23, 0x276: 0x23, 0x277: 0x23, + 0x278: 0x23, 0x279: 0x23, 0x27a: 0x23, 0x27b: 0x23, 0x27c: 0x23, 0x27d: 0x23, 0x27e: 0x23, 0x27f: 0x23, + // Block 0xa, offset 0x280 + 0x280: 0x23, 0x281: 0x23, 0x282: 0x23, 0x283: 0x23, 0x284: 0x23, 0x285: 0x23, 0x286: 0x23, 0x287: 0x23, + 0x288: 0x23, 0x289: 0x23, 0x28a: 0x23, 0x28b: 0x23, 0x28c: 0x23, 0x28d: 0x23, 0x28e: 0x23, 0x28f: 0x23, + 0x290: 0x23, 0x291: 0x23, 0x292: 0x23, 0x293: 0x23, 0x294: 0x23, 0x295: 0x23, 0x296: 0x23, 0x297: 0x23, + 0x298: 0x23, 0x299: 0x23, 0x29a: 0x23, 0x29b: 0x23, 0x29c: 0x23, 0x29d: 0x23, 0x29e: 0xa1, 0x29f: 0xa2, + // Block 0xb, offset 0x2c0 + 0x2ec: 0x0f, 0x2ed: 0xa3, 0x2ee: 0xa4, 0x2ef: 0xa5, + 0x2f0: 0x23, 0x2f1: 0x23, 0x2f2: 0x23, 0x2f3: 0x23, 0x2f4: 0xa6, 0x2f5: 0xa7, 0x2f6: 0xa8, 0x2f7: 0xa9, + 0x2f8: 0xaa, 0x2f9: 0xab, 0x2fa: 0x23, 0x2fb: 0xac, 0x2fc: 0xad, 0x2fd: 0xae, 0x2fe: 0xaf, 0x2ff: 0xb0, + // Block 0xc, offset 0x300 + 0x300: 0xb1, 0x301: 0xb2, 0x302: 0x23, 0x303: 0xb3, 0x305: 0xb4, 0x307: 0xb5, + 0x30a: 0xb6, 0x30b: 0xb7, 0x30c: 0xb8, 0x30d: 0xb9, 0x30e: 0xba, 0x30f: 0xbb, + 0x310: 0xbc, 0x311: 0xbd, 0x312: 0xbe, 0x313: 0xbf, 0x314: 0xc0, 0x315: 0xc1, + 0x318: 0x23, 0x319: 0x23, 0x31a: 0x23, 0x31b: 0x23, 0x31c: 0xc2, 0x31d: 0xc3, + 0x320: 0xc4, 0x321: 0xc5, 0x322: 0xc6, 0x323: 0xc7, 0x324: 0xc8, 0x326: 0xc9, + 0x328: 0xca, 0x329: 0xcb, 0x32a: 0xcc, 0x32b: 0xcd, 0x32c: 0x5f, 0x32d: 0xce, 0x32e: 0xcf, + 0x330: 0x23, 0x331: 0xd0, 0x332: 0xd1, 0x333: 0xd2, + // Block 0xd, offset 0x340 + 0x340: 0xd3, 0x341: 0xd4, 0x342: 0xd5, 0x343: 0xd6, 0x344: 0xd7, 0x345: 0xd8, 0x346: 0xd9, 0x347: 0xda, + 0x348: 0xdb, 0x34a: 0xdc, 0x34b: 0xdd, 0x34c: 0xde, 0x34d: 0xdf, + 0x350: 0xe0, 0x351: 0xe1, 0x352: 0xe2, 0x353: 0xe3, 0x356: 0xe4, 0x357: 0xe5, + 0x358: 0xe6, 0x359: 0xe7, 0x35a: 0xe8, 0x35b: 0xe9, 0x35c: 0xea, + 0x362: 0xeb, 0x363: 0xec, + 0x36b: 0xed, + 0x370: 0xee, 0x371: 0xef, 0x372: 0xf0, + // Block 0xe, offset 0x380 + 0x380: 0x23, 0x381: 0x23, 0x382: 0x23, 0x383: 0x23, 0x384: 0x23, 0x385: 0x23, 0x386: 0x23, 0x387: 0x23, + 0x388: 0x23, 0x389: 0x23, 0x38a: 0x23, 0x38b: 0x23, 0x38c: 0x23, 0x38d: 0x23, 0x38e: 0xf1, + 0x390: 0x23, 0x391: 0xf2, 0x392: 0x23, 0x393: 0x23, 0x394: 0x23, 0x395: 0xf3, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x23, 0x3c1: 0x23, 0x3c2: 0x23, 0x3c3: 0x23, 0x3c4: 0x23, 0x3c5: 0x23, 0x3c6: 0x23, 0x3c7: 0x23, + 0x3c8: 0x23, 0x3c9: 0x23, 0x3ca: 0x23, 0x3cb: 0x23, 0x3cc: 0x23, 0x3cd: 0x23, 0x3ce: 0x23, 0x3cf: 0x23, + 0x3d0: 0xf2, + // Block 0x10, offset 0x400 + 0x410: 0x23, 0x411: 0x23, 0x412: 0x23, 0x413: 0x23, 0x414: 0x23, 0x415: 0x23, 0x416: 0x23, 0x417: 0x23, + 0x418: 0x23, 0x419: 0xf4, + // Block 0x11, offset 0x440 + 0x460: 0x23, 0x461: 0x23, 0x462: 0x23, 0x463: 0x23, 0x464: 0x23, 0x465: 0x23, 0x466: 0x23, 0x467: 0x23, + 0x468: 0xed, 0x469: 0xf5, 0x46b: 0xf6, 0x46c: 0xf7, 0x46d: 0xf8, 0x46e: 0xf9, + 0x47c: 0x23, 0x47d: 0xfa, 0x47e: 0xfb, 0x47f: 0xfc, + // Block 0x12, offset 0x480 + 0x4b0: 0x23, 0x4b1: 0xfd, 0x4b2: 0xfe, + // Block 0x13, offset 0x4c0 + 0x4c5: 0xff, 0x4c6: 0x100, + 0x4c9: 0x101, + 0x4d0: 0x102, 0x4d1: 0x103, 0x4d2: 0x104, 0x4d3: 0x105, 0x4d4: 0x106, 0x4d5: 0x107, 0x4d6: 0x108, 0x4d7: 0x109, + 0x4d8: 0x10a, 0x4d9: 0x10b, 0x4da: 0x10c, 0x4db: 0x10d, 0x4dc: 0x10e, 0x4dd: 0x10f, 0x4de: 0x110, 0x4df: 0x111, + 0x4e8: 0x112, 0x4e9: 0x113, 0x4ea: 0x114, + // Block 0x14, offset 0x500 + 0x500: 0x115, + 0x520: 0x23, 0x521: 0x23, 0x522: 0x23, 0x523: 0x116, 0x524: 0x10, 0x525: 0x117, + 0x538: 0x118, 0x539: 0x11, 0x53a: 0x119, + // Block 0x15, offset 0x540 + 0x544: 0x11a, 0x545: 0x11b, 0x546: 0x11c, + 0x54f: 0x11d, + // Block 0x16, offset 0x580 + 0x590: 0x0a, 0x591: 0x0b, 0x592: 0x0c, 0x593: 0x0d, 0x594: 0x0e, 0x596: 0x0f, + 0x59b: 0x10, 0x59d: 0x11, 0x59e: 0x12, 0x59f: 0x13, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x11e, 0x5c1: 0x11f, 0x5c4: 0x11f, 0x5c5: 0x11f, 0x5c6: 0x11f, 0x5c7: 0x120, + // Block 0x18, offset 0x600 + 0x620: 0x15, +} + +// sparseOffsets: 272 entries, 544 bytes +var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x3a, 0x3d, 0x41, 0x44, 0x48, 0x52, 0x54, 0x59, 0x69, 0x70, 0x75, 0x83, 0x84, 0x92, 0xa1, 0xab, 0xae, 0xb4, 0xbc, 0xbe, 0xc0, 0xce, 0xd4, 0xe2, 0xed, 0xf8, 0x103, 0x10f, 0x119, 0x124, 0x12f, 0x13b, 0x147, 0x14f, 0x157, 0x161, 0x16c, 0x178, 0x17e, 0x189, 0x18e, 0x196, 0x199, 0x19e, 0x1a2, 0x1a6, 0x1ad, 0x1b6, 0x1be, 0x1bf, 0x1c8, 0x1cf, 0x1d7, 0x1dd, 0x1e3, 0x1e8, 0x1ec, 0x1ef, 0x1f1, 0x1f4, 0x1f9, 0x1fa, 0x1fc, 0x1fe, 0x200, 0x207, 0x20c, 0x210, 0x219, 0x21c, 0x21f, 0x225, 0x226, 0x231, 0x232, 0x233, 0x238, 0x245, 0x24d, 0x255, 0x25e, 0x267, 0x270, 0x275, 0x278, 0x281, 0x28e, 0x290, 0x297, 0x299, 0x2a4, 0x2a5, 0x2b0, 0x2b8, 0x2c0, 0x2c6, 0x2c7, 0x2d5, 0x2da, 0x2dd, 0x2e2, 0x2e6, 0x2ec, 0x2f1, 0x2f4, 0x2f9, 0x2fe, 0x2ff, 0x305, 0x307, 0x308, 0x30a, 0x30c, 0x30f, 0x310, 0x312, 0x315, 0x31b, 0x31f, 0x321, 0x327, 0x32e, 0x332, 0x33b, 0x33c, 0x344, 0x348, 0x34d, 0x355, 0x35b, 0x361, 0x36b, 0x370, 0x379, 0x37f, 0x386, 0x38a, 0x392, 0x394, 0x396, 0x399, 0x39b, 0x39d, 0x39e, 0x39f, 0x3a1, 0x3a3, 0x3a9, 0x3ae, 0x3b0, 0x3b6, 0x3b9, 0x3bb, 0x3c1, 0x3c6, 0x3c8, 0x3c9, 0x3ca, 0x3cb, 0x3cd, 0x3cf, 0x3d1, 0x3d4, 0x3d6, 0x3d9, 0x3e1, 0x3e4, 0x3e8, 0x3f0, 0x3f2, 0x3f3, 0x3f4, 0x3f6, 0x3fc, 0x3fe, 0x3ff, 0x401, 0x403, 0x405, 0x412, 0x413, 0x414, 0x418, 0x41a, 0x41b, 0x41c, 0x41d, 0x41e, 0x422, 0x426, 0x42c, 0x42e, 0x435, 0x438, 0x43c, 0x442, 0x44b, 0x451, 0x457, 0x461, 0x46b, 0x46d, 0x474, 0x47a, 0x480, 0x486, 0x489, 0x48f, 0x492, 0x49a, 0x49b, 0x4a2, 0x4a3, 0x4a6, 0x4a7, 0x4ad, 0x4b0, 0x4b8, 0x4b9, 0x4ba, 0x4bb, 0x4bc, 0x4be, 0x4c0, 0x4c2, 0x4c6, 0x4c7, 0x4c9, 0x4ca, 0x4cb, 0x4cd, 0x4d2, 0x4d7, 0x4db, 0x4dc, 0x4df, 0x4e3, 0x4ee, 0x4f2, 0x4fa, 0x4ff, 0x503, 0x506, 0x50a, 0x50d, 0x510, 0x515, 0x519, 0x51d, 0x521, 0x525, 0x527, 0x529, 0x52c, 0x531, 0x533, 0x538, 0x541, 0x546, 0x547, 0x54a, 0x54b, 0x54c, 0x54e, 0x54f, 0x550} + +// sparseValues: 1360 entries, 5440 bytes +var sparseValues = [1360]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0004, lo: 0xa8, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xaa}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0004, lo: 0xaf, hi: 0xaf}, + {value: 0x0004, lo: 0xb4, hi: 0xb4}, + {value: 0x001a, lo: 0xb5, hi: 0xb5}, + {value: 0x0054, lo: 0xb7, hi: 0xb7}, + {value: 0x0004, lo: 0xb8, hi: 0xb8}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + // Block 0x1, offset 0x9 + {value: 0x2013, lo: 0x80, hi: 0x96}, + {value: 0x2013, lo: 0x98, hi: 0x9e}, + {value: 0x009a, lo: 0x9f, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xb6}, + {value: 0x2012, lo: 0xb8, hi: 0xbe}, + {value: 0x0252, lo: 0xbf, hi: 0xbf}, + // Block 0x2, offset 0xf + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x011b, lo: 0xb0, hi: 0xb0}, + {value: 0x019a, lo: 0xb1, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb7}, + {value: 0x0012, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x0553, lo: 0xbf, hi: 0xbf}, + // Block 0x3, offset 0x18 + {value: 0x0552, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x01da, lo: 0x89, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xb7}, + {value: 0x0253, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x028a, lo: 0xbf, hi: 0xbf}, + // Block 0x4, offset 0x24 + {value: 0x0117, lo: 0x80, hi: 0x9f}, + {value: 0x2f53, lo: 0xa0, hi: 0xa0}, + {value: 0x0012, lo: 0xa1, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xb3}, + {value: 0x0012, lo: 0xb4, hi: 0xb9}, + {value: 0x090b, lo: 0xba, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x2953, lo: 0xbd, hi: 0xbd}, + {value: 0x098b, lo: 0xbe, hi: 0xbe}, + {value: 0x0a0a, lo: 0xbf, hi: 0xbf}, + // Block 0x5, offset 0x2e + {value: 0x0015, lo: 0x80, hi: 0x81}, + {value: 0x0004, lo: 0x82, hi: 0x85}, + {value: 0x0014, lo: 0x86, hi: 0x91}, + {value: 0x0004, lo: 0x92, hi: 0x96}, + {value: 0x0054, lo: 0x97, hi: 0x97}, + {value: 0x0004, lo: 0x98, hi: 0x9f}, + {value: 0x0015, lo: 0xa0, hi: 0xa4}, + {value: 0x0004, lo: 0xa5, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xac}, + {value: 0x0004, lo: 0xad, hi: 0xad}, + {value: 0x0014, lo: 0xae, hi: 0xae}, + {value: 0x0004, lo: 0xaf, hi: 0xbf}, + // Block 0x6, offset 0x3a + {value: 0x0024, lo: 0x80, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbf}, + // Block 0x7, offset 0x3d + {value: 0x6553, lo: 0x80, hi: 0x8f}, + {value: 0x2013, lo: 0x90, hi: 0x9f}, + {value: 0x5f53, lo: 0xa0, hi: 0xaf}, + {value: 0x2012, lo: 0xb0, hi: 0xbf}, + // Block 0x8, offset 0x41 + {value: 0x5f52, lo: 0x80, hi: 0x8f}, + {value: 0x6552, lo: 0x90, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x9, offset 0x44 + {value: 0x0117, lo: 0x80, hi: 0x81}, + {value: 0x0024, lo: 0x83, hi: 0x87}, + {value: 0x0014, lo: 0x88, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xbf}, + // Block 0xa, offset 0x48 + {value: 0x0f13, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x0316, lo: 0x89, hi: 0x8a}, + {value: 0x0716, lo: 0x8b, hi: 0x8c}, + {value: 0x0316, lo: 0x8d, hi: 0x8e}, + {value: 0x0f12, lo: 0x8f, hi: 0x8f}, + {value: 0x0117, lo: 0x90, hi: 0xbf}, + // Block 0xb, offset 0x52 + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x6553, lo: 0xb1, hi: 0xbf}, + // Block 0xc, offset 0x54 + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6853, lo: 0x90, hi: 0x96}, + {value: 0x0014, lo: 0x99, hi: 0x99}, + {value: 0x6552, lo: 0xa1, hi: 0xaf}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0xd, offset 0x59 + {value: 0x6852, lo: 0x80, hi: 0x86}, + {value: 0x198a, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x91, hi: 0x91}, + {value: 0x0024, lo: 0x92, hi: 0x95}, + {value: 0x0034, lo: 0x96, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x99}, + {value: 0x0034, lo: 0x9a, hi: 0x9b}, + {value: 0x0024, lo: 0x9c, hi: 0xa1}, + {value: 0x0034, lo: 0xa2, hi: 0xa7}, + {value: 0x0024, lo: 0xa8, hi: 0xa9}, + {value: 0x0034, lo: 0xaa, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xaf}, + {value: 0x0034, lo: 0xb0, hi: 0xbd}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xe, offset 0x69 + {value: 0x0034, lo: 0x81, hi: 0x82}, + {value: 0x0024, lo: 0x84, hi: 0x84}, + {value: 0x0034, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xb3}, + {value: 0x0054, lo: 0xb4, hi: 0xb4}, + // Block 0xf, offset 0x70 + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0024, lo: 0x90, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0014, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x10, offset 0x75 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9c}, + {value: 0x0024, lo: 0x9d, hi: 0x9e}, + {value: 0x0034, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0034, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x11, offset 0x83 + {value: 0x0010, lo: 0x80, hi: 0xbf}, + // Block 0x12, offset 0x84 + {value: 0x0010, lo: 0x80, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0024, lo: 0x9f, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xaa, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x13, offset 0x92 + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0034, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0034, lo: 0xb1, hi: 0xb1}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbd}, + {value: 0x0034, lo: 0xbe, hi: 0xbe}, + {value: 0x0024, lo: 0xbf, hi: 0xbf}, + // Block 0x14, offset 0xa1 + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0024, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x88}, + {value: 0x0024, lo: 0x89, hi: 0x8a}, + {value: 0x0010, lo: 0x8d, hi: 0xbf}, + // Block 0x15, offset 0xab + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x16, offset 0xae + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xb1}, + {value: 0x0034, lo: 0xb2, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + // Block 0x17, offset 0xb4 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x99}, + {value: 0x0014, lo: 0x9a, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0xa3}, + {value: 0x0014, lo: 0xa4, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xad}, + // Block 0x18, offset 0xbc + {value: 0x0010, lo: 0x80, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x9b}, + // Block 0x19, offset 0xbe + {value: 0x0010, lo: 0xa0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbd}, + // Block 0x1a, offset 0xc0 + {value: 0x0024, lo: 0x94, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0024, lo: 0xaa, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbf}, + // Block 0x1b, offset 0xce + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1c, offset 0xd4 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0x1d, offset 0xe2 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb6, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1e, offset 0xed + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xb1}, + // Block 0x1f, offset 0xf8 + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x20, offset 0x103 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x99, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x21, offset 0x10f + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x22, offset 0x119 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x85}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + // Block 0x23, offset 0x124 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x24, offset 0x12f + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x25, offset 0x13b + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0010, lo: 0xa8, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x26, offset 0x147 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x27, offset 0x14f + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb9}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbf}, + // Block 0x28, offset 0x157 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x88}, + {value: 0x0014, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x29, offset 0x161 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x2a, offset 0x16c + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb2}, + // Block 0x2b, offset 0x178 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xba}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x2c, offset 0x17e + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x94, hi: 0x97}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xba, hi: 0xbf}, + // Block 0x2d, offset 0x189 + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x96}, + {value: 0x0010, lo: 0x9a, hi: 0xb1}, + {value: 0x0010, lo: 0xb3, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x2e, offset 0x18e + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x94}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9f}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + // Block 0x2f, offset 0x196 + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xba}, + // Block 0x30, offset 0x199 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x31, offset 0x19e + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xb9}, + {value: 0x0014, lo: 0xbb, hi: 0xbc}, + // Block 0x32, offset 0x1a2 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x33, offset 0x1a6 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0034, lo: 0x98, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0034, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x34, offset 0x1ad + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xac}, + {value: 0x0034, lo: 0xb1, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xba, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x35, offset 0x1b6 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0024, lo: 0x82, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x86, hi: 0x87}, + {value: 0x0010, lo: 0x88, hi: 0x8c}, + {value: 0x0014, lo: 0x8d, hi: 0x97}, + {value: 0x0014, lo: 0x99, hi: 0xbc}, + // Block 0x36, offset 0x1be + {value: 0x0034, lo: 0x86, hi: 0x86}, + // Block 0x37, offset 0x1bf + {value: 0x0010, lo: 0xab, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbe}, + // Block 0x38, offset 0x1c8 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x96, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x99}, + {value: 0x0014, lo: 0x9e, hi: 0xa0}, + {value: 0x0010, lo: 0xa2, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xad}, + {value: 0x0014, lo: 0xb1, hi: 0xb4}, + // Block 0x39, offset 0x1cf + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x6c53, lo: 0xa0, hi: 0xbf}, + // Block 0x3a, offset 0x1d7 + {value: 0x7053, lo: 0x80, hi: 0x85}, + {value: 0x7053, lo: 0x87, hi: 0x87}, + {value: 0x7053, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xba}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x3b, offset 0x1dd + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x9a, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x3c, offset 0x1e3 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x3d, offset 0x1e8 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x82, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3e, offset 0x1ec + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3f, offset 0x1ef + {value: 0x0010, lo: 0x80, hi: 0x9a}, + {value: 0x0024, lo: 0x9d, hi: 0x9f}, + // Block 0x40, offset 0x1f1 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x7453, lo: 0xa0, hi: 0xaf}, + {value: 0x7853, lo: 0xb0, hi: 0xbf}, + // Block 0x41, offset 0x1f4 + {value: 0x7c53, lo: 0x80, hi: 0x8f}, + {value: 0x8053, lo: 0x90, hi: 0x9f}, + {value: 0x7c53, lo: 0xa0, hi: 0xaf}, + {value: 0x0813, lo: 0xb0, hi: 0xb5}, + {value: 0x0892, lo: 0xb8, hi: 0xbd}, + // Block 0x42, offset 0x1f9 + {value: 0x0010, lo: 0x81, hi: 0xbf}, + // Block 0x43, offset 0x1fa + {value: 0x0010, lo: 0x80, hi: 0xac}, + {value: 0x0010, lo: 0xaf, hi: 0xbf}, + // Block 0x44, offset 0x1fc + {value: 0x0010, lo: 0x81, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x45, offset 0x1fe + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb8}, + // Block 0x46, offset 0x200 + {value: 0x0010, lo: 0x80, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0034, lo: 0x94, hi: 0x94}, + {value: 0x0010, lo: 0xa0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + // Block 0x47, offset 0x207 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xac}, + {value: 0x0010, lo: 0xae, hi: 0xb0}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + // Block 0x48, offset 0x20c + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x49, offset 0x210 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x89, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0014, lo: 0x93, hi: 0x93}, + {value: 0x0004, lo: 0x97, hi: 0x97}, + {value: 0x0024, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0x4a, offset 0x219 + {value: 0x0014, lo: 0x8b, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x4b, offset 0x21c + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb7}, + // Block 0x4c, offset 0x21f + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x4d, offset 0x225 + {value: 0x0010, lo: 0x80, hi: 0xb5}, + // Block 0x4e, offset 0x226 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbb}, + // Block 0x4f, offset 0x231 + {value: 0x0010, lo: 0x86, hi: 0x8f}, + // Block 0x50, offset 0x232 + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x51, offset 0x233 + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + // Block 0x52, offset 0x238 + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x9e}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xac}, + {value: 0x0010, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xbc}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x53, offset 0x245 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xa7, hi: 0xa7}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + {value: 0x0034, lo: 0xb5, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbc}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0x54, offset 0x24d + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x55, offset 0x255 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0030, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8b}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xab, hi: 0xab}, + {value: 0x0034, lo: 0xac, hi: 0xac}, + {value: 0x0024, lo: 0xad, hi: 0xb3}, + // Block 0x56, offset 0x25e + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0030, lo: 0xaa, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbf}, + // Block 0x57, offset 0x267 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0030, lo: 0xb2, hi: 0xb3}, + // Block 0x58, offset 0x270 + {value: 0x0010, lo: 0x80, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0x59, offset 0x275 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8d, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x5a, offset 0x278 + {value: 0x1a6a, lo: 0x80, hi: 0x80}, + {value: 0x1aea, lo: 0x81, hi: 0x81}, + {value: 0x1b6a, lo: 0x82, hi: 0x82}, + {value: 0x1bea, lo: 0x83, hi: 0x83}, + {value: 0x1c6a, lo: 0x84, hi: 0x84}, + {value: 0x1cea, lo: 0x85, hi: 0x85}, + {value: 0x1d6a, lo: 0x86, hi: 0x86}, + {value: 0x1dea, lo: 0x87, hi: 0x87}, + {value: 0x1e6a, lo: 0x88, hi: 0x88}, + // Block 0x5b, offset 0x281 + {value: 0x0024, lo: 0x90, hi: 0x92}, + {value: 0x0034, lo: 0x94, hi: 0x99}, + {value: 0x0024, lo: 0x9a, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9f}, + {value: 0x0024, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0034, lo: 0xa2, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xb3}, + {value: 0x0024, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + {value: 0x0024, lo: 0xb8, hi: 0xb9}, + // Block 0x5c, offset 0x28e + {value: 0x0012, lo: 0x80, hi: 0xab}, + {value: 0x0015, lo: 0xac, hi: 0xbf}, + // Block 0x5d, offset 0x290 + {value: 0x0015, lo: 0x80, hi: 0xaa}, + {value: 0x0012, lo: 0xab, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb8}, + {value: 0x8452, lo: 0xb9, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbc}, + {value: 0x8852, lo: 0xbd, hi: 0xbd}, + {value: 0x0012, lo: 0xbe, hi: 0xbf}, + // Block 0x5e, offset 0x297 + {value: 0x0012, lo: 0x80, hi: 0x9a}, + {value: 0x0015, lo: 0x9b, hi: 0xbf}, + // Block 0x5f, offset 0x299 + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0024, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0xb5}, + {value: 0x0024, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbd}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x60, offset 0x2a4 + {value: 0x0117, lo: 0x80, hi: 0xbf}, + // Block 0x61, offset 0x2a5 + {value: 0x0117, lo: 0x80, hi: 0x95}, + {value: 0x1f1a, lo: 0x96, hi: 0x96}, + {value: 0x1fca, lo: 0x97, hi: 0x97}, + {value: 0x207a, lo: 0x98, hi: 0x98}, + {value: 0x212a, lo: 0x99, hi: 0x99}, + {value: 0x21da, lo: 0x9a, hi: 0x9a}, + {value: 0x228a, lo: 0x9b, hi: 0x9b}, + {value: 0x0012, lo: 0x9c, hi: 0x9d}, + {value: 0x233b, lo: 0x9e, hi: 0x9e}, + {value: 0x0012, lo: 0x9f, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x62, offset 0x2b0 + {value: 0x0812, lo: 0x80, hi: 0x87}, + {value: 0x0813, lo: 0x88, hi: 0x8f}, + {value: 0x0812, lo: 0x90, hi: 0x95}, + {value: 0x0813, lo: 0x98, hi: 0x9d}, + {value: 0x0812, lo: 0xa0, hi: 0xa7}, + {value: 0x0813, lo: 0xa8, hi: 0xaf}, + {value: 0x0812, lo: 0xb0, hi: 0xb7}, + {value: 0x0813, lo: 0xb8, hi: 0xbf}, + // Block 0x63, offset 0x2b8 + {value: 0x0004, lo: 0x8b, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8f}, + {value: 0x0054, lo: 0x98, hi: 0x99}, + {value: 0x0054, lo: 0xa4, hi: 0xa4}, + {value: 0x0054, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xaa, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xaf}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x64, offset 0x2c0 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x94, hi: 0x94}, + {value: 0x0014, lo: 0xa0, hi: 0xa4}, + {value: 0x0014, lo: 0xa6, hi: 0xaf}, + {value: 0x0015, lo: 0xb1, hi: 0xb1}, + {value: 0x0015, lo: 0xbf, hi: 0xbf}, + // Block 0x65, offset 0x2c6 + {value: 0x0015, lo: 0x90, hi: 0x9c}, + // Block 0x66, offset 0x2c7 + {value: 0x0024, lo: 0x90, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x93}, + {value: 0x0024, lo: 0x94, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0xa0}, + {value: 0x0024, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa4}, + {value: 0x0034, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa7}, + {value: 0x0034, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xa9}, + {value: 0x0034, lo: 0xaa, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + // Block 0x67, offset 0x2d5 + {value: 0x0016, lo: 0x85, hi: 0x86}, + {value: 0x0012, lo: 0x87, hi: 0x89}, + {value: 0x9d52, lo: 0x8e, hi: 0x8e}, + {value: 0x1013, lo: 0xa0, hi: 0xaf}, + {value: 0x1012, lo: 0xb0, hi: 0xbf}, + // Block 0x68, offset 0x2da + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x88}, + // Block 0x69, offset 0x2dd + {value: 0xa053, lo: 0xb6, hi: 0xb7}, + {value: 0xa353, lo: 0xb8, hi: 0xb9}, + {value: 0xa653, lo: 0xba, hi: 0xbb}, + {value: 0xa353, lo: 0xbc, hi: 0xbd}, + {value: 0xa053, lo: 0xbe, hi: 0xbf}, + // Block 0x6a, offset 0x2e2 + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6553, lo: 0x90, hi: 0x9f}, + {value: 0xa953, lo: 0xa0, hi: 0xae}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0x6b, offset 0x2e6 + {value: 0x0117, lo: 0x80, hi: 0xa3}, + {value: 0x0012, lo: 0xa4, hi: 0xa4}, + {value: 0x0716, lo: 0xab, hi: 0xac}, + {value: 0x0316, lo: 0xad, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb3}, + // Block 0x6c, offset 0x2ec + {value: 0x6c52, lo: 0x80, hi: 0x9f}, + {value: 0x7052, lo: 0xa0, hi: 0xa5}, + {value: 0x7052, lo: 0xa7, hi: 0xa7}, + {value: 0x7052, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x6d, offset 0x2f1 + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x6e, offset 0x2f4 + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0010, lo: 0xb0, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x6f, offset 0x2f9 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9e}, + {value: 0x0024, lo: 0xa0, hi: 0xbf}, + // Block 0x70, offset 0x2fe + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + // Block 0x71, offset 0x2ff + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0xaa, hi: 0xad}, + {value: 0x0030, lo: 0xae, hi: 0xaf}, + {value: 0x0004, lo: 0xb1, hi: 0xb5}, + {value: 0x0014, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + // Block 0x72, offset 0x305 + {value: 0x0034, lo: 0x99, hi: 0x9a}, + {value: 0x0004, lo: 0x9b, hi: 0x9e}, + // Block 0x73, offset 0x307 + {value: 0x0004, lo: 0xbc, hi: 0xbe}, + // Block 0x74, offset 0x308 + {value: 0x0010, lo: 0x85, hi: 0xad}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x75, offset 0x30a + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0010, lo: 0xa0, hi: 0xba}, + // Block 0x76, offset 0x30c + {value: 0x0010, lo: 0x80, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0xbf}, + // Block 0x77, offset 0x30f + {value: 0x0010, lo: 0x80, hi: 0x8c}, + // Block 0x78, offset 0x310 + {value: 0x0010, lo: 0x90, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x79, offset 0x312 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0xab}, + // Block 0x7a, offset 0x315 + {value: 0x0117, lo: 0x80, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb2}, + {value: 0x0024, lo: 0xb4, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x7b, offset 0x31b + {value: 0x0117, lo: 0x80, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9d}, + {value: 0x0024, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x7c, offset 0x31f + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb1}, + // Block 0x7d, offset 0x321 + {value: 0x0004, lo: 0x80, hi: 0x96}, + {value: 0x0014, lo: 0x97, hi: 0x9f}, + {value: 0x0004, lo: 0xa0, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xaf}, + {value: 0x0012, lo: 0xb0, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xbf}, + // Block 0x7e, offset 0x327 + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x0015, lo: 0xb0, hi: 0xb0}, + {value: 0x0012, lo: 0xb1, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x8453, lo: 0xbd, hi: 0xbd}, + {value: 0x0117, lo: 0xbe, hi: 0xbf}, + // Block 0x7f, offset 0x32e + {value: 0x0010, lo: 0xb7, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbf}, + // Block 0x80, offset 0x332 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8b}, + {value: 0x0010, lo: 0x8c, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + // Block 0x81, offset 0x33b + {value: 0x0010, lo: 0x80, hi: 0xb3}, + // Block 0x82, offset 0x33c + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xa0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb7}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x83, offset 0x344 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x84, offset 0x348 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0x92}, + {value: 0x0030, lo: 0x93, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0x85, offset 0x34d + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb9}, + {value: 0x0010, lo: 0xba, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x86, offset 0x355 + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0004, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x87, offset 0x35b + {value: 0x0010, lo: 0x80, hi: 0xa8}, + {value: 0x0014, lo: 0xa9, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0x88, offset 0x361 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x89, offset 0x36b + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0024, lo: 0xbe, hi: 0xbf}, + // Block 0x8a, offset 0x370 + {value: 0x0024, lo: 0x81, hi: 0x81}, + {value: 0x0004, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + // Block 0x8b, offset 0x379 + {value: 0x0010, lo: 0x81, hi: 0x86}, + {value: 0x0010, lo: 0x89, hi: 0x8e}, + {value: 0x0010, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x8c, offset 0x37f + {value: 0x0012, lo: 0x80, hi: 0x92}, + {value: 0xac52, lo: 0x93, hi: 0x93}, + {value: 0x0012, lo: 0x94, hi: 0x9a}, + {value: 0x0004, lo: 0x9b, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9f}, + {value: 0x0012, lo: 0xa0, hi: 0xa5}, + {value: 0x74d2, lo: 0xb0, hi: 0xbf}, + // Block 0x8d, offset 0x386 + {value: 0x78d2, lo: 0x80, hi: 0x8f}, + {value: 0x7cd2, lo: 0x90, hi: 0x9f}, + {value: 0x80d2, lo: 0xa0, hi: 0xaf}, + {value: 0x7cd2, lo: 0xb0, hi: 0xbf}, + // Block 0x8e, offset 0x38a + {value: 0x0010, lo: 0x80, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x8f, offset 0x392 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x90, offset 0x394 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x8b, hi: 0xbb}, + // Block 0x91, offset 0x396 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0xbf}, + // Block 0x92, offset 0x399 + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0004, lo: 0xb2, hi: 0xbf}, + // Block 0x93, offset 0x39b + {value: 0x0004, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x93, hi: 0xbf}, + // Block 0x94, offset 0x39d + {value: 0x0010, lo: 0x80, hi: 0xbd}, + // Block 0x95, offset 0x39e + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0x96, offset 0x39f + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0xbf}, + // Block 0x97, offset 0x3a1 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0xb0, hi: 0xbb}, + // Block 0x98, offset 0x3a3 + {value: 0x0014, lo: 0x80, hi: 0x8f}, + {value: 0x0054, lo: 0x93, hi: 0x93}, + {value: 0x0024, lo: 0xa0, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xad}, + {value: 0x0024, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + // Block 0x99, offset 0x3a9 + {value: 0x0010, lo: 0x8d, hi: 0x8f}, + {value: 0x0054, lo: 0x92, hi: 0x92}, + {value: 0x0054, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0xb0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0x9a, offset 0x3ae + {value: 0x0010, lo: 0x80, hi: 0xbc}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x9b, offset 0x3b0 + {value: 0x0054, lo: 0x87, hi: 0x87}, + {value: 0x0054, lo: 0x8e, hi: 0x8e}, + {value: 0x0054, lo: 0x9a, hi: 0x9a}, + {value: 0x5f53, lo: 0xa1, hi: 0xba}, + {value: 0x0004, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9c, offset 0x3b6 + {value: 0x0004, lo: 0x80, hi: 0x80}, + {value: 0x5f52, lo: 0x81, hi: 0x9a}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + // Block 0x9d, offset 0x3b9 + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbe}, + // Block 0x9e, offset 0x3bb + {value: 0x0010, lo: 0x82, hi: 0x87}, + {value: 0x0010, lo: 0x8a, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0x97}, + {value: 0x0010, lo: 0x9a, hi: 0x9c}, + {value: 0x0004, lo: 0xa3, hi: 0xa3}, + {value: 0x0014, lo: 0xb9, hi: 0xbb}, + // Block 0x9f, offset 0x3c1 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0010, lo: 0x8d, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xba}, + {value: 0x0010, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xa0, offset 0x3c6 + {value: 0x0010, lo: 0x80, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x9d}, + // Block 0xa1, offset 0x3c8 + {value: 0x0010, lo: 0x80, hi: 0xba}, + // Block 0xa2, offset 0x3c9 + {value: 0x0010, lo: 0x80, hi: 0xb4}, + // Block 0xa3, offset 0x3ca + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0xa4, offset 0x3cb + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa5, offset 0x3cd + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + // Block 0xa6, offset 0x3cf + {value: 0x0010, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xa7, offset 0x3d1 + {value: 0x0010, lo: 0x80, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0xb5}, + {value: 0x0024, lo: 0xb6, hi: 0xba}, + // Block 0xa8, offset 0x3d4 + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa9, offset 0x3d6 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x91, hi: 0x95}, + // Block 0xaa, offset 0x3d9 + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x97}, + {value: 0xaf53, lo: 0x98, hi: 0x9f}, + {value: 0xb253, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbf}, + // Block 0xab, offset 0x3e1 + {value: 0xaf52, lo: 0x80, hi: 0x87}, + {value: 0xb252, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0xac, offset 0x3e4 + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0xb253, lo: 0xb0, hi: 0xb7}, + {value: 0xaf53, lo: 0xb8, hi: 0xbf}, + // Block 0xad, offset 0x3e8 + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x93}, + {value: 0xb252, lo: 0x98, hi: 0x9f}, + {value: 0xaf52, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbb}, + // Block 0xae, offset 0x3f0 + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xaf, offset 0x3f2 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + // Block 0xb0, offset 0x3f3 + {value: 0x0010, lo: 0x80, hi: 0xb6}, + // Block 0xb1, offset 0x3f4 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xa7}, + // Block 0xb2, offset 0x3f6 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xb5}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xb3, offset 0x3fc + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb6}, + // Block 0xb4, offset 0x3fe + {value: 0x0010, lo: 0x80, hi: 0x9e}, + // Block 0xb5, offset 0x3ff + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + // Block 0xb6, offset 0x401 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb9}, + // Block 0xb7, offset 0x403 + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0xb8, offset 0x405 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x8e, hi: 0x8e}, + {value: 0x0024, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x99, hi: 0xb3}, + {value: 0x0024, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xb9, offset 0x412 + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0xba, offset 0x413 + {value: 0x0010, lo: 0x80, hi: 0x9c}, + // Block 0xbb, offset 0x414 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + // Block 0xbc, offset 0x418 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + // Block 0xbd, offset 0x41a + {value: 0x0010, lo: 0x80, hi: 0x91}, + // Block 0xbe, offset 0x41b + {value: 0x0010, lo: 0x80, hi: 0x88}, + // Block 0xbf, offset 0x41c + {value: 0x5653, lo: 0x80, hi: 0xb2}, + // Block 0xc0, offset 0x41d + {value: 0x5652, lo: 0x80, hi: 0xb2}, + // Block 0xc1, offset 0x41e + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xc2, offset 0x422 + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xc3, offset 0x426 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb6}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + // Block 0xc4, offset 0x42c + {value: 0x0010, lo: 0x90, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xc5, offset 0x42e + {value: 0x0024, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0xc6, offset 0x435 + {value: 0x0010, lo: 0x90, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + // Block 0xc7, offset 0x438 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xc8, offset 0x43c + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + // Block 0xc9, offset 0x442 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb4}, + {value: 0x0030, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xb7}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0xca, offset 0x44b + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xcb, offset 0x451 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa2}, + {value: 0x0014, lo: 0xa3, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xcc, offset 0x457 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xcd, offset 0x461 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0030, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9d, hi: 0xa3}, + {value: 0x0024, lo: 0xa6, hi: 0xac}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + // Block 0xce, offset 0x46b + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xcf, offset 0x46d + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd0, offset 0x474 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xd1, offset 0x47a + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd2, offset 0x480 + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd3, offset 0x486 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x98, hi: 0x9b}, + {value: 0x0014, lo: 0x9c, hi: 0x9d}, + // Block 0xd4, offset 0x489 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd5, offset 0x48f + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd6, offset 0x492 + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0014, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb5}, + {value: 0x0030, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0xd7, offset 0x49a + {value: 0x0010, lo: 0x80, hi: 0x89}, + // Block 0xd8, offset 0x49b + {value: 0x0014, lo: 0x9d, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xd9, offset 0x4a2 + {value: 0x5f53, lo: 0xa0, hi: 0xbf}, + // Block 0xda, offset 0x4a3 + {value: 0x5f52, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xdb, offset 0x4a6 + {value: 0x0010, lo: 0x80, hi: 0xb8}, + // Block 0xdc, offset 0x4a7 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb6}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xdd, offset 0x4ad + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0xde, offset 0x4b0 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0014, lo: 0x92, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xa9}, + {value: 0x0014, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0xdf, offset 0x4b8 + {value: 0x0010, lo: 0x80, hi: 0x99}, + // Block 0xe0, offset 0x4b9 + {value: 0x0010, lo: 0x80, hi: 0xae}, + // Block 0xe1, offset 0x4ba + {value: 0x0010, lo: 0x80, hi: 0x83}, + // Block 0xe2, offset 0x4bb + {value: 0x0010, lo: 0x80, hi: 0x86}, + // Block 0xe3, offset 0x4bc + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0xe4, offset 0x4be + {value: 0x0010, lo: 0x90, hi: 0xad}, + {value: 0x0034, lo: 0xb0, hi: 0xb4}, + // Block 0xe5, offset 0x4c0 + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb6}, + // Block 0xe6, offset 0x4c2 + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa3, hi: 0xb7}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xe7, offset 0x4c6 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + // Block 0xe8, offset 0x4c7 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0xbe}, + // Block 0xe9, offset 0x4c9 + {value: 0x0014, lo: 0x8f, hi: 0x9f}, + // Block 0xea, offset 0x4ca + {value: 0x0014, lo: 0xa0, hi: 0xa0}, + // Block 0xeb, offset 0x4cb + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbc}, + // Block 0xec, offset 0x4cd + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0034, lo: 0x9e, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa3}, + // Block 0xed, offset 0x4d2 + {value: 0x0030, lo: 0xa5, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xa9}, + {value: 0x0030, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbf}, + // Block 0xee, offset 0x4d7 + {value: 0x0034, lo: 0x80, hi: 0x82}, + {value: 0x0024, lo: 0x85, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8b}, + {value: 0x0024, lo: 0xaa, hi: 0xad}, + // Block 0xef, offset 0x4db + {value: 0x0024, lo: 0x82, hi: 0x84}, + // Block 0xf0, offset 0x4dc + {value: 0x0013, lo: 0x80, hi: 0x99}, + {value: 0x0012, lo: 0x9a, hi: 0xb3}, + {value: 0x0013, lo: 0xb4, hi: 0xbf}, + // Block 0xf1, offset 0x4df + {value: 0x0013, lo: 0x80, hi: 0x8d}, + {value: 0x0012, lo: 0x8e, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0xa7}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0xf2, offset 0x4e3 + {value: 0x0013, lo: 0x80, hi: 0x81}, + {value: 0x0012, lo: 0x82, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0x9c}, + {value: 0x0013, lo: 0x9e, hi: 0x9f}, + {value: 0x0013, lo: 0xa2, hi: 0xa2}, + {value: 0x0013, lo: 0xa5, hi: 0xa6}, + {value: 0x0013, lo: 0xa9, hi: 0xac}, + {value: 0x0013, lo: 0xae, hi: 0xb5}, + {value: 0x0012, lo: 0xb6, hi: 0xb9}, + {value: 0x0012, lo: 0xbb, hi: 0xbb}, + {value: 0x0012, lo: 0xbd, hi: 0xbf}, + // Block 0xf3, offset 0x4ee + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0012, lo: 0x85, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0xf4, offset 0x4f2 + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0013, lo: 0x84, hi: 0x85}, + {value: 0x0013, lo: 0x87, hi: 0x8a}, + {value: 0x0013, lo: 0x8d, hi: 0x94}, + {value: 0x0013, lo: 0x96, hi: 0x9c}, + {value: 0x0012, lo: 0x9e, hi: 0xb7}, + {value: 0x0013, lo: 0xb8, hi: 0xb9}, + {value: 0x0013, lo: 0xbb, hi: 0xbe}, + // Block 0xf5, offset 0x4fa + {value: 0x0013, lo: 0x80, hi: 0x84}, + {value: 0x0013, lo: 0x86, hi: 0x86}, + {value: 0x0013, lo: 0x8a, hi: 0x90}, + {value: 0x0012, lo: 0x92, hi: 0xab}, + {value: 0x0013, lo: 0xac, hi: 0xbf}, + // Block 0xf6, offset 0x4ff + {value: 0x0013, lo: 0x80, hi: 0x85}, + {value: 0x0012, lo: 0x86, hi: 0x9f}, + {value: 0x0013, lo: 0xa0, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbf}, + // Block 0xf7, offset 0x503 + {value: 0x0012, lo: 0x80, hi: 0x93}, + {value: 0x0013, lo: 0x94, hi: 0xad}, + {value: 0x0012, lo: 0xae, hi: 0xbf}, + // Block 0xf8, offset 0x506 + {value: 0x0012, lo: 0x80, hi: 0x87}, + {value: 0x0013, lo: 0x88, hi: 0xa1}, + {value: 0x0012, lo: 0xa2, hi: 0xbb}, + {value: 0x0013, lo: 0xbc, hi: 0xbf}, + // Block 0xf9, offset 0x50a + {value: 0x0013, lo: 0x80, hi: 0x95}, + {value: 0x0012, lo: 0x96, hi: 0xaf}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0xfa, offset 0x50d + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0012, lo: 0x8a, hi: 0xa5}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0xfb, offset 0x510 + {value: 0x0013, lo: 0x80, hi: 0x80}, + {value: 0x0012, lo: 0x82, hi: 0x9a}, + {value: 0x0012, lo: 0x9c, hi: 0xa1}, + {value: 0x0013, lo: 0xa2, hi: 0xba}, + {value: 0x0012, lo: 0xbc, hi: 0xbf}, + // Block 0xfc, offset 0x515 + {value: 0x0012, lo: 0x80, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0xb4}, + {value: 0x0012, lo: 0xb6, hi: 0xbf}, + // Block 0xfd, offset 0x519 + {value: 0x0012, lo: 0x80, hi: 0x8e}, + {value: 0x0012, lo: 0x90, hi: 0x95}, + {value: 0x0013, lo: 0x96, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0xfe, offset 0x51d + {value: 0x0012, lo: 0x80, hi: 0x88}, + {value: 0x0012, lo: 0x8a, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0xff, offset 0x521 + {value: 0x0012, lo: 0x80, hi: 0x82}, + {value: 0x0012, lo: 0x84, hi: 0x89}, + {value: 0x0017, lo: 0x8a, hi: 0x8b}, + {value: 0x0010, lo: 0x8e, hi: 0xbf}, + // Block 0x100, offset 0x525 + {value: 0x0014, lo: 0x80, hi: 0xb6}, + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x101, offset 0x527 + {value: 0x0014, lo: 0x80, hi: 0xac}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x102, offset 0x529 + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x9b, hi: 0x9f}, + {value: 0x0014, lo: 0xa1, hi: 0xaf}, + // Block 0x103, offset 0x52c + {value: 0x0024, lo: 0x80, hi: 0x86}, + {value: 0x0024, lo: 0x88, hi: 0x98}, + {value: 0x0024, lo: 0x9b, hi: 0xa1}, + {value: 0x0024, lo: 0xa3, hi: 0xa4}, + {value: 0x0024, lo: 0xa6, hi: 0xaa}, + // Block 0x104, offset 0x531 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0034, lo: 0x90, hi: 0x96}, + // Block 0x105, offset 0x533 + {value: 0xb552, lo: 0x80, hi: 0x81}, + {value: 0xb852, lo: 0x82, hi: 0x83}, + {value: 0x0024, lo: 0x84, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x106, offset 0x538 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x9f}, + {value: 0x0010, lo: 0xa1, hi: 0xa2}, + {value: 0x0010, lo: 0xa4, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb7}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + // Block 0x107, offset 0x541 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x9b}, + {value: 0x0010, lo: 0xa1, hi: 0xa3}, + {value: 0x0010, lo: 0xa5, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xbb}, + // Block 0x108, offset 0x546 + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x109, offset 0x547 + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x10a, offset 0x54a + {value: 0x0013, lo: 0x80, hi: 0x89}, + // Block 0x10b, offset 0x54b + {value: 0x0004, lo: 0xbb, hi: 0xbf}, + // Block 0x10c, offset 0x54c + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0014, lo: 0xa0, hi: 0xbf}, + // Block 0x10d, offset 0x54e + {value: 0x0014, lo: 0x80, hi: 0xbf}, + // Block 0x10e, offset 0x54f + {value: 0x0014, lo: 0x80, hi: 0xaf}, +} + +// Total table size 14027 bytes (13KiB); checksum: F17D40E8 diff --git a/vendor/golang.org/x/text/cases/trieval.go b/vendor/golang.org/x/text/cases/trieval.go new file mode 100644 index 0000000..99e0396 --- /dev/null +++ b/vendor/golang.org/x/text/cases/trieval.go @@ -0,0 +1,214 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package cases + +// This file contains definitions for interpreting the trie value of the case +// trie generated by "go run gen*.go". It is shared by both the generator +// program and the resultant package. Sharing is achieved by the generator +// copying gen_trieval.go to trieval.go and changing what's above this comment. + +// info holds case information for a single rune. It is the value returned +// by a trie lookup. Most mapping information can be stored in a single 16-bit +// value. If not, for example when a rune is mapped to multiple runes, the value +// stores some basic case data and an index into an array with additional data. +// +// The per-rune values have the following format: +// +// if (exception) { +// 15..4 unsigned exception index +// } else { +// 15..8 XOR pattern or index to XOR pattern for case mapping +// Only 13..8 are used for XOR patterns. +// 7 inverseFold (fold to upper, not to lower) +// 6 index: interpret the XOR pattern as an index +// or isMid if case mode is cIgnorableUncased. +// 5..4 CCC: zero (normal or break), above or other +// } +// 3 exception: interpret this value as an exception index +// (TODO: is this bit necessary? Probably implied from case mode.) +// 2..0 case mode +// +// For the non-exceptional cases, a rune must be either uncased, lowercase or +// uppercase. If the rune is cased, the XOR pattern maps either a lowercase +// rune to uppercase or an uppercase rune to lowercase (applied to the 10 +// least-significant bits of the rune). +// +// See the definitions below for a more detailed description of the various +// bits. +type info uint16 + +const ( + casedMask = 0x0003 + fullCasedMask = 0x0007 + ignorableMask = 0x0006 + ignorableValue = 0x0004 + + inverseFoldBit = 1 << 7 + isMidBit = 1 << 6 + + exceptionBit = 1 << 3 + exceptionShift = 4 + numExceptionBits = 12 + + xorIndexBit = 1 << 6 + xorShift = 8 + + // There is no mapping if all xor bits and the exception bit are zero. + hasMappingMask = 0xff80 | exceptionBit +) + +// The case mode bits encodes the case type of a rune. This includes uncased, +// title, upper and lower case and case ignorable. (For a definition of these +// terms see Chapter 3 of The Unicode Standard Core Specification.) In some rare +// cases, a rune can be both cased and case-ignorable. This is encoded by +// cIgnorableCased. A rune of this type is always lower case. Some runes are +// cased while not having a mapping. +// +// A common pattern for scripts in the Unicode standard is for upper and lower +// case runes to alternate for increasing rune values (e.g. the accented Latin +// ranges starting from U+0100 and U+1E00 among others and some Cyrillic +// characters). We use this property by defining a cXORCase mode, where the case +// mode (always upper or lower case) is derived from the rune value. As the XOR +// pattern for case mappings is often identical for successive runes, using +// cXORCase can result in large series of identical trie values. This, in turn, +// allows us to better compress the trie blocks. +const ( + cUncased info = iota // 000 + cTitle // 001 + cLower // 010 + cUpper // 011 + cIgnorableUncased // 100 + cIgnorableCased // 101 // lower case if mappings exist + cXORCase // 11x // case is cLower | ((rune&1) ^ x) + + maxCaseMode = cUpper +) + +func (c info) isCased() bool { + return c&casedMask != 0 +} + +func (c info) isCaseIgnorable() bool { + return c&ignorableMask == ignorableValue +} + +func (c info) isNotCasedAndNotCaseIgnorable() bool { + return c&fullCasedMask == 0 +} + +func (c info) isCaseIgnorableAndNotCased() bool { + return c&fullCasedMask == cIgnorableUncased +} + +func (c info) isMid() bool { + return c&(fullCasedMask|isMidBit) == isMidBit|cIgnorableUncased +} + +// The case mapping implementation will need to know about various Canonical +// Combining Class (CCC) values. We encode two of these in the trie value: +// cccZero (0) and cccAbove (230). If the value is cccOther, it means that +// CCC(r) > 0, but not 230. A value of cccBreak means that CCC(r) == 0 and that +// the rune also has the break category Break (see below). +const ( + cccBreak info = iota << 4 + cccZero + cccAbove + cccOther + + cccMask = cccBreak | cccZero | cccAbove | cccOther +) + +const ( + starter = 0 + above = 230 + iotaSubscript = 240 +) + +// The exceptions slice holds data that does not fit in a normal info entry. +// The entry is pointed to by the exception index in an entry. It has the +// following format: +// +// Header +// byte 0: +// 7..6 unused +// 5..4 CCC type (same bits as entry) +// 3 unused +// 2..0 length of fold +// +// byte 1: +// 7..6 unused +// 5..3 length of 1st mapping of case type +// 2..0 length of 2nd mapping of case type +// +// case 1st 2nd +// lower -> upper, title +// upper -> lower, title +// title -> lower, upper +// +// Lengths with the value 0x7 indicate no value and implies no change. +// A length of 0 indicates a mapping to zero-length string. +// +// Body bytes: +// case folding bytes +// lowercase mapping bytes +// uppercase mapping bytes +// titlecase mapping bytes +// closure mapping bytes (for NFKC_Casefold). (TODO) +// +// Fallbacks: +// missing fold -> lower +// missing title -> upper +// all missing -> original rune +// +// exceptions starts with a dummy byte to enforce that there is no zero index +// value. +const ( + lengthMask = 0x07 + lengthBits = 3 + noChange = 0 +) + +// References to generated trie. + +var trie = newCaseTrie(0) + +var sparse = sparseBlocks{ + values: sparseValues[:], + offsets: sparseOffsets[:], +} + +// Sparse block lookup code. + +// valueRange is an entry in a sparse block. +type valueRange struct { + value uint16 + lo, hi byte +} + +type sparseBlocks struct { + values []valueRange + offsets []uint16 +} + +// lookup returns the value from values block n for byte b using binary search. +func (s *sparseBlocks) lookup(n uint32, b byte) uint16 { + lo := s.offsets[n] + hi := s.offsets[n+1] + for lo < hi { + m := lo + (hi-lo)/2 + r := s.values[m] + if r.lo <= b && b <= r.hi { + return r.value + } + if b < r.lo { + hi = m + } else { + lo = m + 1 + } + } + return 0 +} + +// lastRuneForTesting is the last rune used for testing. Everything after this +// is boring. +const lastRuneForTesting = rune(0x1FFFF) diff --git a/vendor/golang.org/x/text/internal/internal.go b/vendor/golang.org/x/text/internal/internal.go new file mode 100644 index 0000000..3cddbbd --- /dev/null +++ b/vendor/golang.org/x/text/internal/internal.go @@ -0,0 +1,49 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package internal contains non-exported functionality that are used by +// packages in the text repository. +package internal // import "golang.org/x/text/internal" + +import ( + "sort" + + "golang.org/x/text/language" +) + +// SortTags sorts tags in place. +func SortTags(tags []language.Tag) { + sort.Sort(sorter(tags)) +} + +type sorter []language.Tag + +func (s sorter) Len() int { + return len(s) +} + +func (s sorter) Swap(i, j int) { + s[i], s[j] = s[j], s[i] +} + +func (s sorter) Less(i, j int) bool { + return s[i].String() < s[j].String() +} + +// UniqueTags sorts and filters duplicate tags in place and returns a slice with +// only unique tags. +func UniqueTags(tags []language.Tag) []language.Tag { + if len(tags) <= 1 { + return tags + } + SortTags(tags) + k := 0 + for i := 1; i < len(tags); i++ { + if tags[k].String() < tags[i].String() { + k++ + tags[k] = tags[i] + } + } + return tags[:k+1] +} diff --git a/vendor/golang.org/x/text/internal/language/common.go b/vendor/golang.org/x/text/internal/language/common.go new file mode 100644 index 0000000..cdfdb74 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/common.go @@ -0,0 +1,16 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package language + +// This file contains code common to the maketables.go and the package code. + +// AliasType is the type of an alias in AliasMap. +type AliasType int8 + +const ( + Deprecated AliasType = iota + Macro + Legacy + + AliasTypeUnknown AliasType = -1 +) diff --git a/vendor/golang.org/x/text/internal/language/compact.go b/vendor/golang.org/x/text/internal/language/compact.go new file mode 100644 index 0000000..46a0015 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact.go @@ -0,0 +1,29 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// CompactCoreInfo is a compact integer with the three core tags encoded. +type CompactCoreInfo uint32 + +// GetCompactCore generates a uint32 value that is guaranteed to be unique for +// different language, region, and script values. +func GetCompactCore(t Tag) (cci CompactCoreInfo, ok bool) { + if t.LangID > langNoIndexOffset { + return 0, false + } + cci |= CompactCoreInfo(t.LangID) << (8 + 12) + cci |= CompactCoreInfo(t.ScriptID) << 12 + cci |= CompactCoreInfo(t.RegionID) + return cci, true +} + +// Tag generates a tag from c. +func (c CompactCoreInfo) Tag() Tag { + return Tag{ + LangID: Language(c >> 20), + RegionID: Region(c & 0x3ff), + ScriptID: Script(c>>12) & 0xff, + } +} diff --git a/vendor/golang.org/x/text/internal/language/compact/compact.go b/vendor/golang.org/x/text/internal/language/compact/compact.go new file mode 100644 index 0000000..1b36935 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/compact.go @@ -0,0 +1,61 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package compact defines a compact representation of language tags. +// +// Common language tags (at least all for which locale information is defined +// in CLDR) are assigned a unique index. Each Tag is associated with such an +// ID for selecting language-related resources (such as translations) as well +// as one for selecting regional defaults (currency, number formatting, etc.) +// +// It may want to export this functionality at some point, but at this point +// this is only available for use within x/text. +package compact // import "golang.org/x/text/internal/language/compact" + +import ( + "sort" + "strings" + + "golang.org/x/text/internal/language" +) + +// ID is an integer identifying a single tag. +type ID uint16 + +func getCoreIndex(t language.Tag) (id ID, ok bool) { + cci, ok := language.GetCompactCore(t) + if !ok { + return 0, false + } + i := sort.Search(len(coreTags), func(i int) bool { + return cci <= coreTags[i] + }) + if i == len(coreTags) || coreTags[i] != cci { + return 0, false + } + return ID(i), true +} + +// Parent returns the ID of the parent or the root ID if id is already the root. +func (id ID) Parent() ID { + return parents[id] +} + +// Tag converts id to an internal language Tag. +func (id ID) Tag() language.Tag { + if int(id) >= len(coreTags) { + return specialTags[int(id)-len(coreTags)] + } + return coreTags[id].Tag() +} + +var specialTags []language.Tag + +func init() { + tags := strings.Split(specialTagsStr, " ") + specialTags = make([]language.Tag, len(tags)) + for i, t := range tags { + specialTags[i] = language.MustParse(t) + } +} diff --git a/vendor/golang.org/x/text/internal/language/compact/language.go b/vendor/golang.org/x/text/internal/language/compact/language.go new file mode 100644 index 0000000..83816a7 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/language.go @@ -0,0 +1,260 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_index.go -output tables.go +//go:generate go run gen_parents.go + +package compact + +// TODO: Remove above NOTE after: +// - verifying that tables are dropped correctly (most notably matcher tables). + +import ( + "strings" + + "golang.org/x/text/internal/language" +) + +// Tag represents a BCP 47 language tag. It is used to specify an instance of a +// specific language or locale. All language tag values are guaranteed to be +// well-formed. +type Tag struct { + // NOTE: exported tags will become part of the public API. + language ID + locale ID + full fullTag // always a language.Tag for now. +} + +const _und = 0 + +type fullTag interface { + IsRoot() bool + Parent() language.Tag +} + +// Make a compact Tag from a fully specified internal language Tag. +func Make(t language.Tag) (tag Tag) { + if region := t.TypeForKey("rg"); len(region) == 6 && region[2:] == "zzzz" { + if r, err := language.ParseRegion(region[:2]); err == nil { + tFull := t + t, _ = t.SetTypeForKey("rg", "") + // TODO: should we not consider "va" for the language tag? + var exact1, exact2 bool + tag.language, exact1 = FromTag(t) + t.RegionID = r + tag.locale, exact2 = FromTag(t) + if !exact1 || !exact2 { + tag.full = tFull + } + return tag + } + } + lang, ok := FromTag(t) + tag.language = lang + tag.locale = lang + if !ok { + tag.full = t + } + return tag +} + +// Tag returns an internal language Tag version of this tag. +func (t Tag) Tag() language.Tag { + if t.full != nil { + return t.full.(language.Tag) + } + tag := t.language.Tag() + if t.language != t.locale { + loc := t.locale.Tag() + tag, _ = tag.SetTypeForKey("rg", strings.ToLower(loc.RegionID.String())+"zzzz") + } + return tag +} + +// IsCompact reports whether this tag is fully defined in terms of ID. +func (t *Tag) IsCompact() bool { + return t.full == nil +} + +// MayHaveVariants reports whether a tag may have variants. If it returns false +// it is guaranteed the tag does not have variants. +func (t Tag) MayHaveVariants() bool { + return t.full != nil || int(t.language) >= len(coreTags) +} + +// MayHaveExtensions reports whether a tag may have extensions. If it returns +// false it is guaranteed the tag does not have them. +func (t Tag) MayHaveExtensions() bool { + return t.full != nil || + int(t.language) >= len(coreTags) || + t.language != t.locale +} + +// IsRoot returns true if t is equal to language "und". +func (t Tag) IsRoot() bool { + if t.full != nil { + return t.full.IsRoot() + } + return t.language == _und +} + +// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a +// specific language are substituted with fields from the parent language. +// The parent for a language may change for newer versions of CLDR. +func (t Tag) Parent() Tag { + if t.full != nil { + return Make(t.full.Parent()) + } + if t.language != t.locale { + // Simulate stripping -u-rg-xxxxxx + return Tag{language: t.language, locale: t.language} + } + // TODO: use parent lookup table once cycle from internal package is + // removed. Probably by internalizing the table and declaring this fast + // enough. + // lang := compactID(internal.Parent(uint16(t.language))) + lang, _ := FromTag(t.language.Tag().Parent()) + return Tag{language: lang, locale: lang} +} + +// returns token t and the rest of the string. +func nextToken(s string) (t, tail string) { + p := strings.Index(s[1:], "-") + if p == -1 { + return s[1:], "" + } + p++ + return s[1:p], s[p:] +} + +// LanguageID returns an index, where 0 <= index < NumCompactTags, for tags +// for which data exists in the text repository.The index will change over time +// and should not be stored in persistent storage. If t does not match a compact +// index, exact will be false and the compact index will be returned for the +// first match after repeatedly taking the Parent of t. +func LanguageID(t Tag) (id ID, exact bool) { + return t.language, t.full == nil +} + +// RegionalID returns the ID for the regional variant of this tag. This index is +// used to indicate region-specific overrides, such as default currency, default +// calendar and week data, default time cycle, and default measurement system +// and unit preferences. +// +// For instance, the tag en-GB-u-rg-uszzzz specifies British English with US +// settings for currency, number formatting, etc. The CompactIndex for this tag +// will be that for en-GB, while the RegionalID will be the one corresponding to +// en-US. +func RegionalID(t Tag) (id ID, exact bool) { + return t.locale, t.full == nil +} + +// LanguageTag returns t stripped of regional variant indicators. +// +// At the moment this means it is stripped of a regional and variant subtag "rg" +// and "va" in the "u" extension. +func (t Tag) LanguageTag() Tag { + if t.full == nil { + return Tag{language: t.language, locale: t.language} + } + tt := t.Tag() + tt.SetTypeForKey("rg", "") + tt.SetTypeForKey("va", "") + return Make(tt) +} + +// RegionalTag returns the regional variant of the tag. +// +// At the moment this means that the region is set from the regional subtag +// "rg" in the "u" extension. +func (t Tag) RegionalTag() Tag { + rt := Tag{language: t.locale, locale: t.locale} + if t.full == nil { + return rt + } + b := language.Builder{} + tag := t.Tag() + // tag, _ = tag.SetTypeForKey("rg", "") + b.SetTag(t.locale.Tag()) + if v := tag.Variants(); v != "" { + for _, v := range strings.Split(v, "-") { + b.AddVariant(v) + } + } + for _, e := range tag.Extensions() { + b.AddExt(e) + } + return t +} + +// FromTag reports closest matching ID for an internal language Tag. +func FromTag(t language.Tag) (id ID, exact bool) { + // TODO: perhaps give more frequent tags a lower index. + // TODO: we could make the indexes stable. This will excluded some + // possibilities for optimization, so don't do this quite yet. + exact = true + + b, s, r := t.Raw() + if t.HasString() { + if t.IsPrivateUse() { + // We have no entries for user-defined tags. + return 0, false + } + hasExtra := false + if t.HasVariants() { + if t.HasExtensions() { + build := language.Builder{} + build.SetTag(language.Tag{LangID: b, ScriptID: s, RegionID: r}) + build.AddVariant(t.Variants()) + exact = false + t = build.Make() + } + hasExtra = true + } else if _, ok := t.Extension('u'); ok { + // TODO: va may mean something else. Consider not considering it. + // Strip all but the 'va' entry. + old := t + variant := t.TypeForKey("va") + t = language.Tag{LangID: b, ScriptID: s, RegionID: r} + if variant != "" { + t, _ = t.SetTypeForKey("va", variant) + hasExtra = true + } + exact = old == t + } else { + exact = false + } + if hasExtra { + // We have some variants. + for i, s := range specialTags { + if s == t { + return ID(i + len(coreTags)), exact + } + } + exact = false + } + } + if x, ok := getCoreIndex(t); ok { + return x, exact + } + exact = false + if r != 0 && s == 0 { + // Deal with cases where an extra script is inserted for the region. + t, _ := t.Maximize() + if x, ok := getCoreIndex(t); ok { + return x, exact + } + } + for t = t.Parent(); t != root; t = t.Parent() { + // No variants specified: just compare core components. + // The key has the form lllssrrr, where l, s, and r are nibbles for + // respectively the langID, scriptID, and regionID. + if x, ok := getCoreIndex(t); ok { + return x, exact + } + } + return 0, exact +} + +var root = language.Tag{} diff --git a/vendor/golang.org/x/text/internal/language/compact/parents.go b/vendor/golang.org/x/text/internal/language/compact/parents.go new file mode 100644 index 0000000..8d81072 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/parents.go @@ -0,0 +1,120 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package compact + +// parents maps a compact index of a tag to the compact index of the parent of +// this tag. +var parents = []ID{ // 775 elements + // Entry 0 - 3F + 0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0004, 0x0000, 0x0006, + 0x0000, 0x0008, 0x0000, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x0000, + 0x0000, 0x0028, 0x0000, 0x002a, 0x0000, 0x002c, 0x0000, 0x0000, + 0x002f, 0x002e, 0x002e, 0x0000, 0x0033, 0x0000, 0x0035, 0x0000, + 0x0037, 0x0000, 0x0039, 0x0000, 0x003b, 0x0000, 0x0000, 0x003e, + // Entry 40 - 7F + 0x0000, 0x0040, 0x0040, 0x0000, 0x0043, 0x0043, 0x0000, 0x0046, + 0x0000, 0x0048, 0x0000, 0x0000, 0x004b, 0x004a, 0x004a, 0x0000, + 0x004f, 0x004f, 0x004f, 0x004f, 0x0000, 0x0054, 0x0054, 0x0000, + 0x0057, 0x0000, 0x0059, 0x0000, 0x005b, 0x0000, 0x005d, 0x005d, + 0x0000, 0x0060, 0x0000, 0x0062, 0x0000, 0x0064, 0x0000, 0x0066, + 0x0066, 0x0000, 0x0069, 0x0000, 0x006b, 0x006b, 0x006b, 0x006b, + 0x006b, 0x006b, 0x006b, 0x0000, 0x0073, 0x0000, 0x0075, 0x0000, + 0x0077, 0x0000, 0x0000, 0x007a, 0x0000, 0x007c, 0x0000, 0x007e, + // Entry 80 - BF + 0x0000, 0x0080, 0x0080, 0x0000, 0x0083, 0x0083, 0x0000, 0x0086, + 0x0087, 0x0087, 0x0087, 0x0086, 0x0088, 0x0087, 0x0087, 0x0087, + 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, 0x0088, 0x0087, + 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0086, + // Entry C0 - FF + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, + 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0086, 0x0087, + 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0000, + 0x00ef, 0x0000, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, + 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f1, 0x00f1, + // Entry 100 - 13F + 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, + 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x0000, 0x010e, + 0x0000, 0x0110, 0x0000, 0x0112, 0x0000, 0x0114, 0x0114, 0x0000, + 0x0117, 0x0117, 0x0117, 0x0117, 0x0000, 0x011c, 0x0000, 0x011e, + 0x0000, 0x0120, 0x0120, 0x0000, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + // Entry 140 - 17F + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0000, 0x0152, 0x0000, 0x0154, 0x0000, 0x0156, + 0x0000, 0x0158, 0x0000, 0x015a, 0x0000, 0x015c, 0x015c, 0x015c, + 0x0000, 0x0160, 0x0000, 0x0000, 0x0163, 0x0000, 0x0165, 0x0000, + 0x0167, 0x0167, 0x0167, 0x0000, 0x016b, 0x0000, 0x016d, 0x0000, + 0x016f, 0x0000, 0x0171, 0x0171, 0x0000, 0x0174, 0x0000, 0x0176, + 0x0000, 0x0178, 0x0000, 0x017a, 0x0000, 0x017c, 0x0000, 0x017e, + // Entry 180 - 1BF + 0x0000, 0x0000, 0x0000, 0x0182, 0x0000, 0x0184, 0x0184, 0x0184, + 0x0184, 0x0000, 0x0000, 0x0000, 0x018b, 0x0000, 0x0000, 0x018e, + 0x0000, 0x0000, 0x0191, 0x0000, 0x0000, 0x0000, 0x0195, 0x0000, + 0x0197, 0x0000, 0x0000, 0x019a, 0x0000, 0x0000, 0x019d, 0x0000, + 0x019f, 0x0000, 0x01a1, 0x0000, 0x01a3, 0x0000, 0x01a5, 0x0000, + 0x01a7, 0x0000, 0x01a9, 0x0000, 0x01ab, 0x0000, 0x01ad, 0x0000, + 0x01af, 0x0000, 0x01b1, 0x01b1, 0x0000, 0x01b4, 0x0000, 0x01b6, + 0x0000, 0x01b8, 0x0000, 0x01ba, 0x0000, 0x01bc, 0x0000, 0x0000, + // Entry 1C0 - 1FF + 0x01bf, 0x0000, 0x01c1, 0x0000, 0x01c3, 0x0000, 0x01c5, 0x0000, + 0x01c7, 0x0000, 0x01c9, 0x0000, 0x01cb, 0x01cb, 0x01cb, 0x01cb, + 0x0000, 0x01d0, 0x0000, 0x01d2, 0x01d2, 0x0000, 0x01d5, 0x0000, + 0x01d7, 0x0000, 0x01d9, 0x0000, 0x01db, 0x0000, 0x01dd, 0x0000, + 0x01df, 0x01df, 0x0000, 0x01e2, 0x0000, 0x01e4, 0x0000, 0x01e6, + 0x0000, 0x01e8, 0x0000, 0x01ea, 0x0000, 0x01ec, 0x0000, 0x01ee, + 0x0000, 0x01f0, 0x0000, 0x0000, 0x01f3, 0x0000, 0x01f5, 0x01f5, + 0x01f5, 0x0000, 0x01f9, 0x0000, 0x01fb, 0x0000, 0x01fd, 0x0000, + // Entry 200 - 23F + 0x01ff, 0x0000, 0x0000, 0x0202, 0x0000, 0x0204, 0x0204, 0x0000, + 0x0207, 0x0000, 0x0209, 0x0209, 0x0000, 0x020c, 0x020c, 0x0000, + 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x0000, + 0x0217, 0x0000, 0x0219, 0x0000, 0x021b, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0221, 0x0000, 0x0000, 0x0224, 0x0000, 0x0226, + 0x0226, 0x0000, 0x0229, 0x0000, 0x022b, 0x022b, 0x0000, 0x0000, + 0x022f, 0x022e, 0x022e, 0x0000, 0x0000, 0x0234, 0x0000, 0x0236, + 0x0000, 0x0238, 0x0000, 0x0244, 0x023a, 0x0244, 0x0244, 0x0244, + // Entry 240 - 27F + 0x0244, 0x0244, 0x0244, 0x0244, 0x023a, 0x0244, 0x0244, 0x0000, + 0x0247, 0x0247, 0x0247, 0x0000, 0x024b, 0x0000, 0x024d, 0x0000, + 0x024f, 0x024f, 0x0000, 0x0252, 0x0000, 0x0254, 0x0254, 0x0254, + 0x0254, 0x0254, 0x0254, 0x0000, 0x025b, 0x0000, 0x025d, 0x0000, + 0x025f, 0x0000, 0x0261, 0x0000, 0x0263, 0x0000, 0x0265, 0x0000, + 0x0000, 0x0268, 0x0268, 0x0268, 0x0000, 0x026c, 0x0000, 0x026e, + 0x0000, 0x0270, 0x0000, 0x0000, 0x0000, 0x0274, 0x0273, 0x0273, + 0x0000, 0x0278, 0x0000, 0x027a, 0x0000, 0x027c, 0x0000, 0x0000, + // Entry 280 - 2BF + 0x0000, 0x0000, 0x0281, 0x0000, 0x0000, 0x0284, 0x0000, 0x0286, + 0x0286, 0x0286, 0x0286, 0x0000, 0x028b, 0x028b, 0x028b, 0x0000, + 0x028f, 0x028f, 0x028f, 0x028f, 0x028f, 0x0000, 0x0295, 0x0295, + 0x0295, 0x0295, 0x0000, 0x0000, 0x0000, 0x0000, 0x029d, 0x029d, + 0x029d, 0x0000, 0x02a1, 0x02a1, 0x02a1, 0x02a1, 0x0000, 0x0000, + 0x02a7, 0x02a7, 0x02a7, 0x02a7, 0x0000, 0x02ac, 0x0000, 0x02ae, + 0x02ae, 0x0000, 0x02b1, 0x0000, 0x02b3, 0x0000, 0x02b5, 0x02b5, + 0x0000, 0x0000, 0x02b9, 0x0000, 0x0000, 0x0000, 0x02bd, 0x0000, + // Entry 2C0 - 2FF + 0x02bf, 0x02bf, 0x0000, 0x0000, 0x02c3, 0x0000, 0x02c5, 0x0000, + 0x02c7, 0x0000, 0x02c9, 0x0000, 0x02cb, 0x0000, 0x02cd, 0x02cd, + 0x0000, 0x0000, 0x02d1, 0x0000, 0x02d3, 0x02d0, 0x02d0, 0x0000, + 0x0000, 0x02d8, 0x02d7, 0x02d7, 0x0000, 0x0000, 0x02dd, 0x0000, + 0x02df, 0x0000, 0x02e1, 0x0000, 0x0000, 0x02e4, 0x0000, 0x02e6, + 0x0000, 0x0000, 0x02e9, 0x0000, 0x02eb, 0x0000, 0x02ed, 0x0000, + 0x02ef, 0x02ef, 0x0000, 0x0000, 0x02f3, 0x02f2, 0x02f2, 0x0000, + 0x02f7, 0x0000, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x0000, + // Entry 300 - 33F + 0x02ff, 0x0300, 0x02ff, 0x0000, 0x0303, 0x0051, 0x00e6, +} // Size: 1574 bytes + +// Total table size 1574 bytes (1KiB); checksum: 895AAF0B diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go new file mode 100644 index 0000000..fe7ad9e --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/tables.go @@ -0,0 +1,1015 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package compact + +import "golang.org/x/text/internal/language" + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +// NumCompactTags is the number of common tags. The maximum tag is +// NumCompactTags-1. +const NumCompactTags = 775 +const ( + undIndex ID = 0 + afIndex ID = 1 + afNAIndex ID = 2 + afZAIndex ID = 3 + agqIndex ID = 4 + agqCMIndex ID = 5 + akIndex ID = 6 + akGHIndex ID = 7 + amIndex ID = 8 + amETIndex ID = 9 + arIndex ID = 10 + ar001Index ID = 11 + arAEIndex ID = 12 + arBHIndex ID = 13 + arDJIndex ID = 14 + arDZIndex ID = 15 + arEGIndex ID = 16 + arEHIndex ID = 17 + arERIndex ID = 18 + arILIndex ID = 19 + arIQIndex ID = 20 + arJOIndex ID = 21 + arKMIndex ID = 22 + arKWIndex ID = 23 + arLBIndex ID = 24 + arLYIndex ID = 25 + arMAIndex ID = 26 + arMRIndex ID = 27 + arOMIndex ID = 28 + arPSIndex ID = 29 + arQAIndex ID = 30 + arSAIndex ID = 31 + arSDIndex ID = 32 + arSOIndex ID = 33 + arSSIndex ID = 34 + arSYIndex ID = 35 + arTDIndex ID = 36 + arTNIndex ID = 37 + arYEIndex ID = 38 + arsIndex ID = 39 + asIndex ID = 40 + asINIndex ID = 41 + asaIndex ID = 42 + asaTZIndex ID = 43 + astIndex ID = 44 + astESIndex ID = 45 + azIndex ID = 46 + azCyrlIndex ID = 47 + azCyrlAZIndex ID = 48 + azLatnIndex ID = 49 + azLatnAZIndex ID = 50 + basIndex ID = 51 + basCMIndex ID = 52 + beIndex ID = 53 + beBYIndex ID = 54 + bemIndex ID = 55 + bemZMIndex ID = 56 + bezIndex ID = 57 + bezTZIndex ID = 58 + bgIndex ID = 59 + bgBGIndex ID = 60 + bhIndex ID = 61 + bmIndex ID = 62 + bmMLIndex ID = 63 + bnIndex ID = 64 + bnBDIndex ID = 65 + bnINIndex ID = 66 + boIndex ID = 67 + boCNIndex ID = 68 + boINIndex ID = 69 + brIndex ID = 70 + brFRIndex ID = 71 + brxIndex ID = 72 + brxINIndex ID = 73 + bsIndex ID = 74 + bsCyrlIndex ID = 75 + bsCyrlBAIndex ID = 76 + bsLatnIndex ID = 77 + bsLatnBAIndex ID = 78 + caIndex ID = 79 + caADIndex ID = 80 + caESIndex ID = 81 + caFRIndex ID = 82 + caITIndex ID = 83 + ccpIndex ID = 84 + ccpBDIndex ID = 85 + ccpINIndex ID = 86 + ceIndex ID = 87 + ceRUIndex ID = 88 + cggIndex ID = 89 + cggUGIndex ID = 90 + chrIndex ID = 91 + chrUSIndex ID = 92 + ckbIndex ID = 93 + ckbIQIndex ID = 94 + ckbIRIndex ID = 95 + csIndex ID = 96 + csCZIndex ID = 97 + cuIndex ID = 98 + cuRUIndex ID = 99 + cyIndex ID = 100 + cyGBIndex ID = 101 + daIndex ID = 102 + daDKIndex ID = 103 + daGLIndex ID = 104 + davIndex ID = 105 + davKEIndex ID = 106 + deIndex ID = 107 + deATIndex ID = 108 + deBEIndex ID = 109 + deCHIndex ID = 110 + deDEIndex ID = 111 + deITIndex ID = 112 + deLIIndex ID = 113 + deLUIndex ID = 114 + djeIndex ID = 115 + djeNEIndex ID = 116 + dsbIndex ID = 117 + dsbDEIndex ID = 118 + duaIndex ID = 119 + duaCMIndex ID = 120 + dvIndex ID = 121 + dyoIndex ID = 122 + dyoSNIndex ID = 123 + dzIndex ID = 124 + dzBTIndex ID = 125 + ebuIndex ID = 126 + ebuKEIndex ID = 127 + eeIndex ID = 128 + eeGHIndex ID = 129 + eeTGIndex ID = 130 + elIndex ID = 131 + elCYIndex ID = 132 + elGRIndex ID = 133 + enIndex ID = 134 + en001Index ID = 135 + en150Index ID = 136 + enAGIndex ID = 137 + enAIIndex ID = 138 + enASIndex ID = 139 + enATIndex ID = 140 + enAUIndex ID = 141 + enBBIndex ID = 142 + enBEIndex ID = 143 + enBIIndex ID = 144 + enBMIndex ID = 145 + enBSIndex ID = 146 + enBWIndex ID = 147 + enBZIndex ID = 148 + enCAIndex ID = 149 + enCCIndex ID = 150 + enCHIndex ID = 151 + enCKIndex ID = 152 + enCMIndex ID = 153 + enCXIndex ID = 154 + enCYIndex ID = 155 + enDEIndex ID = 156 + enDGIndex ID = 157 + enDKIndex ID = 158 + enDMIndex ID = 159 + enERIndex ID = 160 + enFIIndex ID = 161 + enFJIndex ID = 162 + enFKIndex ID = 163 + enFMIndex ID = 164 + enGBIndex ID = 165 + enGDIndex ID = 166 + enGGIndex ID = 167 + enGHIndex ID = 168 + enGIIndex ID = 169 + enGMIndex ID = 170 + enGUIndex ID = 171 + enGYIndex ID = 172 + enHKIndex ID = 173 + enIEIndex ID = 174 + enILIndex ID = 175 + enIMIndex ID = 176 + enINIndex ID = 177 + enIOIndex ID = 178 + enJEIndex ID = 179 + enJMIndex ID = 180 + enKEIndex ID = 181 + enKIIndex ID = 182 + enKNIndex ID = 183 + enKYIndex ID = 184 + enLCIndex ID = 185 + enLRIndex ID = 186 + enLSIndex ID = 187 + enMGIndex ID = 188 + enMHIndex ID = 189 + enMOIndex ID = 190 + enMPIndex ID = 191 + enMSIndex ID = 192 + enMTIndex ID = 193 + enMUIndex ID = 194 + enMWIndex ID = 195 + enMYIndex ID = 196 + enNAIndex ID = 197 + enNFIndex ID = 198 + enNGIndex ID = 199 + enNLIndex ID = 200 + enNRIndex ID = 201 + enNUIndex ID = 202 + enNZIndex ID = 203 + enPGIndex ID = 204 + enPHIndex ID = 205 + enPKIndex ID = 206 + enPNIndex ID = 207 + enPRIndex ID = 208 + enPWIndex ID = 209 + enRWIndex ID = 210 + enSBIndex ID = 211 + enSCIndex ID = 212 + enSDIndex ID = 213 + enSEIndex ID = 214 + enSGIndex ID = 215 + enSHIndex ID = 216 + enSIIndex ID = 217 + enSLIndex ID = 218 + enSSIndex ID = 219 + enSXIndex ID = 220 + enSZIndex ID = 221 + enTCIndex ID = 222 + enTKIndex ID = 223 + enTOIndex ID = 224 + enTTIndex ID = 225 + enTVIndex ID = 226 + enTZIndex ID = 227 + enUGIndex ID = 228 + enUMIndex ID = 229 + enUSIndex ID = 230 + enVCIndex ID = 231 + enVGIndex ID = 232 + enVIIndex ID = 233 + enVUIndex ID = 234 + enWSIndex ID = 235 + enZAIndex ID = 236 + enZMIndex ID = 237 + enZWIndex ID = 238 + eoIndex ID = 239 + eo001Index ID = 240 + esIndex ID = 241 + es419Index ID = 242 + esARIndex ID = 243 + esBOIndex ID = 244 + esBRIndex ID = 245 + esBZIndex ID = 246 + esCLIndex ID = 247 + esCOIndex ID = 248 + esCRIndex ID = 249 + esCUIndex ID = 250 + esDOIndex ID = 251 + esEAIndex ID = 252 + esECIndex ID = 253 + esESIndex ID = 254 + esGQIndex ID = 255 + esGTIndex ID = 256 + esHNIndex ID = 257 + esICIndex ID = 258 + esMXIndex ID = 259 + esNIIndex ID = 260 + esPAIndex ID = 261 + esPEIndex ID = 262 + esPHIndex ID = 263 + esPRIndex ID = 264 + esPYIndex ID = 265 + esSVIndex ID = 266 + esUSIndex ID = 267 + esUYIndex ID = 268 + esVEIndex ID = 269 + etIndex ID = 270 + etEEIndex ID = 271 + euIndex ID = 272 + euESIndex ID = 273 + ewoIndex ID = 274 + ewoCMIndex ID = 275 + faIndex ID = 276 + faAFIndex ID = 277 + faIRIndex ID = 278 + ffIndex ID = 279 + ffCMIndex ID = 280 + ffGNIndex ID = 281 + ffMRIndex ID = 282 + ffSNIndex ID = 283 + fiIndex ID = 284 + fiFIIndex ID = 285 + filIndex ID = 286 + filPHIndex ID = 287 + foIndex ID = 288 + foDKIndex ID = 289 + foFOIndex ID = 290 + frIndex ID = 291 + frBEIndex ID = 292 + frBFIndex ID = 293 + frBIIndex ID = 294 + frBJIndex ID = 295 + frBLIndex ID = 296 + frCAIndex ID = 297 + frCDIndex ID = 298 + frCFIndex ID = 299 + frCGIndex ID = 300 + frCHIndex ID = 301 + frCIIndex ID = 302 + frCMIndex ID = 303 + frDJIndex ID = 304 + frDZIndex ID = 305 + frFRIndex ID = 306 + frGAIndex ID = 307 + frGFIndex ID = 308 + frGNIndex ID = 309 + frGPIndex ID = 310 + frGQIndex ID = 311 + frHTIndex ID = 312 + frKMIndex ID = 313 + frLUIndex ID = 314 + frMAIndex ID = 315 + frMCIndex ID = 316 + frMFIndex ID = 317 + frMGIndex ID = 318 + frMLIndex ID = 319 + frMQIndex ID = 320 + frMRIndex ID = 321 + frMUIndex ID = 322 + frNCIndex ID = 323 + frNEIndex ID = 324 + frPFIndex ID = 325 + frPMIndex ID = 326 + frREIndex ID = 327 + frRWIndex ID = 328 + frSCIndex ID = 329 + frSNIndex ID = 330 + frSYIndex ID = 331 + frTDIndex ID = 332 + frTGIndex ID = 333 + frTNIndex ID = 334 + frVUIndex ID = 335 + frWFIndex ID = 336 + frYTIndex ID = 337 + furIndex ID = 338 + furITIndex ID = 339 + fyIndex ID = 340 + fyNLIndex ID = 341 + gaIndex ID = 342 + gaIEIndex ID = 343 + gdIndex ID = 344 + gdGBIndex ID = 345 + glIndex ID = 346 + glESIndex ID = 347 + gswIndex ID = 348 + gswCHIndex ID = 349 + gswFRIndex ID = 350 + gswLIIndex ID = 351 + guIndex ID = 352 + guINIndex ID = 353 + guwIndex ID = 354 + guzIndex ID = 355 + guzKEIndex ID = 356 + gvIndex ID = 357 + gvIMIndex ID = 358 + haIndex ID = 359 + haGHIndex ID = 360 + haNEIndex ID = 361 + haNGIndex ID = 362 + hawIndex ID = 363 + hawUSIndex ID = 364 + heIndex ID = 365 + heILIndex ID = 366 + hiIndex ID = 367 + hiINIndex ID = 368 + hrIndex ID = 369 + hrBAIndex ID = 370 + hrHRIndex ID = 371 + hsbIndex ID = 372 + hsbDEIndex ID = 373 + huIndex ID = 374 + huHUIndex ID = 375 + hyIndex ID = 376 + hyAMIndex ID = 377 + idIndex ID = 378 + idIDIndex ID = 379 + igIndex ID = 380 + igNGIndex ID = 381 + iiIndex ID = 382 + iiCNIndex ID = 383 + inIndex ID = 384 + ioIndex ID = 385 + isIndex ID = 386 + isISIndex ID = 387 + itIndex ID = 388 + itCHIndex ID = 389 + itITIndex ID = 390 + itSMIndex ID = 391 + itVAIndex ID = 392 + iuIndex ID = 393 + iwIndex ID = 394 + jaIndex ID = 395 + jaJPIndex ID = 396 + jboIndex ID = 397 + jgoIndex ID = 398 + jgoCMIndex ID = 399 + jiIndex ID = 400 + jmcIndex ID = 401 + jmcTZIndex ID = 402 + jvIndex ID = 403 + jwIndex ID = 404 + kaIndex ID = 405 + kaGEIndex ID = 406 + kabIndex ID = 407 + kabDZIndex ID = 408 + kajIndex ID = 409 + kamIndex ID = 410 + kamKEIndex ID = 411 + kcgIndex ID = 412 + kdeIndex ID = 413 + kdeTZIndex ID = 414 + keaIndex ID = 415 + keaCVIndex ID = 416 + khqIndex ID = 417 + khqMLIndex ID = 418 + kiIndex ID = 419 + kiKEIndex ID = 420 + kkIndex ID = 421 + kkKZIndex ID = 422 + kkjIndex ID = 423 + kkjCMIndex ID = 424 + klIndex ID = 425 + klGLIndex ID = 426 + klnIndex ID = 427 + klnKEIndex ID = 428 + kmIndex ID = 429 + kmKHIndex ID = 430 + knIndex ID = 431 + knINIndex ID = 432 + koIndex ID = 433 + koKPIndex ID = 434 + koKRIndex ID = 435 + kokIndex ID = 436 + kokINIndex ID = 437 + ksIndex ID = 438 + ksINIndex ID = 439 + ksbIndex ID = 440 + ksbTZIndex ID = 441 + ksfIndex ID = 442 + ksfCMIndex ID = 443 + kshIndex ID = 444 + kshDEIndex ID = 445 + kuIndex ID = 446 + kwIndex ID = 447 + kwGBIndex ID = 448 + kyIndex ID = 449 + kyKGIndex ID = 450 + lagIndex ID = 451 + lagTZIndex ID = 452 + lbIndex ID = 453 + lbLUIndex ID = 454 + lgIndex ID = 455 + lgUGIndex ID = 456 + lktIndex ID = 457 + lktUSIndex ID = 458 + lnIndex ID = 459 + lnAOIndex ID = 460 + lnCDIndex ID = 461 + lnCFIndex ID = 462 + lnCGIndex ID = 463 + loIndex ID = 464 + loLAIndex ID = 465 + lrcIndex ID = 466 + lrcIQIndex ID = 467 + lrcIRIndex ID = 468 + ltIndex ID = 469 + ltLTIndex ID = 470 + luIndex ID = 471 + luCDIndex ID = 472 + luoIndex ID = 473 + luoKEIndex ID = 474 + luyIndex ID = 475 + luyKEIndex ID = 476 + lvIndex ID = 477 + lvLVIndex ID = 478 + masIndex ID = 479 + masKEIndex ID = 480 + masTZIndex ID = 481 + merIndex ID = 482 + merKEIndex ID = 483 + mfeIndex ID = 484 + mfeMUIndex ID = 485 + mgIndex ID = 486 + mgMGIndex ID = 487 + mghIndex ID = 488 + mghMZIndex ID = 489 + mgoIndex ID = 490 + mgoCMIndex ID = 491 + mkIndex ID = 492 + mkMKIndex ID = 493 + mlIndex ID = 494 + mlINIndex ID = 495 + mnIndex ID = 496 + mnMNIndex ID = 497 + moIndex ID = 498 + mrIndex ID = 499 + mrINIndex ID = 500 + msIndex ID = 501 + msBNIndex ID = 502 + msMYIndex ID = 503 + msSGIndex ID = 504 + mtIndex ID = 505 + mtMTIndex ID = 506 + muaIndex ID = 507 + muaCMIndex ID = 508 + myIndex ID = 509 + myMMIndex ID = 510 + mznIndex ID = 511 + mznIRIndex ID = 512 + nahIndex ID = 513 + naqIndex ID = 514 + naqNAIndex ID = 515 + nbIndex ID = 516 + nbNOIndex ID = 517 + nbSJIndex ID = 518 + ndIndex ID = 519 + ndZWIndex ID = 520 + ndsIndex ID = 521 + ndsDEIndex ID = 522 + ndsNLIndex ID = 523 + neIndex ID = 524 + neINIndex ID = 525 + neNPIndex ID = 526 + nlIndex ID = 527 + nlAWIndex ID = 528 + nlBEIndex ID = 529 + nlBQIndex ID = 530 + nlCWIndex ID = 531 + nlNLIndex ID = 532 + nlSRIndex ID = 533 + nlSXIndex ID = 534 + nmgIndex ID = 535 + nmgCMIndex ID = 536 + nnIndex ID = 537 + nnNOIndex ID = 538 + nnhIndex ID = 539 + nnhCMIndex ID = 540 + noIndex ID = 541 + nqoIndex ID = 542 + nrIndex ID = 543 + nsoIndex ID = 544 + nusIndex ID = 545 + nusSSIndex ID = 546 + nyIndex ID = 547 + nynIndex ID = 548 + nynUGIndex ID = 549 + omIndex ID = 550 + omETIndex ID = 551 + omKEIndex ID = 552 + orIndex ID = 553 + orINIndex ID = 554 + osIndex ID = 555 + osGEIndex ID = 556 + osRUIndex ID = 557 + paIndex ID = 558 + paArabIndex ID = 559 + paArabPKIndex ID = 560 + paGuruIndex ID = 561 + paGuruINIndex ID = 562 + papIndex ID = 563 + plIndex ID = 564 + plPLIndex ID = 565 + prgIndex ID = 566 + prg001Index ID = 567 + psIndex ID = 568 + psAFIndex ID = 569 + ptIndex ID = 570 + ptAOIndex ID = 571 + ptBRIndex ID = 572 + ptCHIndex ID = 573 + ptCVIndex ID = 574 + ptGQIndex ID = 575 + ptGWIndex ID = 576 + ptLUIndex ID = 577 + ptMOIndex ID = 578 + ptMZIndex ID = 579 + ptPTIndex ID = 580 + ptSTIndex ID = 581 + ptTLIndex ID = 582 + quIndex ID = 583 + quBOIndex ID = 584 + quECIndex ID = 585 + quPEIndex ID = 586 + rmIndex ID = 587 + rmCHIndex ID = 588 + rnIndex ID = 589 + rnBIIndex ID = 590 + roIndex ID = 591 + roMDIndex ID = 592 + roROIndex ID = 593 + rofIndex ID = 594 + rofTZIndex ID = 595 + ruIndex ID = 596 + ruBYIndex ID = 597 + ruKGIndex ID = 598 + ruKZIndex ID = 599 + ruMDIndex ID = 600 + ruRUIndex ID = 601 + ruUAIndex ID = 602 + rwIndex ID = 603 + rwRWIndex ID = 604 + rwkIndex ID = 605 + rwkTZIndex ID = 606 + sahIndex ID = 607 + sahRUIndex ID = 608 + saqIndex ID = 609 + saqKEIndex ID = 610 + sbpIndex ID = 611 + sbpTZIndex ID = 612 + sdIndex ID = 613 + sdPKIndex ID = 614 + sdhIndex ID = 615 + seIndex ID = 616 + seFIIndex ID = 617 + seNOIndex ID = 618 + seSEIndex ID = 619 + sehIndex ID = 620 + sehMZIndex ID = 621 + sesIndex ID = 622 + sesMLIndex ID = 623 + sgIndex ID = 624 + sgCFIndex ID = 625 + shIndex ID = 626 + shiIndex ID = 627 + shiLatnIndex ID = 628 + shiLatnMAIndex ID = 629 + shiTfngIndex ID = 630 + shiTfngMAIndex ID = 631 + siIndex ID = 632 + siLKIndex ID = 633 + skIndex ID = 634 + skSKIndex ID = 635 + slIndex ID = 636 + slSIIndex ID = 637 + smaIndex ID = 638 + smiIndex ID = 639 + smjIndex ID = 640 + smnIndex ID = 641 + smnFIIndex ID = 642 + smsIndex ID = 643 + snIndex ID = 644 + snZWIndex ID = 645 + soIndex ID = 646 + soDJIndex ID = 647 + soETIndex ID = 648 + soKEIndex ID = 649 + soSOIndex ID = 650 + sqIndex ID = 651 + sqALIndex ID = 652 + sqMKIndex ID = 653 + sqXKIndex ID = 654 + srIndex ID = 655 + srCyrlIndex ID = 656 + srCyrlBAIndex ID = 657 + srCyrlMEIndex ID = 658 + srCyrlRSIndex ID = 659 + srCyrlXKIndex ID = 660 + srLatnIndex ID = 661 + srLatnBAIndex ID = 662 + srLatnMEIndex ID = 663 + srLatnRSIndex ID = 664 + srLatnXKIndex ID = 665 + ssIndex ID = 666 + ssyIndex ID = 667 + stIndex ID = 668 + svIndex ID = 669 + svAXIndex ID = 670 + svFIIndex ID = 671 + svSEIndex ID = 672 + swIndex ID = 673 + swCDIndex ID = 674 + swKEIndex ID = 675 + swTZIndex ID = 676 + swUGIndex ID = 677 + syrIndex ID = 678 + taIndex ID = 679 + taINIndex ID = 680 + taLKIndex ID = 681 + taMYIndex ID = 682 + taSGIndex ID = 683 + teIndex ID = 684 + teINIndex ID = 685 + teoIndex ID = 686 + teoKEIndex ID = 687 + teoUGIndex ID = 688 + tgIndex ID = 689 + tgTJIndex ID = 690 + thIndex ID = 691 + thTHIndex ID = 692 + tiIndex ID = 693 + tiERIndex ID = 694 + tiETIndex ID = 695 + tigIndex ID = 696 + tkIndex ID = 697 + tkTMIndex ID = 698 + tlIndex ID = 699 + tnIndex ID = 700 + toIndex ID = 701 + toTOIndex ID = 702 + trIndex ID = 703 + trCYIndex ID = 704 + trTRIndex ID = 705 + tsIndex ID = 706 + ttIndex ID = 707 + ttRUIndex ID = 708 + twqIndex ID = 709 + twqNEIndex ID = 710 + tzmIndex ID = 711 + tzmMAIndex ID = 712 + ugIndex ID = 713 + ugCNIndex ID = 714 + ukIndex ID = 715 + ukUAIndex ID = 716 + urIndex ID = 717 + urINIndex ID = 718 + urPKIndex ID = 719 + uzIndex ID = 720 + uzArabIndex ID = 721 + uzArabAFIndex ID = 722 + uzCyrlIndex ID = 723 + uzCyrlUZIndex ID = 724 + uzLatnIndex ID = 725 + uzLatnUZIndex ID = 726 + vaiIndex ID = 727 + vaiLatnIndex ID = 728 + vaiLatnLRIndex ID = 729 + vaiVaiiIndex ID = 730 + vaiVaiiLRIndex ID = 731 + veIndex ID = 732 + viIndex ID = 733 + viVNIndex ID = 734 + voIndex ID = 735 + vo001Index ID = 736 + vunIndex ID = 737 + vunTZIndex ID = 738 + waIndex ID = 739 + waeIndex ID = 740 + waeCHIndex ID = 741 + woIndex ID = 742 + woSNIndex ID = 743 + xhIndex ID = 744 + xogIndex ID = 745 + xogUGIndex ID = 746 + yavIndex ID = 747 + yavCMIndex ID = 748 + yiIndex ID = 749 + yi001Index ID = 750 + yoIndex ID = 751 + yoBJIndex ID = 752 + yoNGIndex ID = 753 + yueIndex ID = 754 + yueHansIndex ID = 755 + yueHansCNIndex ID = 756 + yueHantIndex ID = 757 + yueHantHKIndex ID = 758 + zghIndex ID = 759 + zghMAIndex ID = 760 + zhIndex ID = 761 + zhHansIndex ID = 762 + zhHansCNIndex ID = 763 + zhHansHKIndex ID = 764 + zhHansMOIndex ID = 765 + zhHansSGIndex ID = 766 + zhHantIndex ID = 767 + zhHantHKIndex ID = 768 + zhHantMOIndex ID = 769 + zhHantTWIndex ID = 770 + zuIndex ID = 771 + zuZAIndex ID = 772 + caESvalenciaIndex ID = 773 + enUSuvaposixIndex ID = 774 +) + +var coreTags = []language.CompactCoreInfo{ // 773 elements + // Entry 0 - 1F + 0x00000000, 0x01600000, 0x016000d2, 0x01600161, + 0x01c00000, 0x01c00052, 0x02100000, 0x02100080, + 0x02700000, 0x0270006f, 0x03a00000, 0x03a00001, + 0x03a00023, 0x03a00039, 0x03a00062, 0x03a00067, + 0x03a0006b, 0x03a0006c, 0x03a0006d, 0x03a00097, + 0x03a0009b, 0x03a000a1, 0x03a000a8, 0x03a000ac, + 0x03a000b0, 0x03a000b9, 0x03a000ba, 0x03a000c9, + 0x03a000e1, 0x03a000ed, 0x03a000f3, 0x03a00108, + // Entry 20 - 3F + 0x03a0010b, 0x03a00115, 0x03a00117, 0x03a0011c, + 0x03a00120, 0x03a00128, 0x03a0015e, 0x04000000, + 0x04300000, 0x04300099, 0x04400000, 0x0440012f, + 0x04800000, 0x0480006e, 0x05800000, 0x05820000, + 0x05820032, 0x0585a000, 0x0585a032, 0x05e00000, + 0x05e00052, 0x07100000, 0x07100047, 0x07500000, + 0x07500162, 0x07900000, 0x0790012f, 0x07e00000, + 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c3, + // Entry 40 - 5F + 0x0a500000, 0x0a500035, 0x0a500099, 0x0a900000, + 0x0a900053, 0x0a900099, 0x0b200000, 0x0b200078, + 0x0b500000, 0x0b500099, 0x0b700000, 0x0b720000, + 0x0b720033, 0x0b75a000, 0x0b75a033, 0x0d700000, + 0x0d700022, 0x0d70006e, 0x0d700078, 0x0d70009e, + 0x0db00000, 0x0db00035, 0x0db00099, 0x0dc00000, + 0x0dc00106, 0x0df00000, 0x0df00131, 0x0e500000, + 0x0e500135, 0x0e900000, 0x0e90009b, 0x0e90009c, + // Entry 60 - 7F + 0x0fa00000, 0x0fa0005e, 0x0fe00000, 0x0fe00106, + 0x10000000, 0x1000007b, 0x10100000, 0x10100063, + 0x10100082, 0x10800000, 0x108000a4, 0x10d00000, + 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00060, + 0x10d0009e, 0x10d000b2, 0x10d000b7, 0x11700000, + 0x117000d4, 0x11f00000, 0x11f00060, 0x12400000, + 0x12400052, 0x12800000, 0x12b00000, 0x12b00114, + 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a4, + // Entry 80 - 9F + 0x13000000, 0x13000080, 0x13000122, 0x13600000, + 0x1360005d, 0x13600087, 0x13900000, 0x13900001, + 0x1390001a, 0x13900025, 0x13900026, 0x1390002d, + 0x1390002e, 0x1390002f, 0x13900034, 0x13900036, + 0x1390003a, 0x1390003d, 0x13900042, 0x13900046, + 0x13900048, 0x13900049, 0x1390004a, 0x1390004e, + 0x13900050, 0x13900052, 0x1390005c, 0x1390005d, + 0x13900060, 0x13900061, 0x13900063, 0x13900064, + // Entry A0 - BF + 0x1390006d, 0x13900072, 0x13900073, 0x13900074, + 0x13900075, 0x1390007b, 0x1390007c, 0x1390007f, + 0x13900080, 0x13900081, 0x13900083, 0x1390008a, + 0x1390008c, 0x1390008d, 0x13900096, 0x13900097, + 0x13900098, 0x13900099, 0x1390009a, 0x1390009f, + 0x139000a0, 0x139000a4, 0x139000a7, 0x139000a9, + 0x139000ad, 0x139000b1, 0x139000b4, 0x139000b5, + 0x139000bf, 0x139000c0, 0x139000c6, 0x139000c7, + // Entry C0 - DF + 0x139000ca, 0x139000cb, 0x139000cc, 0x139000ce, + 0x139000d0, 0x139000d2, 0x139000d5, 0x139000d6, + 0x139000d9, 0x139000dd, 0x139000df, 0x139000e0, + 0x139000e6, 0x139000e7, 0x139000e8, 0x139000eb, + 0x139000ec, 0x139000f0, 0x13900107, 0x13900109, + 0x1390010a, 0x1390010b, 0x1390010c, 0x1390010d, + 0x1390010e, 0x1390010f, 0x13900112, 0x13900117, + 0x1390011b, 0x1390011d, 0x1390011f, 0x13900125, + // Entry E0 - FF + 0x13900129, 0x1390012c, 0x1390012d, 0x1390012f, + 0x13900131, 0x13900133, 0x13900135, 0x13900139, + 0x1390013c, 0x1390013d, 0x1390013f, 0x13900142, + 0x13900161, 0x13900162, 0x13900164, 0x13c00000, + 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c, + 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051, + 0x13e00054, 0x13e00056, 0x13e00059, 0x13e00065, + 0x13e00068, 0x13e00069, 0x13e0006e, 0x13e00086, + // Entry 100 - 11F + 0x13e00089, 0x13e0008f, 0x13e00094, 0x13e000cf, + 0x13e000d8, 0x13e000e2, 0x13e000e4, 0x13e000e7, + 0x13e000ec, 0x13e000f1, 0x13e0011a, 0x13e00135, + 0x13e00136, 0x13e0013b, 0x14000000, 0x1400006a, + 0x14500000, 0x1450006e, 0x14600000, 0x14600052, + 0x14800000, 0x14800024, 0x1480009c, 0x14e00000, + 0x14e00052, 0x14e00084, 0x14e000c9, 0x14e00114, + 0x15100000, 0x15100072, 0x15300000, 0x153000e7, + // Entry 120 - 13F + 0x15800000, 0x15800063, 0x15800076, 0x15e00000, + 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b, + 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c, + 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052, + 0x15e00062, 0x15e00067, 0x15e00078, 0x15e0007a, + 0x15e0007e, 0x15e00084, 0x15e00085, 0x15e00086, + 0x15e00091, 0x15e000a8, 0x15e000b7, 0x15e000ba, + 0x15e000bb, 0x15e000be, 0x15e000bf, 0x15e000c3, + // Entry 140 - 15F + 0x15e000c8, 0x15e000c9, 0x15e000cc, 0x15e000d3, + 0x15e000d4, 0x15e000e5, 0x15e000ea, 0x15e00102, + 0x15e00107, 0x15e0010a, 0x15e00114, 0x15e0011c, + 0x15e00120, 0x15e00122, 0x15e00128, 0x15e0013f, + 0x15e00140, 0x15e0015f, 0x16900000, 0x1690009e, + 0x16d00000, 0x16d000d9, 0x16e00000, 0x16e00096, + 0x17e00000, 0x17e0007b, 0x19000000, 0x1900006e, + 0x1a300000, 0x1a30004e, 0x1a300078, 0x1a3000b2, + // Entry 160 - 17F + 0x1a400000, 0x1a400099, 0x1a900000, 0x1ab00000, + 0x1ab000a4, 0x1ac00000, 0x1ac00098, 0x1b400000, + 0x1b400080, 0x1b4000d4, 0x1b4000d6, 0x1b800000, + 0x1b800135, 0x1bc00000, 0x1bc00097, 0x1be00000, + 0x1be00099, 0x1d100000, 0x1d100033, 0x1d100090, + 0x1d200000, 0x1d200060, 0x1d500000, 0x1d500092, + 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100095, + 0x1e700000, 0x1e7000d6, 0x1ea00000, 0x1ea00053, + // Entry 180 - 19F + 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009d, + 0x1f900000, 0x1f90004e, 0x1f90009e, 0x1f900113, + 0x1f900138, 0x1fa00000, 0x1fb00000, 0x20000000, + 0x200000a2, 0x20300000, 0x20700000, 0x20700052, + 0x20800000, 0x20a00000, 0x20a0012f, 0x20e00000, + 0x20f00000, 0x21000000, 0x2100007d, 0x21200000, + 0x21200067, 0x21600000, 0x21700000, 0x217000a4, + 0x21f00000, 0x22300000, 0x2230012f, 0x22700000, + // Entry 1A0 - 1BF + 0x2270005a, 0x23400000, 0x234000c3, 0x23900000, + 0x239000a4, 0x24200000, 0x242000ae, 0x24400000, + 0x24400052, 0x24500000, 0x24500082, 0x24600000, + 0x246000a4, 0x24a00000, 0x24a000a6, 0x25100000, + 0x25100099, 0x25400000, 0x254000aa, 0x254000ab, + 0x25600000, 0x25600099, 0x26a00000, 0x26a00099, + 0x26b00000, 0x26b0012f, 0x26d00000, 0x26d00052, + 0x26e00000, 0x26e00060, 0x27400000, 0x28100000, + // Entry 1C0 - 1DF + 0x2810007b, 0x28a00000, 0x28a000a5, 0x29100000, + 0x2910012f, 0x29500000, 0x295000b7, 0x2a300000, + 0x2a300131, 0x2af00000, 0x2af00135, 0x2b500000, + 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d, + 0x2b800000, 0x2b8000af, 0x2bf00000, 0x2bf0009b, + 0x2bf0009c, 0x2c000000, 0x2c0000b6, 0x2c200000, + 0x2c20004b, 0x2c400000, 0x2c4000a4, 0x2c500000, + 0x2c5000a4, 0x2c700000, 0x2c7000b8, 0x2d100000, + // Entry 1E0 - 1FF + 0x2d1000a4, 0x2d10012f, 0x2e900000, 0x2e9000a4, + 0x2ed00000, 0x2ed000cc, 0x2f100000, 0x2f1000bf, + 0x2f200000, 0x2f2000d1, 0x2f400000, 0x2f400052, + 0x2ff00000, 0x2ff000c2, 0x30400000, 0x30400099, + 0x30b00000, 0x30b000c5, 0x31000000, 0x31b00000, + 0x31b00099, 0x31f00000, 0x31f0003e, 0x31f000d0, + 0x31f0010d, 0x32000000, 0x320000cb, 0x32500000, + 0x32500052, 0x33100000, 0x331000c4, 0x33a00000, + // Entry 200 - 21F + 0x33a0009c, 0x34100000, 0x34500000, 0x345000d2, + 0x34700000, 0x347000da, 0x34700110, 0x34e00000, + 0x34e00164, 0x35000000, 0x35000060, 0x350000d9, + 0x35100000, 0x35100099, 0x351000db, 0x36700000, + 0x36700030, 0x36700036, 0x36700040, 0x3670005b, + 0x367000d9, 0x36700116, 0x3670011b, 0x36800000, + 0x36800052, 0x36a00000, 0x36a000da, 0x36c00000, + 0x36c00052, 0x36f00000, 0x37500000, 0x37600000, + // Entry 220 - 23F + 0x37a00000, 0x38000000, 0x38000117, 0x38700000, + 0x38900000, 0x38900131, 0x39000000, 0x3900006f, + 0x390000a4, 0x39500000, 0x39500099, 0x39800000, + 0x3980007d, 0x39800106, 0x39d00000, 0x39d05000, + 0x39d050e8, 0x39d36000, 0x39d36099, 0x3a100000, + 0x3b300000, 0x3b3000e9, 0x3bd00000, 0x3bd00001, + 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a, + 0x3c000041, 0x3c00004e, 0x3c00005a, 0x3c000086, + // Entry 240 - 25F + 0x3c00008b, 0x3c0000b7, 0x3c0000c6, 0x3c0000d1, + 0x3c0000ee, 0x3c000118, 0x3c000126, 0x3c400000, + 0x3c40003f, 0x3c400069, 0x3c4000e4, 0x3d400000, + 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000, + 0x3dc000bc, 0x3dc00104, 0x3de00000, 0x3de0012f, + 0x3e200000, 0x3e200047, 0x3e2000a5, 0x3e2000ae, + 0x3e2000bc, 0x3e200106, 0x3e200130, 0x3e500000, + 0x3e500107, 0x3e600000, 0x3e60012f, 0x3eb00000, + // Entry 260 - 27F + 0x3eb00106, 0x3ec00000, 0x3ec000a4, 0x3f300000, + 0x3f30012f, 0x3fa00000, 0x3fa000e8, 0x3fc00000, + 0x3fd00000, 0x3fd00072, 0x3fd000da, 0x3fd0010c, + 0x3ff00000, 0x3ff000d1, 0x40100000, 0x401000c3, + 0x40200000, 0x4020004c, 0x40700000, 0x40800000, + 0x4085a000, 0x4085a0ba, 0x408e3000, 0x408e30ba, + 0x40c00000, 0x40c000b3, 0x41200000, 0x41200111, + 0x41600000, 0x4160010f, 0x41c00000, 0x41d00000, + // Entry 280 - 29F + 0x41e00000, 0x41f00000, 0x41f00072, 0x42200000, + 0x42300000, 0x42300164, 0x42900000, 0x42900062, + 0x4290006f, 0x429000a4, 0x42900115, 0x43100000, + 0x43100027, 0x431000c2, 0x4310014d, 0x43200000, + 0x43220000, 0x43220033, 0x432200bd, 0x43220105, + 0x4322014d, 0x4325a000, 0x4325a033, 0x4325a0bd, + 0x4325a105, 0x4325a14d, 0x43700000, 0x43a00000, + 0x43b00000, 0x44400000, 0x44400031, 0x44400072, + // Entry 2A0 - 2BF + 0x4440010c, 0x44500000, 0x4450004b, 0x445000a4, + 0x4450012f, 0x44500131, 0x44e00000, 0x45000000, + 0x45000099, 0x450000b3, 0x450000d0, 0x4500010d, + 0x46100000, 0x46100099, 0x46400000, 0x464000a4, + 0x46400131, 0x46700000, 0x46700124, 0x46b00000, + 0x46b00123, 0x46f00000, 0x46f0006d, 0x46f0006f, + 0x47100000, 0x47600000, 0x47600127, 0x47a00000, + 0x48000000, 0x48200000, 0x48200129, 0x48a00000, + // Entry 2C0 - 2DF + 0x48a0005d, 0x48a0012b, 0x48e00000, 0x49400000, + 0x49400106, 0x4a400000, 0x4a4000d4, 0x4a900000, + 0x4a9000ba, 0x4ac00000, 0x4ac00053, 0x4ae00000, + 0x4ae00130, 0x4b400000, 0x4b400099, 0x4b4000e8, + 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc20000, + 0x4bc20137, 0x4bc5a000, 0x4bc5a137, 0x4be00000, + 0x4be5a000, 0x4be5a0b4, 0x4beeb000, 0x4beeb0b4, + 0x4c000000, 0x4c300000, 0x4c30013e, 0x4c900000, + // Entry 2E0 - 2FF + 0x4c900001, 0x4cc00000, 0x4cc0012f, 0x4ce00000, + 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500114, + 0x4f200000, 0x4fb00000, 0x4fb00131, 0x50900000, + 0x50900052, 0x51200000, 0x51200001, 0x51800000, + 0x5180003b, 0x518000d6, 0x51f00000, 0x51f3b000, + 0x51f3b053, 0x51f3c000, 0x51f3c08d, 0x52800000, + 0x528000ba, 0x52900000, 0x5293b000, 0x5293b053, + 0x5293b08d, 0x5293b0c6, 0x5293b10d, 0x5293c000, + // Entry 300 - 31F + 0x5293c08d, 0x5293c0c6, 0x5293c12e, 0x52f00000, + 0x52f00161, +} // Size: 3116 bytes + +const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix" + +// Total table size 3147 bytes (3KiB); checksum: BE816D44 diff --git a/vendor/golang.org/x/text/internal/language/compact/tags.go b/vendor/golang.org/x/text/internal/language/compact/tags.go new file mode 100644 index 0000000..ca135d2 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/tags.go @@ -0,0 +1,91 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package compact + +var ( + und = Tag{} + + Und Tag = Tag{} + + Afrikaans Tag = Tag{language: afIndex, locale: afIndex} + Amharic Tag = Tag{language: amIndex, locale: amIndex} + Arabic Tag = Tag{language: arIndex, locale: arIndex} + ModernStandardArabic Tag = Tag{language: ar001Index, locale: ar001Index} + Azerbaijani Tag = Tag{language: azIndex, locale: azIndex} + Bulgarian Tag = Tag{language: bgIndex, locale: bgIndex} + Bengali Tag = Tag{language: bnIndex, locale: bnIndex} + Catalan Tag = Tag{language: caIndex, locale: caIndex} + Czech Tag = Tag{language: csIndex, locale: csIndex} + Danish Tag = Tag{language: daIndex, locale: daIndex} + German Tag = Tag{language: deIndex, locale: deIndex} + Greek Tag = Tag{language: elIndex, locale: elIndex} + English Tag = Tag{language: enIndex, locale: enIndex} + AmericanEnglish Tag = Tag{language: enUSIndex, locale: enUSIndex} + BritishEnglish Tag = Tag{language: enGBIndex, locale: enGBIndex} + Spanish Tag = Tag{language: esIndex, locale: esIndex} + EuropeanSpanish Tag = Tag{language: esESIndex, locale: esESIndex} + LatinAmericanSpanish Tag = Tag{language: es419Index, locale: es419Index} + Estonian Tag = Tag{language: etIndex, locale: etIndex} + Persian Tag = Tag{language: faIndex, locale: faIndex} + Finnish Tag = Tag{language: fiIndex, locale: fiIndex} + Filipino Tag = Tag{language: filIndex, locale: filIndex} + French Tag = Tag{language: frIndex, locale: frIndex} + CanadianFrench Tag = Tag{language: frCAIndex, locale: frCAIndex} + Gujarati Tag = Tag{language: guIndex, locale: guIndex} + Hebrew Tag = Tag{language: heIndex, locale: heIndex} + Hindi Tag = Tag{language: hiIndex, locale: hiIndex} + Croatian Tag = Tag{language: hrIndex, locale: hrIndex} + Hungarian Tag = Tag{language: huIndex, locale: huIndex} + Armenian Tag = Tag{language: hyIndex, locale: hyIndex} + Indonesian Tag = Tag{language: idIndex, locale: idIndex} + Icelandic Tag = Tag{language: isIndex, locale: isIndex} + Italian Tag = Tag{language: itIndex, locale: itIndex} + Japanese Tag = Tag{language: jaIndex, locale: jaIndex} + Georgian Tag = Tag{language: kaIndex, locale: kaIndex} + Kazakh Tag = Tag{language: kkIndex, locale: kkIndex} + Khmer Tag = Tag{language: kmIndex, locale: kmIndex} + Kannada Tag = Tag{language: knIndex, locale: knIndex} + Korean Tag = Tag{language: koIndex, locale: koIndex} + Kirghiz Tag = Tag{language: kyIndex, locale: kyIndex} + Lao Tag = Tag{language: loIndex, locale: loIndex} + Lithuanian Tag = Tag{language: ltIndex, locale: ltIndex} + Latvian Tag = Tag{language: lvIndex, locale: lvIndex} + Macedonian Tag = Tag{language: mkIndex, locale: mkIndex} + Malayalam Tag = Tag{language: mlIndex, locale: mlIndex} + Mongolian Tag = Tag{language: mnIndex, locale: mnIndex} + Marathi Tag = Tag{language: mrIndex, locale: mrIndex} + Malay Tag = Tag{language: msIndex, locale: msIndex} + Burmese Tag = Tag{language: myIndex, locale: myIndex} + Nepali Tag = Tag{language: neIndex, locale: neIndex} + Dutch Tag = Tag{language: nlIndex, locale: nlIndex} + Norwegian Tag = Tag{language: noIndex, locale: noIndex} + Punjabi Tag = Tag{language: paIndex, locale: paIndex} + Polish Tag = Tag{language: plIndex, locale: plIndex} + Portuguese Tag = Tag{language: ptIndex, locale: ptIndex} + BrazilianPortuguese Tag = Tag{language: ptBRIndex, locale: ptBRIndex} + EuropeanPortuguese Tag = Tag{language: ptPTIndex, locale: ptPTIndex} + Romanian Tag = Tag{language: roIndex, locale: roIndex} + Russian Tag = Tag{language: ruIndex, locale: ruIndex} + Sinhala Tag = Tag{language: siIndex, locale: siIndex} + Slovak Tag = Tag{language: skIndex, locale: skIndex} + Slovenian Tag = Tag{language: slIndex, locale: slIndex} + Albanian Tag = Tag{language: sqIndex, locale: sqIndex} + Serbian Tag = Tag{language: srIndex, locale: srIndex} + SerbianLatin Tag = Tag{language: srLatnIndex, locale: srLatnIndex} + Swedish Tag = Tag{language: svIndex, locale: svIndex} + Swahili Tag = Tag{language: swIndex, locale: swIndex} + Tamil Tag = Tag{language: taIndex, locale: taIndex} + Telugu Tag = Tag{language: teIndex, locale: teIndex} + Thai Tag = Tag{language: thIndex, locale: thIndex} + Turkish Tag = Tag{language: trIndex, locale: trIndex} + Ukrainian Tag = Tag{language: ukIndex, locale: ukIndex} + Urdu Tag = Tag{language: urIndex, locale: urIndex} + Uzbek Tag = Tag{language: uzIndex, locale: uzIndex} + Vietnamese Tag = Tag{language: viIndex, locale: viIndex} + Chinese Tag = Tag{language: zhIndex, locale: zhIndex} + SimplifiedChinese Tag = Tag{language: zhHansIndex, locale: zhHansIndex} + TraditionalChinese Tag = Tag{language: zhHantIndex, locale: zhHantIndex} + Zulu Tag = Tag{language: zuIndex, locale: zuIndex} +) diff --git a/vendor/golang.org/x/text/internal/language/compose.go b/vendor/golang.org/x/text/internal/language/compose.go new file mode 100644 index 0000000..4ae78e0 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compose.go @@ -0,0 +1,167 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "sort" + "strings" +) + +// A Builder allows constructing a Tag from individual components. +// Its main user is Compose in the top-level language package. +type Builder struct { + Tag Tag + + private string // the x extension + variants []string + extensions []string +} + +// Make returns a new Tag from the current settings. +func (b *Builder) Make() Tag { + t := b.Tag + + if len(b.extensions) > 0 || len(b.variants) > 0 { + sort.Sort(sortVariants(b.variants)) + sort.Strings(b.extensions) + + if b.private != "" { + b.extensions = append(b.extensions, b.private) + } + n := maxCoreSize + tokenLen(b.variants...) + tokenLen(b.extensions...) + buf := make([]byte, n) + p := t.genCoreBytes(buf) + t.pVariant = byte(p) + p += appendTokens(buf[p:], b.variants...) + t.pExt = uint16(p) + p += appendTokens(buf[p:], b.extensions...) + t.str = string(buf[:p]) + // We may not always need to remake the string, but when or when not + // to do so is rather tricky. + scan := makeScanner(buf[:p]) + t, _ = parse(&scan, "") + return t + + } else if b.private != "" { + t.str = b.private + t.RemakeString() + } + return t +} + +// SetTag copies all the settings from a given Tag. Any previously set values +// are discarded. +func (b *Builder) SetTag(t Tag) { + b.Tag.LangID = t.LangID + b.Tag.RegionID = t.RegionID + b.Tag.ScriptID = t.ScriptID + // TODO: optimize + b.variants = b.variants[:0] + if variants := t.Variants(); variants != "" { + for _, vr := range strings.Split(variants[1:], "-") { + b.variants = append(b.variants, vr) + } + } + b.extensions, b.private = b.extensions[:0], "" + for _, e := range t.Extensions() { + b.AddExt(e) + } +} + +// AddExt adds extension e to the tag. e must be a valid extension as returned +// by Tag.Extension. If the extension already exists, it will be discarded, +// except for a -u extension, where non-existing key-type pairs will added. +func (b *Builder) AddExt(e string) { + if e[0] == 'x' { + if b.private == "" { + b.private = e + } + return + } + for i, s := range b.extensions { + if s[0] == e[0] { + if e[0] == 'u' { + b.extensions[i] += e[1:] + } + return + } + } + b.extensions = append(b.extensions, e) +} + +// SetExt sets the extension e to the tag. e must be a valid extension as +// returned by Tag.Extension. If the extension already exists, it will be +// overwritten, except for a -u extension, where the individual key-type pairs +// will be set. +func (b *Builder) SetExt(e string) { + if e[0] == 'x' { + b.private = e + return + } + for i, s := range b.extensions { + if s[0] == e[0] { + if e[0] == 'u' { + b.extensions[i] = e + s[1:] + } else { + b.extensions[i] = e + } + return + } + } + b.extensions = append(b.extensions, e) +} + +// AddVariant adds any number of variants. +func (b *Builder) AddVariant(v ...string) { + for _, v := range v { + if v != "" { + b.variants = append(b.variants, v) + } + } +} + +// ClearVariants removes any variants previously added, including those +// copied from a Tag in SetTag. +func (b *Builder) ClearVariants() { + b.variants = b.variants[:0] +} + +// ClearExtensions removes any extensions previously added, including those +// copied from a Tag in SetTag. +func (b *Builder) ClearExtensions() { + b.private = "" + b.extensions = b.extensions[:0] +} + +func tokenLen(token ...string) (n int) { + for _, t := range token { + n += len(t) + 1 + } + return +} + +func appendTokens(b []byte, token ...string) int { + p := 0 + for _, t := range token { + b[p] = '-' + copy(b[p+1:], t) + p += 1 + len(t) + } + return p +} + +type sortVariants []string + +func (s sortVariants) Len() int { + return len(s) +} + +func (s sortVariants) Swap(i, j int) { + s[j], s[i] = s[i], s[j] +} + +func (s sortVariants) Less(i, j int) bool { + return variantIndex[s[i]] < variantIndex[s[j]] +} diff --git a/vendor/golang.org/x/text/internal/language/coverage.go b/vendor/golang.org/x/text/internal/language/coverage.go new file mode 100644 index 0000000..9b20b88 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/coverage.go @@ -0,0 +1,28 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// BaseLanguages returns the list of all supported base languages. It generates +// the list by traversing the internal structures. +func BaseLanguages() []Language { + base := make([]Language, 0, NumLanguages) + for i := 0; i < langNoIndexOffset; i++ { + // We included "und" already for the value 0. + if i != nonCanonicalUnd { + base = append(base, Language(i)) + } + } + i := langNoIndexOffset + for _, v := range langNoIndex { + for k := 0; k < 8; k++ { + if v&1 == 1 { + base = append(base, Language(i)) + } + v >>= 1 + i++ + } + } + return base +} diff --git a/vendor/golang.org/x/text/internal/language/language.go b/vendor/golang.org/x/text/internal/language/language.go new file mode 100644 index 0000000..6105bc7 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/language.go @@ -0,0 +1,627 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_common.go -output tables.go + +package language // import "golang.org/x/text/internal/language" + +// TODO: Remove above NOTE after: +// - verifying that tables are dropped correctly (most notably matcher tables). + +import ( + "errors" + "fmt" + "strings" +) + +const ( + // maxCoreSize is the maximum size of a BCP 47 tag without variants and + // extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes. + maxCoreSize = 12 + + // max99thPercentileSize is a somewhat arbitrary buffer size that presumably + // is large enough to hold at least 99% of the BCP 47 tags. + max99thPercentileSize = 32 + + // maxSimpleUExtensionSize is the maximum size of a -u extension with one + // key-type pair. Equals len("-u-") + key (2) + dash + max value (8). + maxSimpleUExtensionSize = 14 +) + +// Tag represents a BCP 47 language tag. It is used to specify an instance of a +// specific language or locale. All language tag values are guaranteed to be +// well-formed. The zero value of Tag is Und. +type Tag struct { + // TODO: the following fields have the form TagTypeID. This name is chosen + // to allow refactoring the public package without conflicting with its + // Base, Script, and Region methods. Once the transition is fully completed + // the ID can be stripped from the name. + + LangID Language + RegionID Region + // TODO: we will soon run out of positions for ScriptID. Idea: instead of + // storing lang, region, and ScriptID codes, store only the compact index and + // have a lookup table from this code to its expansion. This greatly speeds + // up table lookup, speed up common variant cases. + // This will also immediately free up 3 extra bytes. Also, the pVariant + // field can now be moved to the lookup table, as the compact index uniquely + // determines the offset of a possible variant. + ScriptID Script + pVariant byte // offset in str, includes preceding '-' + pExt uint16 // offset of first extension, includes preceding '-' + + // str is the string representation of the Tag. It will only be used if the + // tag has variants or extensions. + str string +} + +// Make is a convenience wrapper for Parse that omits the error. +// In case of an error, a sensible default is returned. +func Make(s string) Tag { + t, _ := Parse(s) + return t +} + +// Raw returns the raw base language, script and region, without making an +// attempt to infer their values. +// TODO: consider removing +func (t Tag) Raw() (b Language, s Script, r Region) { + return t.LangID, t.ScriptID, t.RegionID +} + +// equalTags compares language, script and region subtags only. +func (t Tag) equalTags(a Tag) bool { + return t.LangID == a.LangID && t.ScriptID == a.ScriptID && t.RegionID == a.RegionID +} + +// IsRoot returns true if t is equal to language "und". +func (t Tag) IsRoot() bool { + if int(t.pVariant) < len(t.str) { + return false + } + return t.equalTags(Und) +} + +// IsPrivateUse reports whether the Tag consists solely of an IsPrivateUse use +// tag. +func (t Tag) IsPrivateUse() bool { + return t.str != "" && t.pVariant == 0 +} + +// RemakeString is used to update t.str in case lang, script or region changed. +// It is assumed that pExt and pVariant still point to the start of the +// respective parts. +func (t *Tag) RemakeString() { + if t.str == "" { + return + } + extra := t.str[t.pVariant:] + if t.pVariant > 0 { + extra = extra[1:] + } + if t.equalTags(Und) && strings.HasPrefix(extra, "x-") { + t.str = extra + t.pVariant = 0 + t.pExt = 0 + return + } + var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases. + b := buf[:t.genCoreBytes(buf[:])] + if extra != "" { + diff := len(b) - int(t.pVariant) + b = append(b, '-') + b = append(b, extra...) + t.pVariant = uint8(int(t.pVariant) + diff) + t.pExt = uint16(int(t.pExt) + diff) + } else { + t.pVariant = uint8(len(b)) + t.pExt = uint16(len(b)) + } + t.str = string(b) +} + +// genCoreBytes writes a string for the base languages, script and region tags +// to the given buffer and returns the number of bytes written. It will never +// write more than maxCoreSize bytes. +func (t *Tag) genCoreBytes(buf []byte) int { + n := t.LangID.StringToBuf(buf[:]) + if t.ScriptID != 0 { + n += copy(buf[n:], "-") + n += copy(buf[n:], t.ScriptID.String()) + } + if t.RegionID != 0 { + n += copy(buf[n:], "-") + n += copy(buf[n:], t.RegionID.String()) + } + return n +} + +// String returns the canonical string representation of the language tag. +func (t Tag) String() string { + if t.str != "" { + return t.str + } + if t.ScriptID == 0 && t.RegionID == 0 { + return t.LangID.String() + } + buf := [maxCoreSize]byte{} + return string(buf[:t.genCoreBytes(buf[:])]) +} + +// MarshalText implements encoding.TextMarshaler. +func (t Tag) MarshalText() (text []byte, err error) { + if t.str != "" { + text = append(text, t.str...) + } else if t.ScriptID == 0 && t.RegionID == 0 { + text = append(text, t.LangID.String()...) + } else { + buf := [maxCoreSize]byte{} + text = buf[:t.genCoreBytes(buf[:])] + } + return text, nil +} + +// UnmarshalText implements encoding.TextUnmarshaler. +func (t *Tag) UnmarshalText(text []byte) error { + tag, err := Parse(string(text)) + *t = tag + return err +} + +// Variants returns the part of the tag holding all variants or the empty string +// if there are no variants defined. +func (t Tag) Variants() string { + if t.pVariant == 0 { + return "" + } + return t.str[t.pVariant:t.pExt] +} + +// VariantOrPrivateUseTags returns variants or private use tags. +func (t Tag) VariantOrPrivateUseTags() string { + if t.pExt > 0 { + return t.str[t.pVariant:t.pExt] + } + return t.str[t.pVariant:] +} + +// HasString reports whether this tag defines more than just the raw +// components. +func (t Tag) HasString() bool { + return t.str != "" +} + +// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a +// specific language are substituted with fields from the parent language. +// The parent for a language may change for newer versions of CLDR. +func (t Tag) Parent() Tag { + if t.str != "" { + // Strip the variants and extensions. + b, s, r := t.Raw() + t = Tag{LangID: b, ScriptID: s, RegionID: r} + if t.RegionID == 0 && t.ScriptID != 0 && t.LangID != 0 { + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID == t.ScriptID { + return Tag{LangID: t.LangID} + } + } + return t + } + if t.LangID != 0 { + if t.RegionID != 0 { + maxScript := t.ScriptID + if maxScript == 0 { + max, _ := addTags(t) + maxScript = max.ScriptID + } + + for i := range parents { + if Language(parents[i].lang) == t.LangID && Script(parents[i].maxScript) == maxScript { + for _, r := range parents[i].fromRegion { + if Region(r) == t.RegionID { + return Tag{ + LangID: t.LangID, + ScriptID: Script(parents[i].script), + RegionID: Region(parents[i].toRegion), + } + } + } + } + } + + // Strip the script if it is the default one. + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID != maxScript { + return Tag{LangID: t.LangID, ScriptID: maxScript} + } + return Tag{LangID: t.LangID} + } else if t.ScriptID != 0 { + // The parent for an base-script pair with a non-default script is + // "und" instead of the base language. + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID != t.ScriptID { + return Und + } + return Tag{LangID: t.LangID} + } + } + return Und +} + +// ParseExtension parses s as an extension and returns it on success. +func ParseExtension(s string) (ext string, err error) { + defer func() { + if recover() != nil { + ext = "" + err = ErrSyntax + } + }() + + scan := makeScannerString(s) + var end int + if n := len(scan.token); n != 1 { + return "", ErrSyntax + } + scan.toLower(0, len(scan.b)) + end = parseExtension(&scan) + if end != len(s) { + return "", ErrSyntax + } + return string(scan.b), nil +} + +// HasVariants reports whether t has variants. +func (t Tag) HasVariants() bool { + return uint16(t.pVariant) < t.pExt +} + +// HasExtensions reports whether t has extensions. +func (t Tag) HasExtensions() bool { + return int(t.pExt) < len(t.str) +} + +// Extension returns the extension of type x for tag t. It will return +// false for ok if t does not have the requested extension. The returned +// extension will be invalid in this case. +func (t Tag) Extension(x byte) (ext string, ok bool) { + for i := int(t.pExt); i < len(t.str)-1; { + var ext string + i, ext = getExtension(t.str, i) + if ext[0] == x { + return ext, true + } + } + return "", false +} + +// Extensions returns all extensions of t. +func (t Tag) Extensions() []string { + e := []string{} + for i := int(t.pExt); i < len(t.str)-1; { + var ext string + i, ext = getExtension(t.str, i) + e = append(e, ext) + } + return e +} + +// TypeForKey returns the type associated with the given key, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// TypeForKey will traverse the inheritance chain to get the correct value. +// +// If there are multiple types associated with a key, only the first will be +// returned. If there is no type associated with a key, it returns the empty +// string. +func (t Tag) TypeForKey(key string) string { + if _, start, end, _ := t.findTypeForKey(key); end != start { + s := t.str[start:end] + if p := strings.IndexByte(s, '-'); p >= 0 { + s = s[:p] + } + return s + } + return "" +} + +var ( + errPrivateUse = errors.New("cannot set a key on a private use tag") + errInvalidArguments = errors.New("invalid key or type") +) + +// SetTypeForKey returns a new Tag with the key set to type, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// An empty value removes an existing pair with the same key. +func (t Tag) SetTypeForKey(key, value string) (Tag, error) { + if t.IsPrivateUse() { + return t, errPrivateUse + } + if len(key) != 2 { + return t, errInvalidArguments + } + + // Remove the setting if value is "". + if value == "" { + start, sep, end, _ := t.findTypeForKey(key) + if start != sep { + // Remove a possible empty extension. + switch { + case t.str[start-2] != '-': // has previous elements. + case end == len(t.str), // end of string + end+2 < len(t.str) && t.str[end+2] == '-': // end of extension + start -= 2 + } + if start == int(t.pVariant) && end == len(t.str) { + t.str = "" + t.pVariant, t.pExt = 0, 0 + } else { + t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:]) + } + } + return t, nil + } + + if len(value) < 3 || len(value) > 8 { + return t, errInvalidArguments + } + + var ( + buf [maxCoreSize + maxSimpleUExtensionSize]byte + uStart int // start of the -u extension. + ) + + // Generate the tag string if needed. + if t.str == "" { + uStart = t.genCoreBytes(buf[:]) + buf[uStart] = '-' + uStart++ + } + + // Create new key-type pair and parse it to verify. + b := buf[uStart:] + copy(b, "u-") + copy(b[2:], key) + b[4] = '-' + b = b[:5+copy(b[5:], value)] + scan := makeScanner(b) + if parseExtensions(&scan); scan.err != nil { + return t, scan.err + } + + // Assemble the replacement string. + if t.str == "" { + t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1) + t.str = string(buf[:uStart+len(b)]) + } else { + s := t.str + start, sep, end, hasExt := t.findTypeForKey(key) + if start == sep { + if hasExt { + b = b[2:] + } + t.str = fmt.Sprintf("%s-%s%s", s[:sep], b, s[end:]) + } else { + t.str = fmt.Sprintf("%s-%s%s", s[:start+3], value, s[end:]) + } + } + return t, nil +} + +// findKeyAndType returns the start and end position for the type corresponding +// to key or the point at which to insert the key-value pair if the type +// wasn't found. The hasExt return value reports whether an -u extension was present. +// Note: the extensions are typically very small and are likely to contain +// only one key-type pair. +func (t Tag) findTypeForKey(key string) (start, sep, end int, hasExt bool) { + p := int(t.pExt) + if len(key) != 2 || p == len(t.str) || p == 0 { + return p, p, p, false + } + s := t.str + + // Find the correct extension. + for p++; s[p] != 'u'; p++ { + if s[p] > 'u' { + p-- + return p, p, p, false + } + if p = nextExtension(s, p); p == len(s) { + return len(s), len(s), len(s), false + } + } + // Proceed to the hyphen following the extension name. + p++ + + // curKey is the key currently being processed. + curKey := "" + + // Iterate over keys until we get the end of a section. + for { + end = p + for p++; p < len(s) && s[p] != '-'; p++ { + } + n := p - end - 1 + if n <= 2 && curKey == key { + if sep < end { + sep++ + } + return start, sep, end, true + } + switch n { + case 0, // invalid string + 1: // next extension + return end, end, end, true + case 2: + // next key + curKey = s[end+1 : p] + if curKey > key { + return end, end, end, true + } + start = end + sep = p + } + } +} + +// ParseBase parses a 2- or 3-letter ISO 639 code. +// It returns a ValueError if s is a well-formed but unknown language identifier +// or another error if another error occurred. +func ParseBase(s string) (l Language, err error) { + defer func() { + if recover() != nil { + l = 0 + err = ErrSyntax + } + }() + + if n := len(s); n < 2 || 3 < n { + return 0, ErrSyntax + } + var buf [3]byte + return getLangID(buf[:copy(buf[:], s)]) +} + +// ParseScript parses a 4-letter ISO 15924 code. +// It returns a ValueError if s is a well-formed but unknown script identifier +// or another error if another error occurred. +func ParseScript(s string) (scr Script, err error) { + defer func() { + if recover() != nil { + scr = 0 + err = ErrSyntax + } + }() + + if len(s) != 4 { + return 0, ErrSyntax + } + var buf [4]byte + return getScriptID(script, buf[:copy(buf[:], s)]) +} + +// EncodeM49 returns the Region for the given UN M.49 code. +// It returns an error if r is not a valid code. +func EncodeM49(r int) (Region, error) { + return getRegionM49(r) +} + +// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code. +// It returns a ValueError if s is a well-formed but unknown region identifier +// or another error if another error occurred. +func ParseRegion(s string) (r Region, err error) { + defer func() { + if recover() != nil { + r = 0 + err = ErrSyntax + } + }() + + if n := len(s); n < 2 || 3 < n { + return 0, ErrSyntax + } + var buf [3]byte + return getRegionID(buf[:copy(buf[:], s)]) +} + +// IsCountry returns whether this region is a country or autonomous area. This +// includes non-standard definitions from CLDR. +func (r Region) IsCountry() bool { + if r == 0 || r.IsGroup() || r.IsPrivateUse() && r != _XK { + return false + } + return true +} + +// IsGroup returns whether this region defines a collection of regions. This +// includes non-standard definitions from CLDR. +func (r Region) IsGroup() bool { + if r == 0 { + return false + } + return int(regionInclusion[r]) < len(regionContainment) +} + +// Contains returns whether Region c is contained by Region r. It returns true +// if c == r. +func (r Region) Contains(c Region) bool { + if r == c { + return true + } + g := regionInclusion[r] + if g >= nRegionGroups { + return false + } + m := regionContainment[g] + + d := regionInclusion[c] + b := regionInclusionBits[d] + + // A contained country may belong to multiple disjoint groups. Matching any + // of these indicates containment. If the contained region is a group, it + // must strictly be a subset. + if d >= nRegionGroups { + return b&m != 0 + } + return b&^m == 0 +} + +var errNoTLD = errors.New("language: region is not a valid ccTLD") + +// TLD returns the country code top-level domain (ccTLD). UK is returned for GB. +// In all other cases it returns either the region itself or an error. +// +// This method may return an error for a region for which there exists a +// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The +// region will already be canonicalized it was obtained from a Tag that was +// obtained using any of the default methods. +func (r Region) TLD() (Region, error) { + // See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the + // difference between ISO 3166-1 and IANA ccTLD. + if r == _GB { + r = _UK + } + if (r.typ() & ccTLD) == 0 { + return 0, errNoTLD + } + return r, nil +} + +// Canonicalize returns the region or a possible replacement if the region is +// deprecated. It will not return a replacement for deprecated regions that +// are split into multiple regions. +func (r Region) Canonicalize() Region { + if cr := normRegion(r); cr != 0 { + return cr + } + return r +} + +// Variant represents a registered variant of a language as defined by BCP 47. +type Variant struct { + ID uint8 + str string +} + +// ParseVariant parses and returns a Variant. An error is returned if s is not +// a valid variant. +func ParseVariant(s string) (v Variant, err error) { + defer func() { + if recover() != nil { + v = Variant{} + err = ErrSyntax + } + }() + + s = strings.ToLower(s) + if id, ok := variantIndex[s]; ok { + return Variant{id, s}, nil + } + return Variant{}, NewValueError([]byte(s)) +} + +// String returns the string representation of the variant. +func (v Variant) String() string { + return v.str +} diff --git a/vendor/golang.org/x/text/internal/language/lookup.go b/vendor/golang.org/x/text/internal/language/lookup.go new file mode 100644 index 0000000..6294b81 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/lookup.go @@ -0,0 +1,412 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "bytes" + "fmt" + "sort" + "strconv" + + "golang.org/x/text/internal/tag" +) + +// findIndex tries to find the given tag in idx and returns a standardized error +// if it could not be found. +func findIndex(idx tag.Index, key []byte, form string) (index int, err error) { + if !tag.FixCase(form, key) { + return 0, ErrSyntax + } + i := idx.Index(key) + if i == -1 { + return 0, NewValueError(key) + } + return i, nil +} + +func searchUint(imap []uint16, key uint16) int { + return sort.Search(len(imap), func(i int) bool { + return imap[i] >= key + }) +} + +type Language uint16 + +// getLangID returns the langID of s if s is a canonical subtag +// or langUnknown if s is not a canonical subtag. +func getLangID(s []byte) (Language, error) { + if len(s) == 2 { + return getLangISO2(s) + } + return getLangISO3(s) +} + +// TODO language normalization as well as the AliasMaps could be moved to the +// higher level package, but it is a bit tricky to separate the generation. + +func (id Language) Canonicalize() (Language, AliasType) { + return normLang(id) +} + +// mapLang returns the mapped langID of id according to mapping m. +func normLang(id Language) (Language, AliasType) { + k := sort.Search(len(AliasMap), func(i int) bool { + return AliasMap[i].From >= uint16(id) + }) + if k < len(AliasMap) && AliasMap[k].From == uint16(id) { + return Language(AliasMap[k].To), AliasTypes[k] + } + return id, AliasTypeUnknown +} + +// getLangISO2 returns the langID for the given 2-letter ISO language code +// or unknownLang if this does not exist. +func getLangISO2(s []byte) (Language, error) { + if !tag.FixCase("zz", s) { + return 0, ErrSyntax + } + if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 { + return Language(i), nil + } + return 0, NewValueError(s) +} + +const base = 'z' - 'a' + 1 + +func strToInt(s []byte) uint { + v := uint(0) + for i := 0; i < len(s); i++ { + v *= base + v += uint(s[i] - 'a') + } + return v +} + +// converts the given integer to the original ASCII string passed to strToInt. +// len(s) must match the number of characters obtained. +func intToStr(v uint, s []byte) { + for i := len(s) - 1; i >= 0; i-- { + s[i] = byte(v%base) + 'a' + v /= base + } +} + +// getLangISO3 returns the langID for the given 3-letter ISO language code +// or unknownLang if this does not exist. +func getLangISO3(s []byte) (Language, error) { + if tag.FixCase("und", s) { + // first try to match canonical 3-letter entries + for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) { + if e := lang.Elem(i); e[3] == 0 && e[2] == s[2] { + // We treat "und" as special and always translate it to "unspecified". + // Note that ZZ and Zzzz are private use and are not treated as + // unspecified by default. + id := Language(i) + if id == nonCanonicalUnd { + return 0, nil + } + return id, nil + } + } + if i := altLangISO3.Index(s); i != -1 { + return Language(altLangIndex[altLangISO3.Elem(i)[3]]), nil + } + n := strToInt(s) + if langNoIndex[n/8]&(1<<(n%8)) != 0 { + return Language(n) + langNoIndexOffset, nil + } + // Check for non-canonical uses of ISO3. + for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) { + if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] { + return Language(i), nil + } + } + return 0, NewValueError(s) + } + return 0, ErrSyntax +} + +// StringToBuf writes the string to b and returns the number of bytes +// written. cap(b) must be >= 3. +func (id Language) StringToBuf(b []byte) int { + if id >= langNoIndexOffset { + intToStr(uint(id)-langNoIndexOffset, b[:3]) + return 3 + } else if id == 0 { + return copy(b, "und") + } + l := lang[id<<2:] + if l[3] == 0 { + return copy(b, l[:3]) + } + return copy(b, l[:2]) +} + +// String returns the BCP 47 representation of the langID. +// Use b as variable name, instead of id, to ensure the variable +// used is consistent with that of Base in which this type is embedded. +func (b Language) String() string { + if b == 0 { + return "und" + } else if b >= langNoIndexOffset { + b -= langNoIndexOffset + buf := [3]byte{} + intToStr(uint(b), buf[:]) + return string(buf[:]) + } + l := lang.Elem(int(b)) + if l[3] == 0 { + return l[:3] + } + return l[:2] +} + +// ISO3 returns the ISO 639-3 language code. +func (b Language) ISO3() string { + if b == 0 || b >= langNoIndexOffset { + return b.String() + } + l := lang.Elem(int(b)) + if l[3] == 0 { + return l[:3] + } else if l[2] == 0 { + return altLangISO3.Elem(int(l[3]))[:3] + } + // This allocation will only happen for 3-letter ISO codes + // that are non-canonical BCP 47 language identifiers. + return l[0:1] + l[2:4] +} + +// IsPrivateUse reports whether this language code is reserved for private use. +func (b Language) IsPrivateUse() bool { + return langPrivateStart <= b && b <= langPrivateEnd +} + +// SuppressScript returns the script marked as SuppressScript in the IANA +// language tag repository, or 0 if there is no such script. +func (b Language) SuppressScript() Script { + if b < langNoIndexOffset { + return Script(suppressScript[b]) + } + return 0 +} + +type Region uint16 + +// getRegionID returns the region id for s if s is a valid 2-letter region code +// or unknownRegion. +func getRegionID(s []byte) (Region, error) { + if len(s) == 3 { + if isAlpha(s[0]) { + return getRegionISO3(s) + } + if i, err := strconv.ParseUint(string(s), 10, 10); err == nil { + return getRegionM49(int(i)) + } + } + return getRegionISO2(s) +} + +// getRegionISO2 returns the regionID for the given 2-letter ISO country code +// or unknownRegion if this does not exist. +func getRegionISO2(s []byte) (Region, error) { + i, err := findIndex(regionISO, s, "ZZ") + if err != nil { + return 0, err + } + return Region(i) + isoRegionOffset, nil +} + +// getRegionISO3 returns the regionID for the given 3-letter ISO country code +// or unknownRegion if this does not exist. +func getRegionISO3(s []byte) (Region, error) { + if tag.FixCase("ZZZ", s) { + for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) { + if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] { + return Region(i) + isoRegionOffset, nil + } + } + for i := 0; i < len(altRegionISO3); i += 3 { + if tag.Compare(altRegionISO3[i:i+3], s) == 0 { + return Region(altRegionIDs[i/3]), nil + } + } + return 0, NewValueError(s) + } + return 0, ErrSyntax +} + +func getRegionM49(n int) (Region, error) { + if 0 < n && n <= 999 { + const ( + searchBits = 7 + regionBits = 9 + regionMask = 1<> searchBits + buf := fromM49[m49Index[idx]:m49Index[idx+1]] + val := uint16(n) << regionBits // we rely on bits shifting out + i := sort.Search(len(buf), func(i int) bool { + return buf[i] >= val + }) + if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val { + return Region(r & regionMask), nil + } + } + var e ValueError + fmt.Fprint(bytes.NewBuffer([]byte(e.v[:])), n) + return 0, e +} + +// normRegion returns a region if r is deprecated or 0 otherwise. +// TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ). +// TODO: consider mapping split up regions to new most populous one (like CLDR). +func normRegion(r Region) Region { + m := regionOldMap + k := sort.Search(len(m), func(i int) bool { + return m[i].From >= uint16(r) + }) + if k < len(m) && m[k].From == uint16(r) { + return Region(m[k].To) + } + return 0 +} + +const ( + iso3166UserAssigned = 1 << iota + ccTLD + bcp47Region +) + +func (r Region) typ() byte { + return regionTypes[r] +} + +// String returns the BCP 47 representation for the region. +// It returns "ZZ" for an unspecified region. +func (r Region) String() string { + if r < isoRegionOffset { + if r == 0 { + return "ZZ" + } + return fmt.Sprintf("%03d", r.M49()) + } + r -= isoRegionOffset + return regionISO.Elem(int(r))[:2] +} + +// ISO3 returns the 3-letter ISO code of r. +// Note that not all regions have a 3-letter ISO code. +// In such cases this method returns "ZZZ". +func (r Region) ISO3() string { + if r < isoRegionOffset { + return "ZZZ" + } + r -= isoRegionOffset + reg := regionISO.Elem(int(r)) + switch reg[2] { + case 0: + return altRegionISO3[reg[3]:][:3] + case ' ': + return "ZZZ" + } + return reg[0:1] + reg[2:4] +} + +// M49 returns the UN M.49 encoding of r, or 0 if this encoding +// is not defined for r. +func (r Region) M49() int { + return int(m49[r]) +} + +// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This +// may include private-use tags that are assigned by CLDR and used in this +// implementation. So IsPrivateUse and IsCountry can be simultaneously true. +func (r Region) IsPrivateUse() bool { + return r.typ()&iso3166UserAssigned != 0 +} + +type Script uint8 + +// getScriptID returns the script id for string s. It assumes that s +// is of the format [A-Z][a-z]{3}. +func getScriptID(idx tag.Index, s []byte) (Script, error) { + i, err := findIndex(idx, s, "Zzzz") + return Script(i), err +} + +// String returns the script code in title case. +// It returns "Zzzz" for an unspecified script. +func (s Script) String() string { + if s == 0 { + return "Zzzz" + } + return script.Elem(int(s)) +} + +// IsPrivateUse reports whether this script code is reserved for private use. +func (s Script) IsPrivateUse() bool { + return _Qaaa <= s && s <= _Qabx +} + +const ( + maxAltTaglen = len("en-US-POSIX") + maxLen = maxAltTaglen +) + +var ( + // grandfatheredMap holds a mapping from legacy and grandfathered tags to + // their base language or index to more elaborate tag. + grandfatheredMap = map[[maxLen]byte]int16{ + [maxLen]byte{'a', 'r', 't', '-', 'l', 'o', 'j', 'b', 'a', 'n'}: _jbo, // art-lojban + [maxLen]byte{'i', '-', 'a', 'm', 'i'}: _ami, // i-ami + [maxLen]byte{'i', '-', 'b', 'n', 'n'}: _bnn, // i-bnn + [maxLen]byte{'i', '-', 'h', 'a', 'k'}: _hak, // i-hak + [maxLen]byte{'i', '-', 'k', 'l', 'i', 'n', 'g', 'o', 'n'}: _tlh, // i-klingon + [maxLen]byte{'i', '-', 'l', 'u', 'x'}: _lb, // i-lux + [maxLen]byte{'i', '-', 'n', 'a', 'v', 'a', 'j', 'o'}: _nv, // i-navajo + [maxLen]byte{'i', '-', 'p', 'w', 'n'}: _pwn, // i-pwn + [maxLen]byte{'i', '-', 't', 'a', 'o'}: _tao, // i-tao + [maxLen]byte{'i', '-', 't', 'a', 'y'}: _tay, // i-tay + [maxLen]byte{'i', '-', 't', 's', 'u'}: _tsu, // i-tsu + [maxLen]byte{'n', 'o', '-', 'b', 'o', 'k'}: _nb, // no-bok + [maxLen]byte{'n', 'o', '-', 'n', 'y', 'n'}: _nn, // no-nyn + [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'f', 'r'}: _sfb, // sgn-BE-FR + [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'n', 'l'}: _vgt, // sgn-BE-NL + [maxLen]byte{'s', 'g', 'n', '-', 'c', 'h', '-', 'd', 'e'}: _sgg, // sgn-CH-DE + [maxLen]byte{'z', 'h', '-', 'g', 'u', 'o', 'y', 'u'}: _cmn, // zh-guoyu + [maxLen]byte{'z', 'h', '-', 'h', 'a', 'k', 'k', 'a'}: _hak, // zh-hakka + [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n', '-', 'n', 'a', 'n'}: _nan, // zh-min-nan + [maxLen]byte{'z', 'h', '-', 'x', 'i', 'a', 'n', 'g'}: _hsn, // zh-xiang + + // Grandfathered tags with no modern replacement will be converted as + // follows: + [maxLen]byte{'c', 'e', 'l', '-', 'g', 'a', 'u', 'l', 'i', 's', 'h'}: -1, // cel-gaulish + [maxLen]byte{'e', 'n', '-', 'g', 'b', '-', 'o', 'e', 'd'}: -2, // en-GB-oed + [maxLen]byte{'i', '-', 'd', 'e', 'f', 'a', 'u', 'l', 't'}: -3, // i-default + [maxLen]byte{'i', '-', 'e', 'n', 'o', 'c', 'h', 'i', 'a', 'n'}: -4, // i-enochian + [maxLen]byte{'i', '-', 'm', 'i', 'n', 'g', 'o'}: -5, // i-mingo + [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n'}: -6, // zh-min + + // CLDR-specific tag. + [maxLen]byte{'r', 'o', 'o', 't'}: 0, // root + [maxLen]byte{'e', 'n', '-', 'u', 's', '-', 'p', 'o', 's', 'i', 'x'}: -7, // en_US_POSIX" + } + + altTagIndex = [...]uint8{0, 17, 31, 45, 61, 74, 86, 102} + + altTags = "xtg-x-cel-gaulishen-GB-oxendicten-x-i-defaultund-x-i-enochiansee-x-i-mingonan-x-zh-minen-US-u-va-posix" +) + +func grandfathered(s [maxAltTaglen]byte) (t Tag, ok bool) { + if v, ok := grandfatheredMap[s]; ok { + if v < 0 { + return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true + } + t.LangID = Language(v) + return t, true + } + return t, false +} diff --git a/vendor/golang.org/x/text/internal/language/match.go b/vendor/golang.org/x/text/internal/language/match.go new file mode 100644 index 0000000..75a2dbc --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/match.go @@ -0,0 +1,226 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import "errors" + +type scriptRegionFlags uint8 + +const ( + isList = 1 << iota + scriptInFrom + regionInFrom +) + +func (t *Tag) setUndefinedLang(id Language) { + if t.LangID == 0 { + t.LangID = id + } +} + +func (t *Tag) setUndefinedScript(id Script) { + if t.ScriptID == 0 { + t.ScriptID = id + } +} + +func (t *Tag) setUndefinedRegion(id Region) { + if t.RegionID == 0 || t.RegionID.Contains(id) { + t.RegionID = id + } +} + +// ErrMissingLikelyTagsData indicates no information was available +// to compute likely values of missing tags. +var ErrMissingLikelyTagsData = errors.New("missing likely tags data") + +// addLikelySubtags sets subtags to their most likely value, given the locale. +// In most cases this means setting fields for unknown values, but in some +// cases it may alter a value. It returns an ErrMissingLikelyTagsData error +// if the given locale cannot be expanded. +func (t Tag) addLikelySubtags() (Tag, error) { + id, err := addTags(t) + if err != nil { + return t, err + } else if id.equalTags(t) { + return t, nil + } + id.RemakeString() + return id, nil +} + +// specializeRegion attempts to specialize a group region. +func specializeRegion(t *Tag) bool { + if i := regionInclusion[t.RegionID]; i < nRegionGroups { + x := likelyRegionGroup[i] + if Language(x.lang) == t.LangID && Script(x.script) == t.ScriptID { + t.RegionID = Region(x.region) + } + return true + } + return false +} + +// Maximize returns a new tag with missing tags filled in. +func (t Tag) Maximize() (Tag, error) { + return addTags(t) +} + +func addTags(t Tag) (Tag, error) { + // We leave private use identifiers alone. + if t.IsPrivateUse() { + return t, nil + } + if t.ScriptID != 0 && t.RegionID != 0 { + if t.LangID != 0 { + // already fully specified + specializeRegion(&t) + return t, nil + } + // Search matches for und-script-region. Note that for these cases + // region will never be a group so there is no need to check for this. + list := likelyRegion[t.RegionID : t.RegionID+1] + if x := list[0]; x.flags&isList != 0 { + list = likelyRegionList[x.lang : x.lang+uint16(x.script)] + } + for _, x := range list { + // Deviating from the spec. See match_test.go for details. + if Script(x.script) == t.ScriptID { + t.setUndefinedLang(Language(x.lang)) + return t, nil + } + } + } + if t.LangID != 0 { + // Search matches for lang-script and lang-region, where lang != und. + if t.LangID < langNoIndexOffset { + x := likelyLang[t.LangID] + if x.flags&isList != 0 { + list := likelyLangList[x.region : x.region+uint16(x.script)] + if t.ScriptID != 0 { + for _, x := range list { + if Script(x.script) == t.ScriptID && x.flags&scriptInFrom != 0 { + t.setUndefinedRegion(Region(x.region)) + return t, nil + } + } + } else if t.RegionID != 0 { + count := 0 + goodScript := true + tt := t + for _, x := range list { + // We visit all entries for which the script was not + // defined, including the ones where the region was not + // defined. This allows for proper disambiguation within + // regions. + if x.flags&scriptInFrom == 0 && t.RegionID.Contains(Region(x.region)) { + tt.RegionID = Region(x.region) + tt.setUndefinedScript(Script(x.script)) + goodScript = goodScript && tt.ScriptID == Script(x.script) + count++ + } + } + if count == 1 { + return tt, nil + } + // Even if we fail to find a unique Region, we might have + // an unambiguous script. + if goodScript { + t.ScriptID = tt.ScriptID + } + } + } + } + } else { + // Search matches for und-script. + if t.ScriptID != 0 { + x := likelyScript[t.ScriptID] + if x.region != 0 { + t.setUndefinedRegion(Region(x.region)) + t.setUndefinedLang(Language(x.lang)) + return t, nil + } + } + // Search matches for und-region. If und-script-region exists, it would + // have been found earlier. + if t.RegionID != 0 { + if i := regionInclusion[t.RegionID]; i < nRegionGroups { + x := likelyRegionGroup[i] + if x.region != 0 { + t.setUndefinedLang(Language(x.lang)) + t.setUndefinedScript(Script(x.script)) + t.RegionID = Region(x.region) + } + } else { + x := likelyRegion[t.RegionID] + if x.flags&isList != 0 { + x = likelyRegionList[x.lang] + } + if x.script != 0 && x.flags != scriptInFrom { + t.setUndefinedLang(Language(x.lang)) + t.setUndefinedScript(Script(x.script)) + return t, nil + } + } + } + } + + // Search matches for lang. + if t.LangID < langNoIndexOffset { + x := likelyLang[t.LangID] + if x.flags&isList != 0 { + x = likelyLangList[x.region] + } + if x.region != 0 { + t.setUndefinedScript(Script(x.script)) + t.setUndefinedRegion(Region(x.region)) + } + specializeRegion(&t) + if t.LangID == 0 { + t.LangID = _en // default language + } + return t, nil + } + return t, ErrMissingLikelyTagsData +} + +func (t *Tag) setTagsFrom(id Tag) { + t.LangID = id.LangID + t.ScriptID = id.ScriptID + t.RegionID = id.RegionID +} + +// minimize removes the region or script subtags from t such that +// t.addLikelySubtags() == t.minimize().addLikelySubtags(). +func (t Tag) minimize() (Tag, error) { + t, err := minimizeTags(t) + if err != nil { + return t, err + } + t.RemakeString() + return t, nil +} + +// minimizeTags mimics the behavior of the ICU 51 C implementation. +func minimizeTags(t Tag) (Tag, error) { + if t.equalTags(Und) { + return t, nil + } + max, err := addTags(t) + if err != nil { + return t, err + } + for _, id := range [...]Tag{ + {LangID: t.LangID}, + {LangID: t.LangID, RegionID: t.RegionID}, + {LangID: t.LangID, ScriptID: t.ScriptID}, + } { + if x, err := addTags(id); err == nil && max.equalTags(x) { + t.setTagsFrom(id) + break + } + } + return t, nil +} diff --git a/vendor/golang.org/x/text/internal/language/parse.go b/vendor/golang.org/x/text/internal/language/parse.go new file mode 100644 index 0000000..47ee0fe --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/parse.go @@ -0,0 +1,604 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "bytes" + "errors" + "fmt" + "sort" + + "golang.org/x/text/internal/tag" +) + +// isAlpha returns true if the byte is not a digit. +// b must be an ASCII letter or digit. +func isAlpha(b byte) bool { + return b > '9' +} + +// isAlphaNum returns true if the string contains only ASCII letters or digits. +func isAlphaNum(s []byte) bool { + for _, c := range s { + if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') { + return false + } + } + return true +} + +// ErrSyntax is returned by any of the parsing functions when the +// input is not well-formed, according to BCP 47. +// TODO: return the position at which the syntax error occurred? +var ErrSyntax = errors.New("language: tag is not well-formed") + +// ErrDuplicateKey is returned when a tag contains the same key twice with +// different values in the -u section. +var ErrDuplicateKey = errors.New("language: different values for same key in -u extension") + +// ValueError is returned by any of the parsing functions when the +// input is well-formed but the respective subtag is not recognized +// as a valid value. +type ValueError struct { + v [8]byte +} + +// NewValueError creates a new ValueError. +func NewValueError(tag []byte) ValueError { + var e ValueError + copy(e.v[:], tag) + return e +} + +func (e ValueError) tag() []byte { + n := bytes.IndexByte(e.v[:], 0) + if n == -1 { + n = 8 + } + return e.v[:n] +} + +// Error implements the error interface. +func (e ValueError) Error() string { + return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag()) +} + +// Subtag returns the subtag for which the error occurred. +func (e ValueError) Subtag() string { + return string(e.tag()) +} + +// scanner is used to scan BCP 47 tokens, which are separated by _ or -. +type scanner struct { + b []byte + bytes [max99thPercentileSize]byte + token []byte + start int // start position of the current token + end int // end position of the current token + next int // next point for scan + err error + done bool +} + +func makeScannerString(s string) scanner { + scan := scanner{} + if len(s) <= len(scan.bytes) { + scan.b = scan.bytes[:copy(scan.bytes[:], s)] + } else { + scan.b = []byte(s) + } + scan.init() + return scan +} + +// makeScanner returns a scanner using b as the input buffer. +// b is not copied and may be modified by the scanner routines. +func makeScanner(b []byte) scanner { + scan := scanner{b: b} + scan.init() + return scan +} + +func (s *scanner) init() { + for i, c := range s.b { + if c == '_' { + s.b[i] = '-' + } + } + s.scan() +} + +// restToLower converts the string between start and end to lower case. +func (s *scanner) toLower(start, end int) { + for i := start; i < end; i++ { + c := s.b[i] + if 'A' <= c && c <= 'Z' { + s.b[i] += 'a' - 'A' + } + } +} + +func (s *scanner) setError(e error) { + if s.err == nil || (e == ErrSyntax && s.err != ErrSyntax) { + s.err = e + } +} + +// resizeRange shrinks or grows the array at position oldStart such that +// a new string of size newSize can fit between oldStart and oldEnd. +// Sets the scan point to after the resized range. +func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) { + s.start = oldStart + if end := oldStart + newSize; end != oldEnd { + diff := end - oldEnd + var b []byte + if n := len(s.b) + diff; n > cap(s.b) { + b = make([]byte, n) + copy(b, s.b[:oldStart]) + } else { + b = s.b[:n] + } + copy(b[end:], s.b[oldEnd:]) + s.b = b + s.next = end + (s.next - s.end) + s.end = end + } +} + +// replace replaces the current token with repl. +func (s *scanner) replace(repl string) { + s.resizeRange(s.start, s.end, len(repl)) + copy(s.b[s.start:], repl) +} + +// gobble removes the current token from the input. +// Caller must call scan after calling gobble. +func (s *scanner) gobble(e error) { + s.setError(e) + if s.start == 0 { + s.b = s.b[:+copy(s.b, s.b[s.next:])] + s.end = 0 + } else { + s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])] + s.end = s.start - 1 + } + s.next = s.start +} + +// deleteRange removes the given range from s.b before the current token. +func (s *scanner) deleteRange(start, end int) { + s.b = s.b[:start+copy(s.b[start:], s.b[end:])] + diff := end - start + s.next -= diff + s.start -= diff + s.end -= diff +} + +// scan parses the next token of a BCP 47 string. Tokens that are larger +// than 8 characters or include non-alphanumeric characters result in an error +// and are gobbled and removed from the output. +// It returns the end position of the last token consumed. +func (s *scanner) scan() (end int) { + end = s.end + s.token = nil + for s.start = s.next; s.next < len(s.b); { + i := bytes.IndexByte(s.b[s.next:], '-') + if i == -1 { + s.end = len(s.b) + s.next = len(s.b) + i = s.end - s.start + } else { + s.end = s.next + i + s.next = s.end + 1 + } + token := s.b[s.start:s.end] + if i < 1 || i > 8 || !isAlphaNum(token) { + s.gobble(ErrSyntax) + continue + } + s.token = token + return end + } + if n := len(s.b); n > 0 && s.b[n-1] == '-' { + s.setError(ErrSyntax) + s.b = s.b[:len(s.b)-1] + } + s.done = true + return end +} + +// acceptMinSize parses multiple tokens of the given size or greater. +// It returns the end position of the last token consumed. +func (s *scanner) acceptMinSize(min int) (end int) { + end = s.end + s.scan() + for ; len(s.token) >= min; s.scan() { + end = s.end + } + return end +} + +// Parse parses the given BCP 47 string and returns a valid Tag. If parsing +// failed it returns an error and any part of the tag that could be parsed. +// If parsing succeeded but an unknown value was found, it returns +// ValueError. The Tag returned in this case is just stripped of the unknown +// value. All other values are preserved. It accepts tags in the BCP 47 format +// and extensions to this standard defined in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +func Parse(s string) (t Tag, err error) { + // TODO: consider supporting old-style locale key-value pairs. + if s == "" { + return Und, ErrSyntax + } + defer func() { + if recover() != nil { + t = Und + err = ErrSyntax + return + } + }() + if len(s) <= maxAltTaglen { + b := [maxAltTaglen]byte{} + for i, c := range s { + // Generating invalid UTF-8 is okay as it won't match. + if 'A' <= c && c <= 'Z' { + c += 'a' - 'A' + } else if c == '_' { + c = '-' + } + b[i] = byte(c) + } + if t, ok := grandfathered(b); ok { + return t, nil + } + } + scan := makeScannerString(s) + return parse(&scan, s) +} + +func parse(scan *scanner, s string) (t Tag, err error) { + t = Und + var end int + if n := len(scan.token); n <= 1 { + scan.toLower(0, len(scan.b)) + if n == 0 || scan.token[0] != 'x' { + return t, ErrSyntax + } + end = parseExtensions(scan) + } else if n >= 4 { + return Und, ErrSyntax + } else { // the usual case + t, end = parseTag(scan) + if n := len(scan.token); n == 1 { + t.pExt = uint16(end) + end = parseExtensions(scan) + } else if end < len(scan.b) { + scan.setError(ErrSyntax) + scan.b = scan.b[:end] + } + } + if int(t.pVariant) < len(scan.b) { + if end < len(s) { + s = s[:end] + } + if len(s) > 0 && tag.Compare(s, scan.b) == 0 { + t.str = s + } else { + t.str = string(scan.b) + } + } else { + t.pVariant, t.pExt = 0, 0 + } + return t, scan.err +} + +// parseTag parses language, script, region and variants. +// It returns a Tag and the end position in the input that was parsed. +func parseTag(scan *scanner) (t Tag, end int) { + var e error + // TODO: set an error if an unknown lang, script or region is encountered. + t.LangID, e = getLangID(scan.token) + scan.setError(e) + scan.replace(t.LangID.String()) + langStart := scan.start + end = scan.scan() + for len(scan.token) == 3 && isAlpha(scan.token[0]) { + // From http://tools.ietf.org/html/bcp47, - tags are equivalent + // to a tag of the form . + lang, e := getLangID(scan.token) + if lang != 0 { + t.LangID = lang + copy(scan.b[langStart:], lang.String()) + scan.b[langStart+3] = '-' + scan.start = langStart + 4 + } + scan.gobble(e) + end = scan.scan() + } + if len(scan.token) == 4 && isAlpha(scan.token[0]) { + t.ScriptID, e = getScriptID(script, scan.token) + if t.ScriptID == 0 { + scan.gobble(e) + } + end = scan.scan() + } + if n := len(scan.token); n >= 2 && n <= 3 { + t.RegionID, e = getRegionID(scan.token) + if t.RegionID == 0 { + scan.gobble(e) + } else { + scan.replace(t.RegionID.String()) + } + end = scan.scan() + } + scan.toLower(scan.start, len(scan.b)) + t.pVariant = byte(end) + end = parseVariants(scan, end, t) + t.pExt = uint16(end) + return t, end +} + +var separator = []byte{'-'} + +// parseVariants scans tokens as long as each token is a valid variant string. +// Duplicate variants are removed. +func parseVariants(scan *scanner, end int, t Tag) int { + start := scan.start + varIDBuf := [4]uint8{} + variantBuf := [4][]byte{} + varID := varIDBuf[:0] + variant := variantBuf[:0] + last := -1 + needSort := false + for ; len(scan.token) >= 4; scan.scan() { + // TODO: measure the impact of needing this conversion and redesign + // the data structure if there is an issue. + v, ok := variantIndex[string(scan.token)] + if !ok { + // unknown variant + // TODO: allow user-defined variants? + scan.gobble(NewValueError(scan.token)) + continue + } + varID = append(varID, v) + variant = append(variant, scan.token) + if !needSort { + if last < int(v) { + last = int(v) + } else { + needSort = true + // There is no legal combinations of more than 7 variants + // (and this is by no means a useful sequence). + const maxVariants = 8 + if len(varID) > maxVariants { + break + } + } + } + end = scan.end + } + if needSort { + sort.Sort(variantsSort{varID, variant}) + k, l := 0, -1 + for i, v := range varID { + w := int(v) + if l == w { + // Remove duplicates. + continue + } + varID[k] = varID[i] + variant[k] = variant[i] + k++ + l = w + } + if str := bytes.Join(variant[:k], separator); len(str) == 0 { + end = start - 1 + } else { + scan.resizeRange(start, end, len(str)) + copy(scan.b[scan.start:], str) + end = scan.end + } + } + return end +} + +type variantsSort struct { + i []uint8 + v [][]byte +} + +func (s variantsSort) Len() int { + return len(s.i) +} + +func (s variantsSort) Swap(i, j int) { + s.i[i], s.i[j] = s.i[j], s.i[i] + s.v[i], s.v[j] = s.v[j], s.v[i] +} + +func (s variantsSort) Less(i, j int) bool { + return s.i[i] < s.i[j] +} + +type bytesSort struct { + b [][]byte + n int // first n bytes to compare +} + +func (b bytesSort) Len() int { + return len(b.b) +} + +func (b bytesSort) Swap(i, j int) { + b.b[i], b.b[j] = b.b[j], b.b[i] +} + +func (b bytesSort) Less(i, j int) bool { + for k := 0; k < b.n; k++ { + if b.b[i][k] == b.b[j][k] { + continue + } + return b.b[i][k] < b.b[j][k] + } + return false +} + +// parseExtensions parses and normalizes the extensions in the buffer. +// It returns the last position of scan.b that is part of any extension. +// It also trims scan.b to remove excess parts accordingly. +func parseExtensions(scan *scanner) int { + start := scan.start + exts := [][]byte{} + private := []byte{} + end := scan.end + for len(scan.token) == 1 { + extStart := scan.start + ext := scan.token[0] + end = parseExtension(scan) + extension := scan.b[extStart:end] + if len(extension) < 3 || (ext != 'x' && len(extension) < 4) { + scan.setError(ErrSyntax) + end = extStart + continue + } else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) { + scan.b = scan.b[:end] + return end + } else if ext == 'x' { + private = extension + break + } + exts = append(exts, extension) + } + sort.Sort(bytesSort{exts, 1}) + if len(private) > 0 { + exts = append(exts, private) + } + scan.b = scan.b[:start] + if len(exts) > 0 { + scan.b = append(scan.b, bytes.Join(exts, separator)...) + } else if start > 0 { + // Strip trailing '-'. + scan.b = scan.b[:start-1] + } + return end +} + +// parseExtension parses a single extension and returns the position of +// the extension end. +func parseExtension(scan *scanner) int { + start, end := scan.start, scan.end + switch scan.token[0] { + case 'u': // https://www.ietf.org/rfc/rfc6067.txt + attrStart := end + scan.scan() + for last := []byte{}; len(scan.token) > 2; scan.scan() { + if bytes.Compare(scan.token, last) != -1 { + // Attributes are unsorted. Start over from scratch. + p := attrStart + 1 + scan.next = p + attrs := [][]byte{} + for scan.scan(); len(scan.token) > 2; scan.scan() { + attrs = append(attrs, scan.token) + end = scan.end + } + sort.Sort(bytesSort{attrs, 3}) + copy(scan.b[p:], bytes.Join(attrs, separator)) + break + } + last = scan.token + end = scan.end + } + // Scan key-type sequences. A key is of length 2 and may be followed + // by 0 or more "type" subtags from 3 to the maximum of 8 letters. + var last, key []byte + for attrEnd := end; len(scan.token) == 2; last = key { + key = scan.token + end = scan.end + for scan.scan(); end < scan.end && len(scan.token) > 2; scan.scan() { + end = scan.end + } + // TODO: check key value validity + if bytes.Compare(key, last) != 1 || scan.err != nil { + // We have an invalid key or the keys are not sorted. + // Start scanning keys from scratch and reorder. + p := attrEnd + 1 + scan.next = p + keys := [][]byte{} + for scan.scan(); len(scan.token) == 2; { + keyStart := scan.start + end = scan.end + for scan.scan(); end < scan.end && len(scan.token) > 2; scan.scan() { + end = scan.end + } + keys = append(keys, scan.b[keyStart:end]) + } + sort.Stable(bytesSort{keys, 2}) + if n := len(keys); n > 0 { + k := 0 + for i := 1; i < n; i++ { + if !bytes.Equal(keys[k][:2], keys[i][:2]) { + k++ + keys[k] = keys[i] + } else if !bytes.Equal(keys[k], keys[i]) { + scan.setError(ErrDuplicateKey) + } + } + keys = keys[:k+1] + } + reordered := bytes.Join(keys, separator) + if e := p + len(reordered); e < end { + scan.deleteRange(e, end) + end = e + } + copy(scan.b[p:], reordered) + break + } + } + case 't': // https://www.ietf.org/rfc/rfc6497.txt + scan.scan() + if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) { + _, end = parseTag(scan) + scan.toLower(start, end) + } + for len(scan.token) == 2 && !isAlpha(scan.token[1]) { + end = scan.acceptMinSize(3) + } + case 'x': + end = scan.acceptMinSize(1) + default: + end = scan.acceptMinSize(2) + } + return end +} + +// getExtension returns the name, body and end position of the extension. +func getExtension(s string, p int) (end int, ext string) { + if s[p] == '-' { + p++ + } + if s[p] == 'x' { + return len(s), s[p:] + } + end = nextExtension(s, p) + return end, s[p:end] +} + +// nextExtension finds the next extension within the string, searching +// for the -- pattern from position p. +// In the fast majority of cases, language tags will have at most +// one extension and extensions tend to be small. +func nextExtension(s string, p int) int { + for n := len(s) - 3; p < n; { + if s[p] == '-' { + if s[p+2] == '-' { + return p + } + p += 3 + } else { + p++ + } + } + return len(s) +} diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go new file mode 100644 index 0000000..a19480c --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/tables.go @@ -0,0 +1,3464 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package language + +import "golang.org/x/text/internal/tag" + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +const NumLanguages = 8717 + +const NumScripts = 251 + +const NumRegions = 357 + +type FromTo struct { + From uint16 + To uint16 +} + +const nonCanonicalUnd = 1201 +const ( + _af = 22 + _am = 39 + _ar = 58 + _az = 88 + _bg = 126 + _bn = 165 + _ca = 215 + _cs = 250 + _da = 257 + _de = 269 + _el = 310 + _en = 313 + _es = 318 + _et = 320 + _fa = 328 + _fi = 337 + _fil = 339 + _fr = 350 + _gu = 420 + _he = 444 + _hi = 446 + _hr = 465 + _hu = 469 + _hy = 471 + _id = 481 + _is = 504 + _it = 505 + _ja = 512 + _ka = 528 + _kk = 578 + _km = 586 + _kn = 593 + _ko = 596 + _ky = 650 + _lo = 696 + _lt = 704 + _lv = 711 + _mk = 767 + _ml = 772 + _mn = 779 + _mo = 784 + _mr = 795 + _ms = 799 + _mul = 806 + _my = 817 + _nb = 839 + _ne = 849 + _nl = 871 + _no = 879 + _pa = 925 + _pl = 947 + _pt = 960 + _ro = 988 + _ru = 994 + _sh = 1031 + _si = 1036 + _sk = 1042 + _sl = 1046 + _sq = 1073 + _sr = 1074 + _sv = 1092 + _sw = 1093 + _ta = 1104 + _te = 1121 + _th = 1131 + _tl = 1146 + _tn = 1152 + _tr = 1162 + _uk = 1198 + _ur = 1204 + _uz = 1212 + _vi = 1219 + _zh = 1321 + _zu = 1327 + _jbo = 515 + _ami = 1650 + _bnn = 2357 + _hak = 438 + _tlh = 14467 + _lb = 661 + _nv = 899 + _pwn = 12055 + _tao = 14188 + _tay = 14198 + _tsu = 14662 + _nn = 874 + _sfb = 13629 + _vgt = 15701 + _sgg = 13660 + _cmn = 3007 + _nan = 835 + _hsn = 467 +) + +const langPrivateStart = 0x2f72 + +const langPrivateEnd = 0x3179 + +// lang holds an alphabetically sorted list of ISO-639 language identifiers. +// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag. +// For 2-byte language identifiers, the two successive bytes have the following meaning: +// - if the first letter of the 2- and 3-letter ISO codes are the same: +// the second and third letter of the 3-letter ISO code. +// - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. +// For 3-byte language identifiers the 4th byte is 0. +const lang tag.Index = "" + // Size: 5324 bytes + "---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" + + "cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" + + "\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" + + "jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" + + "p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" + + "ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" + + "\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" + + "tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" + + "\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" + + "bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" + + "m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" + + "bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" + + "\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" + + "\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" + + "\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" + + "\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" + + "bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" + + "\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" + + "uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" + + "\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" + + "\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" + + "\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" + + "kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" + + "j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" + + "andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" + + "ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" + + "\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" + + "\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" + + "yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" + + "llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" + + "\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" + + "\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" + + "foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" + + "ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" + + "ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" + + "\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" + + "ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" + + "\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" + + "\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" + + "\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" + + "\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" + + "aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" + + "l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" + + "hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" + + "\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" + + "eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" + + "lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" + + "ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" + + "\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" + + "\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" + + "\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" + + "\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" + + "ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" + + "\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" + + "klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" + + "nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" + + "\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" + + "rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" + + "\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" + + "us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" + + "\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" + + "\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" + + "ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" + + "d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" + + "\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" + + "\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" + + "lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" + + "w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" + + "\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" + + "\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" + + "\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" + + "min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" + + "ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" + + "e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" + + "mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" + + "us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" + + "\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" + + "\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" + + "bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" + + "\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" + + "if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" + + "dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" + + "nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" + + "\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" + + "\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" + + "opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" + + "\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" + + "\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" + + "\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" + + "ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" + + "f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" + + "rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" + + "ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" + + "\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" + + "ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" + + "i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" + + "\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" + + "\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" + + "\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" + + "\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" + + "\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" + + "sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" + + "yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" + + "\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" + + "ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" + + "q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" + + "\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" + + "tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" + + "sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" + + "\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" + + "wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" + + "\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" + + "vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" + + "\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" + + "\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" + + "\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" + + "\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" + + "bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" + + "\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" + + "\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" + + "\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" + + "ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" + + "\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" + + "\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff" + +const langNoIndexOffset = 1330 + +// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index +// in lookup tables. The language ids for these language codes are derived directly +// from the letters and are not consecutive. +// Size: 2197 bytes, 2197 elements +var langNoIndex = [2197]uint8{ + // Entry 0 - 3F + 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, + 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, + 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, + 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62, + 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, + 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, + 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xb8, 0x0a, 0x6a, + 0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff, + // Entry 40 - 7F + 0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0, + 0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed, + 0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35, + 0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff, + 0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5, + 0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3, + 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, + 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, + // Entry 80 - BF + 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x2f, 0xff, 0xff, + 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, + 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, + 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, + 0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff, + 0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5, + 0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c, + 0x08, 0x21, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80, + // Entry C0 - FF + 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, + 0x1b, 0x14, 0x08, 0xf3, 0x2b, 0xe7, 0x17, 0x56, + 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7b, 0xf3, 0xef, + 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, + 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xff, 0x73, 0x35, + 0x3e, 0x87, 0xc7, 0xdf, 0xff, 0x01, 0x81, 0x00, + 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03, + 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, + // Entry 100 - 13F + 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, + 0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00, + 0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3, + 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x01, 0x0c, + 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc7, 0x67, 0x5f, + 0x56, 0x99, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, + 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, + 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb, + // Entry 140 - 17F + 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x0c, 0x16, + 0x03, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06, + 0x0a, 0x00, 0x01, 0x00, 0x00, 0x10, 0x11, 0x09, + 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, + 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04, + 0x08, 0x00, 0x00, 0x04, 0x00, 0x80, 0x28, 0x04, + 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, + 0x24, 0x52, 0xf4, 0xd4, 0xbd, 0x62, 0xc9, 0x03, + // Entry 180 - 1BF + 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, + 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, + 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, + // Entry 1C0 - 1FF + 0x00, 0x03, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00, + 0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55, + 0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40, + 0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf, + // Entry 200 - 23F + 0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27, + 0xed, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5, + 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe0, 0xdf, + 0x03, 0x44, 0x08, 0x90, 0x01, 0x04, 0x01, 0xe3, + 0x92, 0x54, 0xdb, 0x28, 0xd3, 0x5f, 0xfe, 0x6d, + 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01, + 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, + 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, + // Entry 240 - 27F + 0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00, + 0x20, 0x7b, 0x78, 0x02, 0x05, 0x84, 0x00, 0xf0, + 0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00, + 0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04, + 0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00, + 0x11, 0x24, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff, + 0x7b, 0x7f, 0x70, 0x00, 0x05, 0x9b, 0xdd, 0x66, + // Entry 280 - 2BF + 0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05, + 0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51, + 0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05, + 0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, + 0x0c, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60, + 0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80, + 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, + 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, + // Entry 2C0 - 2FF + 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2, + 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9, + 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, + 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, + 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, + 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, + 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08, + 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x12, 0x00, + // Entry 300 - 33F + 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, + 0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00, + 0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80, + 0x00, 0x01, 0xd0, 0x12, 0x40, 0x00, 0x10, 0xb0, + 0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00, + 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80, + 0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00, + 0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00, + // Entry 340 - 37F + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01, + 0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3, + 0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb, + 0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6, + 0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff, + 0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff, + 0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f, + 0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f, + // Entry 380 - 3BF + 0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f, + 0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d, + 0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf, + 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, + 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, + 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, + 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b, + 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, + // Entry 3C0 - 3FF + 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, + 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, + 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00, + 0x40, 0x54, 0x9f, 0x8a, 0xd9, 0xf9, 0x2e, 0x11, + 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x01, + 0x05, 0xd1, 0x50, 0x5c, 0x00, 0x00, 0x00, 0x10, + 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, + 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, + // Entry 400 - 43F + 0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f, + 0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7, + 0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f, + 0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b, + 0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7, + 0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe, + 0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde, + 0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf, + // Entry 440 - 47F + 0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d, + 0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd, + 0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf, + 0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7, + 0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce, + 0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xfd, + 0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff, + 0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4, + // Entry 480 - 4BF + 0x13, 0x50, 0x5d, 0xaf, 0xa6, 0xff, 0x99, 0xfb, + 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, + 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41, + 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x05, 0xc5, 0x05, + 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x04, + 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, + 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xb1, + // Entry 4C0 - 4FF + 0xfd, 0x47, 0x49, 0x06, 0x95, 0x06, 0x57, 0xed, + 0xfb, 0x4c, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, + 0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83, + 0xb8, 0x4f, 0x10, 0x8c, 0x89, 0x46, 0xde, 0xf7, + 0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00, + 0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d, + 0xbe, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, + // Entry 500 - 53F + 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, + 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7, + 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, + 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe7, 0xf7, + 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, + 0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9, + 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, + 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, + // Entry 540 - 57F + 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + // Entry 580 - 5BF + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d, + 0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80, + 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, + 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, + 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, + 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81, + 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, + // Entry 5C0 - 5FF + 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02, + 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, + 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, + 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, + 0x31, 0x00, 0x00, 0x00, 0x01, 0x10, 0x02, 0x20, + 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, + 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, + 0x1f, 0x98, 0xcf, 0x9c, 0xff, 0xaf, 0x5f, 0xfe, + // Entry 600 - 63F + 0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9, + 0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1, + 0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7, + 0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd, + 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x1f, + 0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe, + 0xbe, 0x5f, 0x46, 0x1b, 0xe9, 0x5f, 0x50, 0x18, + 0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f, + // Entry 640 - 67F + 0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf5, 0x57, 0x6c, + 0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde, + 0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x3f, 0x00, 0x98, + 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, + 0xb9, 0xda, 0x7d, 0xd0, 0x3e, 0x15, 0x7b, 0xb4, + 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, + 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9, + 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, + // Entry 680 - 6BF + 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, + 0xce, 0x7f, 0x04, 0x1d, 0x73, 0x7f, 0xf8, 0xda, + 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x69, 0xa0, + 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, + 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06, + 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, + 0x04, 0x00, 0x10, 0xdc, 0x58, 0xd7, 0x0d, 0x0f, + // Entry 6C0 - 6FF + 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd1, 0x42, 0x08, + 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, + 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x48, 0x41, + 0x24, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, + 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab, + 0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, + // Entry 700 - 73F + 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, + 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01, + 0xdf, 0x18, 0x00, 0x00, 0x02, 0xf0, 0xfd, 0x79, + 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, + 0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00, + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 740 - 77F + 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, + 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44, + 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, + 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, + 0x01, 0x00, 0x00, 0xb0, 0x80, 0x20, 0x55, 0x75, + 0x97, 0x7c, 0x9f, 0x31, 0xcc, 0x68, 0xd1, 0x03, + 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, + // Entry 780 - 7BF + 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, + 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, + 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0, + 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, + 0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41, + 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00, + 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, + 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, + // Entry 7C0 - 7FF + 0xdd, 0xbf, 0x72, 0x1d, 0xc7, 0x0c, 0xd5, 0x42, + 0xfc, 0xff, 0xf7, 0x1f, 0x00, 0x80, 0x40, 0x56, + 0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff, + 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, + 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, + 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, + 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01, + 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, + // Entry 800 - 83F + 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, + 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1, + 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, + 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, + 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, + 0x2e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93, + 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, + 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, + // Entry 840 - 87F + 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x12, 0x81, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02, + 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, + 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00, + 0x00, 0xcb, 0xe4, 0x3a, 0x42, 0x88, 0x14, 0xf1, + 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, + 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, + 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, + // Entry 880 - 8BF + 0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00, + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24, + 0x0a, 0x00, 0x80, 0x00, 0x00, +} + +// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives +// to 2-letter language codes that cannot be derived using the method described above. +// Each 3-letter code is followed by its 1-byte langID. +const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff" + +// altLangIndex is used to convert indexes in altLangISO3 to langIDs. +// Size: 12 bytes, 6 elements +var altLangIndex = [6]uint16{ + 0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208, +} + +// AliasMap maps langIDs to their suggested replacements. +// Size: 704 bytes, 176 elements +var AliasMap = [176]FromTo{ + 0: {From: 0x82, To: 0x88}, + 1: {From: 0x187, To: 0x1ae}, + 2: {From: 0x1f3, To: 0x1e1}, + 3: {From: 0x1fb, To: 0x1bc}, + 4: {From: 0x208, To: 0x512}, + 5: {From: 0x20f, To: 0x20e}, + 6: {From: 0x310, To: 0x3dc}, + 7: {From: 0x347, To: 0x36f}, + 8: {From: 0x407, To: 0x432}, + 9: {From: 0x47a, To: 0x153}, + 10: {From: 0x490, To: 0x451}, + 11: {From: 0x4a2, To: 0x21}, + 12: {From: 0x53e, To: 0x544}, + 13: {From: 0x58f, To: 0x12d}, + 14: {From: 0x630, To: 0x1eb1}, + 15: {From: 0x651, To: 0x431}, + 16: {From: 0x662, To: 0x431}, + 17: {From: 0x6ed, To: 0x3a}, + 18: {From: 0x6f8, To: 0x1d7}, + 19: {From: 0x709, To: 0x3625}, + 20: {From: 0x73e, To: 0x21a1}, + 21: {From: 0x7b3, To: 0x56}, + 22: {From: 0x7b9, To: 0x299b}, + 23: {From: 0x7c5, To: 0x58}, + 24: {From: 0x7e6, To: 0x145}, + 25: {From: 0x80c, To: 0x5a}, + 26: {From: 0x815, To: 0x8d}, + 27: {From: 0x87e, To: 0x810}, + 28: {From: 0x8c3, To: 0xee3}, + 29: {From: 0x9ef, To: 0x331}, + 30: {From: 0xa36, To: 0x2c5}, + 31: {From: 0xa3d, To: 0xbf}, + 32: {From: 0xabe, To: 0x3322}, + 33: {From: 0xb38, To: 0x529}, + 34: {From: 0xb75, To: 0x265a}, + 35: {From: 0xb7e, To: 0xbc3}, + 36: {From: 0xb9b, To: 0x44e}, + 37: {From: 0xbbc, To: 0x4229}, + 38: {From: 0xbbf, To: 0x529}, + 39: {From: 0xbfe, To: 0x2da7}, + 40: {From: 0xc2e, To: 0x3181}, + 41: {From: 0xcb9, To: 0xf3}, + 42: {From: 0xd08, To: 0xfa}, + 43: {From: 0xdc8, To: 0x11a}, + 44: {From: 0xdd7, To: 0x32d}, + 45: {From: 0xdf8, To: 0xdfb}, + 46: {From: 0xdfe, To: 0x531}, + 47: {From: 0xe01, To: 0xdf3}, + 48: {From: 0xedf, To: 0x205a}, + 49: {From: 0xee9, To: 0x222e}, + 50: {From: 0xeee, To: 0x2e9a}, + 51: {From: 0xf39, To: 0x367}, + 52: {From: 0x10d0, To: 0x140}, + 53: {From: 0x1104, To: 0x2d0}, + 54: {From: 0x11a0, To: 0x1ec}, + 55: {From: 0x1279, To: 0x21}, + 56: {From: 0x1424, To: 0x15e}, + 57: {From: 0x1470, To: 0x14e}, + 58: {From: 0x151f, To: 0xd9b}, + 59: {From: 0x1523, To: 0x390}, + 60: {From: 0x1532, To: 0x19f}, + 61: {From: 0x1580, To: 0x210}, + 62: {From: 0x1583, To: 0x10d}, + 63: {From: 0x15a3, To: 0x3caf}, + 64: {From: 0x1630, To: 0x222e}, + 65: {From: 0x166a, To: 0x19b}, + 66: {From: 0x16c8, To: 0x136}, + 67: {From: 0x1700, To: 0x29f8}, + 68: {From: 0x1718, To: 0x194}, + 69: {From: 0x1727, To: 0xf3f}, + 70: {From: 0x177a, To: 0x178}, + 71: {From: 0x1809, To: 0x17b6}, + 72: {From: 0x1816, To: 0x18f3}, + 73: {From: 0x188a, To: 0x436}, + 74: {From: 0x1979, To: 0x1d01}, + 75: {From: 0x1a74, To: 0x2bb0}, + 76: {From: 0x1a8a, To: 0x1f8}, + 77: {From: 0x1b5a, To: 0x1fa}, + 78: {From: 0x1b86, To: 0x1515}, + 79: {From: 0x1d64, To: 0x2c9b}, + 80: {From: 0x2038, To: 0x37b1}, + 81: {From: 0x203d, To: 0x20dd}, + 82: {From: 0x205a, To: 0x30b}, + 83: {From: 0x20e3, To: 0x274}, + 84: {From: 0x20ee, To: 0x263}, + 85: {From: 0x20f2, To: 0x22d}, + 86: {From: 0x20f9, To: 0x256}, + 87: {From: 0x210f, To: 0x21eb}, + 88: {From: 0x2135, To: 0x27d}, + 89: {From: 0x2160, To: 0x913}, + 90: {From: 0x2199, To: 0x121}, + 91: {From: 0x21ce, To: 0x1561}, + 92: {From: 0x21e6, To: 0x504}, + 93: {From: 0x21f4, To: 0x49f}, + 94: {From: 0x21fb, To: 0x269}, + 95: {From: 0x222d, To: 0x121}, + 96: {From: 0x2237, To: 0x121}, + 97: {From: 0x2262, To: 0x92a}, + 98: {From: 0x2316, To: 0x3226}, + 99: {From: 0x236a, To: 0x2835}, + 100: {From: 0x2382, To: 0x3365}, + 101: {From: 0x2472, To: 0x2c7}, + 102: {From: 0x24e4, To: 0x2ff}, + 103: {From: 0x24f0, To: 0x2fa}, + 104: {From: 0x24fa, To: 0x31f}, + 105: {From: 0x2550, To: 0xb5b}, + 106: {From: 0x25a9, To: 0xe2}, + 107: {From: 0x263e, To: 0x2d0}, + 108: {From: 0x26c9, To: 0x26b4}, + 109: {From: 0x26f9, To: 0x3c8}, + 110: {From: 0x2727, To: 0x3caf}, + 111: {From: 0x2755, To: 0x6a4}, + 112: {From: 0x2765, To: 0x26b4}, + 113: {From: 0x2789, To: 0x4358}, + 114: {From: 0x27c9, To: 0x2001}, + 115: {From: 0x28ea, To: 0x27b1}, + 116: {From: 0x28ef, To: 0x2837}, + 117: {From: 0x2914, To: 0x351}, + 118: {From: 0x2986, To: 0x2da7}, + 119: {From: 0x29f0, To: 0x96b}, + 120: {From: 0x2b1a, To: 0x38d}, + 121: {From: 0x2bfc, To: 0x395}, + 122: {From: 0x2c3f, To: 0x3caf}, + 123: {From: 0x2cfc, To: 0x3be}, + 124: {From: 0x2d13, To: 0x597}, + 125: {From: 0x2d47, To: 0x148}, + 126: {From: 0x2d48, To: 0x148}, + 127: {From: 0x2dff, To: 0x2f1}, + 128: {From: 0x2e08, To: 0x19cc}, + 129: {From: 0x2e1a, To: 0x2d95}, + 130: {From: 0x2e21, To: 0x292}, + 131: {From: 0x2e54, To: 0x7d}, + 132: {From: 0x2e65, To: 0x2282}, + 133: {From: 0x2ea0, To: 0x2e9b}, + 134: {From: 0x2eef, To: 0x2ed7}, + 135: {From: 0x3193, To: 0x3c4}, + 136: {From: 0x3366, To: 0x338e}, + 137: {From: 0x342a, To: 0x3dc}, + 138: {From: 0x34ee, To: 0x18d0}, + 139: {From: 0x35c8, To: 0x2c9b}, + 140: {From: 0x35e6, To: 0x412}, + 141: {From: 0x3658, To: 0x246}, + 142: {From: 0x3676, To: 0x3f4}, + 143: {From: 0x36fd, To: 0x445}, + 144: {From: 0x37c0, To: 0x121}, + 145: {From: 0x3816, To: 0x38f2}, + 146: {From: 0x382a, To: 0x2b48}, + 147: {From: 0x382b, To: 0x2c9b}, + 148: {From: 0x382f, To: 0xa9}, + 149: {From: 0x3832, To: 0x3228}, + 150: {From: 0x386c, To: 0x39a6}, + 151: {From: 0x3892, To: 0x3fc0}, + 152: {From: 0x38a5, To: 0x39d7}, + 153: {From: 0x38b4, To: 0x1fa4}, + 154: {From: 0x38b5, To: 0x2e9a}, + 155: {From: 0x395c, To: 0x47e}, + 156: {From: 0x3b4e, To: 0xd91}, + 157: {From: 0x3b78, To: 0x137}, + 158: {From: 0x3c99, To: 0x4bc}, + 159: {From: 0x3fbd, To: 0x100}, + 160: {From: 0x4208, To: 0xa91}, + 161: {From: 0x42be, To: 0x573}, + 162: {From: 0x42f9, To: 0x3f60}, + 163: {From: 0x4378, To: 0x25a}, + 164: {From: 0x43b8, To: 0xe6c}, + 165: {From: 0x43cd, To: 0x10f}, + 166: {From: 0x44af, To: 0x3322}, + 167: {From: 0x44e3, To: 0x512}, + 168: {From: 0x45ca, To: 0x2409}, + 169: {From: 0x45dd, To: 0x26dc}, + 170: {From: 0x4610, To: 0x48ae}, + 171: {From: 0x46ae, To: 0x46a0}, + 172: {From: 0x473e, To: 0x4745}, + 173: {From: 0x4817, To: 0x3503}, + 174: {From: 0x4916, To: 0x31f}, + 175: {From: 0x49a7, To: 0x523}, +} + +// Size: 176 bytes, 176 elements +var AliasTypes = [176]AliasType{ + // Entry 0 - 3F + 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2, + 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1, + 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0, + 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0, + // Entry 40 - 7F + 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0, + 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, + 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, 1, 1, 0, 1, 0, 0, + 0, 0, 0, 0, 0, 1, 0, 0, 1, 1, 0, 1, 0, 2, 1, 1, + // Entry 80 - BF + 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, 0, 0, 2, 1, 1, 1, + 0, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, 1, 1, 0, 1, 2, + 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1, +} + +const ( + _Latn = 90 + _Hani = 57 + _Hans = 59 + _Hant = 60 + _Qaaa = 143 + _Qaai = 151 + _Qabx = 192 + _Zinh = 245 + _Zyyy = 250 + _Zzzz = 251 +) + +// script is an alphabetically sorted list of ISO 15924 codes. The index +// of the script in the string, divided by 4, is the internal scriptID. +const script tag.Index = "" + // Size: 1012 bytes + "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + + "BrahBraiBugiBuhdCakmCansCariChamCherChrsCirtCoptCpmnCprtCyrlCyrsDevaDiak" + + "DogrDsrtDuplEgydEgyhEgypElbaElymEthiGeokGeorGlagGongGonmGothGranGrekGujr" + + "GuruHanbHangHaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamo" + + "JavaJpanJurcKaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatg" + + "LatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMend" + + "MercMeroMlymModiMongMoonMrooMteiMultMymrNandNarbNbatNewaNkdbNkgbNkooNshu" + + "OgamOlckOrkhOryaOsgeOsmaPalmPaucPermPhagPhliPhlpPhlvPhnxPiqdPlrdPrtiQaaa" + + "QaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaamQaanQaaoQaapQaaqQaarQaas" + + "QaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabeQabfQabgQabhQabiQabjQabk" + + "QablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabwQabxRjngRohgRoroRunrSamr" + + "SaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogdSogoSoraSoyoSundSyloSyrcSyre" + + "SyrjSyrnTagbTakrTaleTaluTamlTangTavtTeluTengTfngTglgThaaThaiTibtTirhToto" + + "UgarVaiiVispWaraWchoWoleXpeoXsuxYeziYiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz" + + "\xff\xff\xff\xff" + +// suppressScript is an index from langID to the dominant script for that language, +// if it exists. If a script is given, it should be suppressed from the language tag. +// Size: 1330 bytes, 1330 elements +var suppressScript = [1330]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 40 - 7F + 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, + // Entry 80 - BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry C0 - FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 100 - 13F + 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xe5, 0x00, 0x00, 0x00, 0x00, 0xe7, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x34, 0x00, + 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x5a, 0x00, + // Entry 140 - 17F + 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 180 - 1BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5a, 0x35, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x22, 0x00, + // Entry 1C0 - 1FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5a, 0x5a, 0x00, 0x5a, 0x5a, 0x00, 0x08, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x5a, 0x5a, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, + // Entry 200 - 23F + 0x49, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x2e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 240 - 27F + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x4e, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x52, 0x00, 0x00, 0x53, 0x00, 0x22, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 280 - 2BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 2C0 - 2FF + 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x22, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, + // Entry 300 - 33F + 0x00, 0x00, 0x00, 0x00, 0x6e, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5a, + 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x75, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + // Entry 340 - 37F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x5a, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x7c, 0x5a, 0x00, + 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 380 - 3BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5a, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x36, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, + // Entry 3C0 - 3FF + 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 400 - 43F + 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xcf, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + // Entry 440 - 47F + 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xde, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xe1, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xe6, 0x00, 0x00, 0x00, 0x2c, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + // Entry 480 - 4BF + 0x5a, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 4C0 - 4FF + 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 500 - 53F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, +} + +const ( + _001 = 1 + _419 = 31 + _BR = 65 + _CA = 73 + _ES = 110 + _GB = 123 + _MD = 188 + _PT = 238 + _UK = 306 + _US = 309 + _ZZ = 357 + _XA = 323 + _XC = 325 + _XK = 333 +) + +// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID +// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for +// the UN.M49 codes used for groups.) +const isoRegionOffset = 32 + +// regionTypes defines the status of a region for various standards. +// Size: 358 bytes, 358 elements +var regionTypes = [358]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 40 - 7F + 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, + 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, + 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, + 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 80 - BF + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry C0 - FF + 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + // Entry 100 - 13F + 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 140 - 17F + 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06, + 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, +} + +// regionISO holds a list of alphabetically sorted 2-letter ISO region codes. +// Each 2-letter codes is followed by two bytes with the following meaning: +// - [A-Z}{2}: the first letter of the 2-letter code plus these two +// letters form the 3-letter ISO code. +// - 0, n: index into altRegionISO3. +const regionISO tag.Index = "" + // Size: 1308 bytes + "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + + "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + + "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + + "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" + + "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" + + "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" + + "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" + + "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" + + "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" + + "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" + + "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" + + "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" + + "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" + + "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" + + "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" + + "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" + + "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" + + "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" + + "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" + + "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff" + +// altRegionISO3 holds a list of 3-letter region codes that cannot be +// mapped to 2-letter codes using the default algorithm. This is a short list. +const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" + +// altRegionIDs holds a list of regionIDs the positions of which match those +// of the 3-letter ISO codes in altRegionISO3. +// Size: 22 bytes, 11 elements +var altRegionIDs = [11]uint16{ + 0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105, + 0x0121, 0x015f, 0x00dc, +} + +// Size: 80 bytes, 20 elements +var regionOldMap = [20]FromTo{ + 0: {From: 0x44, To: 0xc4}, + 1: {From: 0x58, To: 0xa7}, + 2: {From: 0x5f, To: 0x60}, + 3: {From: 0x66, To: 0x3b}, + 4: {From: 0x79, To: 0x78}, + 5: {From: 0x93, To: 0x37}, + 6: {From: 0xa3, To: 0x133}, + 7: {From: 0xc1, To: 0x133}, + 8: {From: 0xd7, To: 0x13f}, + 9: {From: 0xdc, To: 0x2b}, + 10: {From: 0xef, To: 0x133}, + 11: {From: 0xf2, To: 0xe2}, + 12: {From: 0xfc, To: 0x70}, + 13: {From: 0x103, To: 0x164}, + 14: {From: 0x12a, To: 0x126}, + 15: {From: 0x132, To: 0x7b}, + 16: {From: 0x13a, To: 0x13e}, + 17: {From: 0x141, To: 0x133}, + 18: {From: 0x15d, To: 0x15e}, + 19: {From: 0x163, To: 0x4b}, +} + +// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are +// codes indicating collections of regions. +// Size: 716 bytes, 358 elements +var m49 = [358]int16{ + // Entry 0 - 3F + 0, 1, 2, 3, 5, 9, 11, 13, + 14, 15, 17, 18, 19, 21, 29, 30, + 34, 35, 39, 53, 54, 57, 61, 142, + 143, 145, 150, 151, 154, 155, 202, 419, + 958, 0, 20, 784, 4, 28, 660, 8, + 51, 530, 24, 10, 32, 16, 40, 36, + 533, 248, 31, 70, 52, 50, 56, 854, + 100, 48, 108, 204, 652, 60, 96, 68, + // Entry 40 - 7F + 535, 76, 44, 64, 104, 74, 72, 112, + 84, 124, 166, 180, 140, 178, 756, 384, + 184, 152, 120, 156, 170, 0, 188, 891, + 296, 192, 132, 531, 162, 196, 203, 278, + 276, 0, 262, 208, 212, 214, 204, 12, + 0, 218, 233, 818, 732, 232, 724, 231, + 967, 0, 246, 242, 238, 583, 234, 0, + 250, 249, 266, 826, 308, 268, 254, 831, + // Entry 80 - BF + 288, 292, 304, 270, 324, 312, 226, 300, + 239, 320, 316, 624, 328, 344, 334, 340, + 191, 332, 348, 854, 0, 360, 372, 376, + 833, 356, 86, 368, 364, 352, 380, 832, + 388, 400, 392, 581, 404, 417, 116, 296, + 174, 659, 408, 410, 414, 136, 398, 418, + 422, 662, 438, 144, 430, 426, 440, 442, + 428, 434, 504, 492, 498, 499, 663, 450, + // Entry C0 - FF + 584, 581, 807, 466, 104, 496, 446, 580, + 474, 478, 500, 470, 480, 462, 454, 484, + 458, 508, 516, 540, 562, 574, 566, 548, + 558, 528, 578, 524, 10, 520, 536, 570, + 554, 512, 591, 0, 604, 258, 598, 608, + 586, 616, 666, 612, 630, 275, 620, 581, + 585, 600, 591, 634, 959, 960, 961, 962, + 963, 964, 965, 966, 967, 968, 969, 970, + // Entry 100 - 13F + 971, 972, 638, 716, 642, 688, 643, 646, + 682, 90, 690, 729, 752, 702, 654, 705, + 744, 703, 694, 674, 686, 706, 740, 728, + 678, 810, 222, 534, 760, 748, 0, 796, + 148, 260, 768, 764, 762, 772, 626, 795, + 788, 776, 626, 792, 780, 798, 158, 834, + 804, 800, 826, 581, 0, 840, 858, 860, + 336, 670, 704, 862, 92, 850, 704, 548, + // Entry 140 - 17F + 876, 581, 882, 973, 974, 975, 976, 977, + 978, 979, 980, 981, 982, 983, 984, 985, + 986, 987, 988, 989, 990, 991, 992, 993, + 994, 995, 996, 997, 998, 720, 887, 175, + 891, 710, 894, 180, 716, 999, +} + +// m49Index gives indexes into fromM49 based on the three most significant bits +// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in +// fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]] +// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code. +// The region code is stored in the 9 lsb of the indexed value. +// Size: 18 bytes, 9 elements +var m49Index = [9]int16{ + 0, 59, 108, 143, 181, 220, 259, 291, + 333, +} + +// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details. +// Size: 666 bytes, 333 elements +var fromM49 = [333]uint16{ + // Entry 0 - 3F + 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b, + 0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, + 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32, + 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039, + 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d, + 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848, + 0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047, + 0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18, + // Entry 40 - 7F + 0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, + 0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d, + 0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e, + 0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f, + 0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72, + 0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a, + 0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881, + 0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884, + // Entry 80 - BF + 0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d, + 0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f, + 0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac, + 0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9, + 0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd, + 0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5, + 0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd, + 0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de, + // Entry C0 - FF + 0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5, + 0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2, + 0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b, + 0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c, + 0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513, + 0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11, + 0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117, + 0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e, + // Entry 100 - 13F + 0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023, + 0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2, + 0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135, + 0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e, + 0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7, + 0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff, + 0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548, + 0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550, + // Entry 140 - 17F + 0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558, + 0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65, +} + +// Size: 1995 bytes +var variantIndex = map[string]uint8{ + "1606nict": 0x0, + "1694acad": 0x1, + "1901": 0x2, + "1959acad": 0x3, + "1994": 0x60, + "1996": 0x4, + "abl1943": 0x5, + "akuapem": 0x6, + "alalc97": 0x62, + "aluku": 0x7, + "ao1990": 0x8, + "aranes": 0x9, + "arevela": 0xa, + "arevmda": 0xb, + "asante": 0xc, + "auvern": 0xd, + "baku1926": 0xe, + "balanka": 0xf, + "barla": 0x10, + "basiceng": 0x11, + "bauddha": 0x12, + "biscayan": 0x13, + "biske": 0x5b, + "bohoric": 0x14, + "boont": 0x15, + "bornholm": 0x16, + "cisaup": 0x17, + "colb1945": 0x18, + "cornu": 0x19, + "creiss": 0x1a, + "dajnko": 0x1b, + "ekavsk": 0x1c, + "emodeng": 0x1d, + "fonipa": 0x63, + "fonkirsh": 0x64, + "fonnapa": 0x65, + "fonupa": 0x66, + "fonxsamp": 0x67, + "gascon": 0x1e, + "grclass": 0x1f, + "grital": 0x20, + "grmistr": 0x21, + "hepburn": 0x22, + "heploc": 0x61, + "hognorsk": 0x23, + "hsistemo": 0x24, + "ijekavsk": 0x25, + "itihasa": 0x26, + "ivanchov": 0x27, + "jauer": 0x28, + "jyutping": 0x29, + "kkcor": 0x2a, + "kociewie": 0x2b, + "kscor": 0x2c, + "laukika": 0x2d, + "lemosin": 0x2e, + "lengadoc": 0x2f, + "lipaw": 0x5c, + "luna1918": 0x30, + "metelko": 0x31, + "monoton": 0x32, + "ndyuka": 0x33, + "nedis": 0x34, + "newfound": 0x35, + "nicard": 0x36, + "njiva": 0x5d, + "nulik": 0x37, + "osojs": 0x5e, + "oxendict": 0x38, + "pahawh2": 0x39, + "pahawh3": 0x3a, + "pahawh4": 0x3b, + "pamaka": 0x3c, + "peano": 0x3d, + "petr1708": 0x3e, + "pinyin": 0x3f, + "polyton": 0x40, + "provenc": 0x41, + "puter": 0x42, + "rigik": 0x43, + "rozaj": 0x44, + "rumgr": 0x45, + "scotland": 0x46, + "scouse": 0x47, + "simple": 0x68, + "solba": 0x5f, + "sotav": 0x48, + "spanglis": 0x49, + "surmiran": 0x4a, + "sursilv": 0x4b, + "sutsilv": 0x4c, + "tarask": 0x4d, + "tongyong": 0x4e, + "tunumiit": 0x4f, + "uccor": 0x50, + "ucrcor": 0x51, + "ulster": 0x52, + "unifon": 0x53, + "vaidika": 0x54, + "valencia": 0x55, + "vallader": 0x56, + "vecdruka": 0x57, + "vivaraup": 0x58, + "wadegile": 0x59, + "xsistemo": 0x5a, +} + +// variantNumSpecialized is the number of specialized variants in variants. +const variantNumSpecialized = 98 + +// nRegionGroups is the number of region groups. +const nRegionGroups = 33 + +type likelyLangRegion struct { + lang uint16 + region uint16 +} + +// likelyScript is a lookup table, indexed by scriptID, for the most likely +// languages and regions given a script. +// Size: 1012 bytes, 253 elements +var likelyScript = [253]likelyLangRegion{ + 1: {lang: 0x14e, region: 0x84}, + 3: {lang: 0x2a2, region: 0x106}, + 4: {lang: 0x1f, region: 0x99}, + 5: {lang: 0x3a, region: 0x6b}, + 7: {lang: 0x3b, region: 0x9c}, + 8: {lang: 0x1d7, region: 0x28}, + 9: {lang: 0x13, region: 0x9c}, + 10: {lang: 0x5b, region: 0x95}, + 11: {lang: 0x60, region: 0x52}, + 12: {lang: 0xb9, region: 0xb4}, + 13: {lang: 0x63, region: 0x95}, + 14: {lang: 0xa5, region: 0x35}, + 15: {lang: 0x3e9, region: 0x99}, + 17: {lang: 0x529, region: 0x12e}, + 18: {lang: 0x3b1, region: 0x99}, + 19: {lang: 0x15e, region: 0x78}, + 20: {lang: 0xc2, region: 0x95}, + 21: {lang: 0x9d, region: 0xe7}, + 22: {lang: 0xdb, region: 0x35}, + 23: {lang: 0xf3, region: 0x49}, + 24: {lang: 0x4f0, region: 0x12b}, + 25: {lang: 0xe7, region: 0x13e}, + 26: {lang: 0xe5, region: 0x135}, + 29: {lang: 0xf1, region: 0x6b}, + 31: {lang: 0x1a0, region: 0x5d}, + 32: {lang: 0x3e2, region: 0x106}, + 34: {lang: 0x1be, region: 0x99}, + 38: {lang: 0x15e, region: 0x78}, + 41: {lang: 0x133, region: 0x6b}, + 42: {lang: 0x431, region: 0x27}, + 44: {lang: 0x27, region: 0x6f}, + 46: {lang: 0x210, region: 0x7d}, + 47: {lang: 0xfe, region: 0x38}, + 49: {lang: 0x19b, region: 0x99}, + 50: {lang: 0x19e, region: 0x130}, + 51: {lang: 0x3e9, region: 0x99}, + 52: {lang: 0x136, region: 0x87}, + 53: {lang: 0x1a4, region: 0x99}, + 54: {lang: 0x39d, region: 0x99}, + 55: {lang: 0x529, region: 0x12e}, + 56: {lang: 0x254, region: 0xab}, + 57: {lang: 0x529, region: 0x53}, + 58: {lang: 0x1cb, region: 0xe7}, + 59: {lang: 0x529, region: 0x53}, + 60: {lang: 0x529, region: 0x12e}, + 61: {lang: 0x2fd, region: 0x9b}, + 62: {lang: 0x1bc, region: 0x97}, + 63: {lang: 0x200, region: 0xa2}, + 64: {lang: 0x1c5, region: 0x12b}, + 65: {lang: 0x1ca, region: 0xaf}, + 68: {lang: 0x1d5, region: 0x92}, + 70: {lang: 0x142, region: 0x9e}, + 71: {lang: 0x254, region: 0xab}, + 72: {lang: 0x20e, region: 0x95}, + 73: {lang: 0x200, region: 0xa2}, + 75: {lang: 0x135, region: 0xc4}, + 76: {lang: 0x200, region: 0xa2}, + 77: {lang: 0x3bb, region: 0xe8}, + 78: {lang: 0x24a, region: 0xa6}, + 79: {lang: 0x3fa, region: 0x99}, + 82: {lang: 0x251, region: 0x99}, + 83: {lang: 0x254, region: 0xab}, + 85: {lang: 0x88, region: 0x99}, + 86: {lang: 0x370, region: 0x123}, + 87: {lang: 0x2b8, region: 0xaf}, + 92: {lang: 0x29f, region: 0x99}, + 93: {lang: 0x2a8, region: 0x99}, + 94: {lang: 0x28f, region: 0x87}, + 95: {lang: 0x1a0, region: 0x87}, + 96: {lang: 0x2ac, region: 0x53}, + 98: {lang: 0x4f4, region: 0x12b}, + 99: {lang: 0x4f5, region: 0x12b}, + 100: {lang: 0x1be, region: 0x99}, + 102: {lang: 0x337, region: 0x9c}, + 103: {lang: 0x4f7, region: 0x53}, + 104: {lang: 0xa9, region: 0x53}, + 107: {lang: 0x2e8, region: 0x112}, + 108: {lang: 0x4f8, region: 0x10b}, + 109: {lang: 0x4f8, region: 0x10b}, + 110: {lang: 0x304, region: 0x99}, + 111: {lang: 0x31b, region: 0x99}, + 112: {lang: 0x30b, region: 0x53}, + 114: {lang: 0x31e, region: 0x35}, + 115: {lang: 0x30e, region: 0x99}, + 116: {lang: 0x414, region: 0xe8}, + 117: {lang: 0x331, region: 0xc4}, + 119: {lang: 0x4f9, region: 0x108}, + 120: {lang: 0x3b, region: 0xa1}, + 121: {lang: 0x353, region: 0xdb}, + 124: {lang: 0x2d0, region: 0x84}, + 125: {lang: 0x52a, region: 0x53}, + 126: {lang: 0x403, region: 0x96}, + 127: {lang: 0x3ee, region: 0x99}, + 128: {lang: 0x39b, region: 0xc5}, + 129: {lang: 0x395, region: 0x99}, + 130: {lang: 0x399, region: 0x135}, + 131: {lang: 0x429, region: 0x115}, + 132: {lang: 0x3b, region: 0x11c}, + 133: {lang: 0xfd, region: 0xc4}, + 134: {lang: 0x27d, region: 0x106}, + 135: {lang: 0x2c9, region: 0x53}, + 136: {lang: 0x39f, region: 0x9c}, + 137: {lang: 0x39f, region: 0x53}, + 139: {lang: 0x3ad, region: 0xb0}, + 141: {lang: 0x1c6, region: 0x53}, + 142: {lang: 0x4fd, region: 0x9c}, + 193: {lang: 0x3cb, region: 0x95}, + 196: {lang: 0x372, region: 0x10c}, + 197: {lang: 0x420, region: 0x97}, + 199: {lang: 0x4ff, region: 0x15e}, + 200: {lang: 0x3f0, region: 0x99}, + 201: {lang: 0x45, region: 0x135}, + 202: {lang: 0x139, region: 0x7b}, + 203: {lang: 0x3e9, region: 0x99}, + 205: {lang: 0x3e9, region: 0x99}, + 206: {lang: 0x3fa, region: 0x99}, + 207: {lang: 0x40c, region: 0xb3}, + 210: {lang: 0x433, region: 0x99}, + 211: {lang: 0xef, region: 0xc5}, + 212: {lang: 0x43e, region: 0x95}, + 213: {lang: 0x44d, region: 0x35}, + 214: {lang: 0x44e, region: 0x9b}, + 218: {lang: 0x45a, region: 0xe7}, + 219: {lang: 0x11a, region: 0x99}, + 220: {lang: 0x45e, region: 0x53}, + 221: {lang: 0x232, region: 0x53}, + 222: {lang: 0x450, region: 0x99}, + 223: {lang: 0x4a5, region: 0x53}, + 224: {lang: 0x9f, region: 0x13e}, + 225: {lang: 0x461, region: 0x99}, + 227: {lang: 0x528, region: 0xba}, + 228: {lang: 0x153, region: 0xe7}, + 229: {lang: 0x128, region: 0xcd}, + 230: {lang: 0x46b, region: 0x123}, + 231: {lang: 0xa9, region: 0x53}, + 232: {lang: 0x2ce, region: 0x99}, + 234: {lang: 0x4ad, region: 0x11c}, + 235: {lang: 0x4be, region: 0xb4}, + 237: {lang: 0x1ce, region: 0x99}, + 240: {lang: 0x3a9, region: 0x9c}, + 241: {lang: 0x22, region: 0x9b}, + 243: {lang: 0x1ea, region: 0x53}, + 244: {lang: 0xef, region: 0xc5}, +} + +type likelyScriptRegion struct { + region uint16 + script uint8 + flags uint8 +} + +// likelyLang is a lookup table, indexed by langID, for the most likely +// scripts and regions given incomplete information. If more entries exist for a +// given language, region and script are the index and size respectively +// of the list in likelyLangList. +// Size: 5320 bytes, 1330 elements +var likelyLang = [1330]likelyScriptRegion{ + 0: {region: 0x135, script: 0x5a, flags: 0x0}, + 1: {region: 0x6f, script: 0x5a, flags: 0x0}, + 2: {region: 0x165, script: 0x5a, flags: 0x0}, + 3: {region: 0x165, script: 0x5a, flags: 0x0}, + 4: {region: 0x165, script: 0x5a, flags: 0x0}, + 5: {region: 0x7d, script: 0x20, flags: 0x0}, + 6: {region: 0x165, script: 0x5a, flags: 0x0}, + 7: {region: 0x165, script: 0x20, flags: 0x0}, + 8: {region: 0x80, script: 0x5a, flags: 0x0}, + 9: {region: 0x165, script: 0x5a, flags: 0x0}, + 10: {region: 0x165, script: 0x5a, flags: 0x0}, + 11: {region: 0x165, script: 0x5a, flags: 0x0}, + 12: {region: 0x95, script: 0x5a, flags: 0x0}, + 13: {region: 0x131, script: 0x5a, flags: 0x0}, + 14: {region: 0x80, script: 0x5a, flags: 0x0}, + 15: {region: 0x165, script: 0x5a, flags: 0x0}, + 16: {region: 0x165, script: 0x5a, flags: 0x0}, + 17: {region: 0x106, script: 0x20, flags: 0x0}, + 18: {region: 0x165, script: 0x5a, flags: 0x0}, + 19: {region: 0x9c, script: 0x9, flags: 0x0}, + 20: {region: 0x128, script: 0x5, flags: 0x0}, + 21: {region: 0x165, script: 0x5a, flags: 0x0}, + 22: {region: 0x161, script: 0x5a, flags: 0x0}, + 23: {region: 0x165, script: 0x5a, flags: 0x0}, + 24: {region: 0x165, script: 0x5a, flags: 0x0}, + 25: {region: 0x165, script: 0x5a, flags: 0x0}, + 26: {region: 0x165, script: 0x5a, flags: 0x0}, + 27: {region: 0x165, script: 0x5a, flags: 0x0}, + 28: {region: 0x52, script: 0x5a, flags: 0x0}, + 29: {region: 0x165, script: 0x5a, flags: 0x0}, + 30: {region: 0x165, script: 0x5a, flags: 0x0}, + 31: {region: 0x99, script: 0x4, flags: 0x0}, + 32: {region: 0x165, script: 0x5a, flags: 0x0}, + 33: {region: 0x80, script: 0x5a, flags: 0x0}, + 34: {region: 0x9b, script: 0xf1, flags: 0x0}, + 35: {region: 0x165, script: 0x5a, flags: 0x0}, + 36: {region: 0x165, script: 0x5a, flags: 0x0}, + 37: {region: 0x14d, script: 0x5a, flags: 0x0}, + 38: {region: 0x106, script: 0x20, flags: 0x0}, + 39: {region: 0x6f, script: 0x2c, flags: 0x0}, + 40: {region: 0x165, script: 0x5a, flags: 0x0}, + 41: {region: 0x165, script: 0x5a, flags: 0x0}, + 42: {region: 0xd6, script: 0x5a, flags: 0x0}, + 43: {region: 0x165, script: 0x5a, flags: 0x0}, + 45: {region: 0x165, script: 0x5a, flags: 0x0}, + 46: {region: 0x165, script: 0x5a, flags: 0x0}, + 47: {region: 0x165, script: 0x5a, flags: 0x0}, + 48: {region: 0x165, script: 0x5a, flags: 0x0}, + 49: {region: 0x165, script: 0x5a, flags: 0x0}, + 50: {region: 0x165, script: 0x5a, flags: 0x0}, + 51: {region: 0x95, script: 0x5a, flags: 0x0}, + 52: {region: 0x165, script: 0x5, flags: 0x0}, + 53: {region: 0x122, script: 0x5, flags: 0x0}, + 54: {region: 0x165, script: 0x5a, flags: 0x0}, + 55: {region: 0x165, script: 0x5a, flags: 0x0}, + 56: {region: 0x165, script: 0x5a, flags: 0x0}, + 57: {region: 0x165, script: 0x5a, flags: 0x0}, + 58: {region: 0x6b, script: 0x5, flags: 0x0}, + 59: {region: 0x0, script: 0x3, flags: 0x1}, + 60: {region: 0x165, script: 0x5a, flags: 0x0}, + 61: {region: 0x51, script: 0x5a, flags: 0x0}, + 62: {region: 0x3f, script: 0x5a, flags: 0x0}, + 63: {region: 0x67, script: 0x5, flags: 0x0}, + 65: {region: 0xba, script: 0x5, flags: 0x0}, + 66: {region: 0x6b, script: 0x5, flags: 0x0}, + 67: {region: 0x99, script: 0xe, flags: 0x0}, + 68: {region: 0x12f, script: 0x5a, flags: 0x0}, + 69: {region: 0x135, script: 0xc9, flags: 0x0}, + 70: {region: 0x165, script: 0x5a, flags: 0x0}, + 71: {region: 0x165, script: 0x5a, flags: 0x0}, + 72: {region: 0x6e, script: 0x5a, flags: 0x0}, + 73: {region: 0x165, script: 0x5a, flags: 0x0}, + 74: {region: 0x165, script: 0x5a, flags: 0x0}, + 75: {region: 0x49, script: 0x5a, flags: 0x0}, + 76: {region: 0x165, script: 0x5a, flags: 0x0}, + 77: {region: 0x106, script: 0x20, flags: 0x0}, + 78: {region: 0x165, script: 0x5, flags: 0x0}, + 79: {region: 0x165, script: 0x5a, flags: 0x0}, + 80: {region: 0x165, script: 0x5a, flags: 0x0}, + 81: {region: 0x165, script: 0x5a, flags: 0x0}, + 82: {region: 0x99, script: 0x22, flags: 0x0}, + 83: {region: 0x165, script: 0x5a, flags: 0x0}, + 84: {region: 0x165, script: 0x5a, flags: 0x0}, + 85: {region: 0x165, script: 0x5a, flags: 0x0}, + 86: {region: 0x3f, script: 0x5a, flags: 0x0}, + 87: {region: 0x165, script: 0x5a, flags: 0x0}, + 88: {region: 0x3, script: 0x5, flags: 0x1}, + 89: {region: 0x106, script: 0x20, flags: 0x0}, + 90: {region: 0xe8, script: 0x5, flags: 0x0}, + 91: {region: 0x95, script: 0x5a, flags: 0x0}, + 92: {region: 0xdb, script: 0x22, flags: 0x0}, + 93: {region: 0x2e, script: 0x5a, flags: 0x0}, + 94: {region: 0x52, script: 0x5a, flags: 0x0}, + 95: {region: 0x165, script: 0x5a, flags: 0x0}, + 96: {region: 0x52, script: 0xb, flags: 0x0}, + 97: {region: 0x165, script: 0x5a, flags: 0x0}, + 98: {region: 0x165, script: 0x5a, flags: 0x0}, + 99: {region: 0x95, script: 0x5a, flags: 0x0}, + 100: {region: 0x165, script: 0x5a, flags: 0x0}, + 101: {region: 0x52, script: 0x5a, flags: 0x0}, + 102: {region: 0x165, script: 0x5a, flags: 0x0}, + 103: {region: 0x165, script: 0x5a, flags: 0x0}, + 104: {region: 0x165, script: 0x5a, flags: 0x0}, + 105: {region: 0x165, script: 0x5a, flags: 0x0}, + 106: {region: 0x4f, script: 0x5a, flags: 0x0}, + 107: {region: 0x165, script: 0x5a, flags: 0x0}, + 108: {region: 0x165, script: 0x5a, flags: 0x0}, + 109: {region: 0x165, script: 0x5a, flags: 0x0}, + 110: {region: 0x165, script: 0x2c, flags: 0x0}, + 111: {region: 0x165, script: 0x5a, flags: 0x0}, + 112: {region: 0x165, script: 0x5a, flags: 0x0}, + 113: {region: 0x47, script: 0x20, flags: 0x0}, + 114: {region: 0x165, script: 0x5a, flags: 0x0}, + 115: {region: 0x165, script: 0x5a, flags: 0x0}, + 116: {region: 0x10b, script: 0x5, flags: 0x0}, + 117: {region: 0x162, script: 0x5a, flags: 0x0}, + 118: {region: 0x165, script: 0x5a, flags: 0x0}, + 119: {region: 0x95, script: 0x5a, flags: 0x0}, + 120: {region: 0x165, script: 0x5a, flags: 0x0}, + 121: {region: 0x12f, script: 0x5a, flags: 0x0}, + 122: {region: 0x52, script: 0x5a, flags: 0x0}, + 123: {region: 0x99, script: 0xde, flags: 0x0}, + 124: {region: 0xe8, script: 0x5, flags: 0x0}, + 125: {region: 0x99, script: 0x22, flags: 0x0}, + 126: {region: 0x38, script: 0x20, flags: 0x0}, + 127: {region: 0x99, script: 0x22, flags: 0x0}, + 128: {region: 0xe8, script: 0x5, flags: 0x0}, + 129: {region: 0x12b, script: 0x34, flags: 0x0}, + 131: {region: 0x99, script: 0x22, flags: 0x0}, + 132: {region: 0x165, script: 0x5a, flags: 0x0}, + 133: {region: 0x99, script: 0x22, flags: 0x0}, + 134: {region: 0xe7, script: 0x5a, flags: 0x0}, + 135: {region: 0x165, script: 0x5a, flags: 0x0}, + 136: {region: 0x99, script: 0x22, flags: 0x0}, + 137: {region: 0x165, script: 0x5a, flags: 0x0}, + 138: {region: 0x13f, script: 0x5a, flags: 0x0}, + 139: {region: 0x165, script: 0x5a, flags: 0x0}, + 140: {region: 0x165, script: 0x5a, flags: 0x0}, + 141: {region: 0xe7, script: 0x5a, flags: 0x0}, + 142: {region: 0x165, script: 0x5a, flags: 0x0}, + 143: {region: 0xd6, script: 0x5a, flags: 0x0}, + 144: {region: 0x165, script: 0x5a, flags: 0x0}, + 145: {region: 0x165, script: 0x5a, flags: 0x0}, + 146: {region: 0x165, script: 0x5a, flags: 0x0}, + 147: {region: 0x165, script: 0x2c, flags: 0x0}, + 148: {region: 0x99, script: 0x22, flags: 0x0}, + 149: {region: 0x95, script: 0x5a, flags: 0x0}, + 150: {region: 0x165, script: 0x5a, flags: 0x0}, + 151: {region: 0x165, script: 0x5a, flags: 0x0}, + 152: {region: 0x114, script: 0x5a, flags: 0x0}, + 153: {region: 0x165, script: 0x5a, flags: 0x0}, + 154: {region: 0x165, script: 0x5a, flags: 0x0}, + 155: {region: 0x52, script: 0x5a, flags: 0x0}, + 156: {region: 0x165, script: 0x5a, flags: 0x0}, + 157: {region: 0xe7, script: 0x5a, flags: 0x0}, + 158: {region: 0x165, script: 0x5a, flags: 0x0}, + 159: {region: 0x13e, script: 0xe0, flags: 0x0}, + 160: {region: 0xc3, script: 0x5a, flags: 0x0}, + 161: {region: 0x165, script: 0x5a, flags: 0x0}, + 162: {region: 0x165, script: 0x5a, flags: 0x0}, + 163: {region: 0xc3, script: 0x5a, flags: 0x0}, + 164: {region: 0x165, script: 0x5a, flags: 0x0}, + 165: {region: 0x35, script: 0xe, flags: 0x0}, + 166: {region: 0x165, script: 0x5a, flags: 0x0}, + 167: {region: 0x165, script: 0x5a, flags: 0x0}, + 168: {region: 0x165, script: 0x5a, flags: 0x0}, + 169: {region: 0x53, script: 0xe7, flags: 0x0}, + 170: {region: 0x165, script: 0x5a, flags: 0x0}, + 171: {region: 0x165, script: 0x5a, flags: 0x0}, + 172: {region: 0x165, script: 0x5a, flags: 0x0}, + 173: {region: 0x99, script: 0xe, flags: 0x0}, + 174: {region: 0x165, script: 0x5a, flags: 0x0}, + 175: {region: 0x9c, script: 0x5, flags: 0x0}, + 176: {region: 0x165, script: 0x5a, flags: 0x0}, + 177: {region: 0x4f, script: 0x5a, flags: 0x0}, + 178: {region: 0x78, script: 0x5a, flags: 0x0}, + 179: {region: 0x99, script: 0x22, flags: 0x0}, + 180: {region: 0xe8, script: 0x5, flags: 0x0}, + 181: {region: 0x99, script: 0x22, flags: 0x0}, + 182: {region: 0x165, script: 0x5a, flags: 0x0}, + 183: {region: 0x33, script: 0x5a, flags: 0x0}, + 184: {region: 0x165, script: 0x5a, flags: 0x0}, + 185: {region: 0xb4, script: 0xc, flags: 0x0}, + 186: {region: 0x52, script: 0x5a, flags: 0x0}, + 187: {region: 0x165, script: 0x2c, flags: 0x0}, + 188: {region: 0xe7, script: 0x5a, flags: 0x0}, + 189: {region: 0x165, script: 0x5a, flags: 0x0}, + 190: {region: 0xe8, script: 0x22, flags: 0x0}, + 191: {region: 0x106, script: 0x20, flags: 0x0}, + 192: {region: 0x15f, script: 0x5a, flags: 0x0}, + 193: {region: 0x165, script: 0x5a, flags: 0x0}, + 194: {region: 0x95, script: 0x5a, flags: 0x0}, + 195: {region: 0x165, script: 0x5a, flags: 0x0}, + 196: {region: 0x52, script: 0x5a, flags: 0x0}, + 197: {region: 0x165, script: 0x5a, flags: 0x0}, + 198: {region: 0x165, script: 0x5a, flags: 0x0}, + 199: {region: 0x165, script: 0x5a, flags: 0x0}, + 200: {region: 0x86, script: 0x5a, flags: 0x0}, + 201: {region: 0x165, script: 0x5a, flags: 0x0}, + 202: {region: 0x165, script: 0x5a, flags: 0x0}, + 203: {region: 0x165, script: 0x5a, flags: 0x0}, + 204: {region: 0x165, script: 0x5a, flags: 0x0}, + 205: {region: 0x6d, script: 0x2c, flags: 0x0}, + 206: {region: 0x165, script: 0x5a, flags: 0x0}, + 207: {region: 0x165, script: 0x5a, flags: 0x0}, + 208: {region: 0x52, script: 0x5a, flags: 0x0}, + 209: {region: 0x165, script: 0x5a, flags: 0x0}, + 210: {region: 0x165, script: 0x5a, flags: 0x0}, + 211: {region: 0xc3, script: 0x5a, flags: 0x0}, + 212: {region: 0x165, script: 0x5a, flags: 0x0}, + 213: {region: 0x165, script: 0x5a, flags: 0x0}, + 214: {region: 0x165, script: 0x5a, flags: 0x0}, + 215: {region: 0x6e, script: 0x5a, flags: 0x0}, + 216: {region: 0x165, script: 0x5a, flags: 0x0}, + 217: {region: 0x165, script: 0x5a, flags: 0x0}, + 218: {region: 0xd6, script: 0x5a, flags: 0x0}, + 219: {region: 0x35, script: 0x16, flags: 0x0}, + 220: {region: 0x106, script: 0x20, flags: 0x0}, + 221: {region: 0xe7, script: 0x5a, flags: 0x0}, + 222: {region: 0x165, script: 0x5a, flags: 0x0}, + 223: {region: 0x131, script: 0x5a, flags: 0x0}, + 224: {region: 0x8a, script: 0x5a, flags: 0x0}, + 225: {region: 0x75, script: 0x5a, flags: 0x0}, + 226: {region: 0x106, script: 0x20, flags: 0x0}, + 227: {region: 0x135, script: 0x5a, flags: 0x0}, + 228: {region: 0x49, script: 0x5a, flags: 0x0}, + 229: {region: 0x135, script: 0x1a, flags: 0x0}, + 230: {region: 0xa6, script: 0x5, flags: 0x0}, + 231: {region: 0x13e, script: 0x19, flags: 0x0}, + 232: {region: 0x165, script: 0x5a, flags: 0x0}, + 233: {region: 0x9b, script: 0x5, flags: 0x0}, + 234: {region: 0x165, script: 0x5a, flags: 0x0}, + 235: {region: 0x165, script: 0x5a, flags: 0x0}, + 236: {region: 0x165, script: 0x5a, flags: 0x0}, + 237: {region: 0x165, script: 0x5a, flags: 0x0}, + 238: {region: 0x165, script: 0x5a, flags: 0x0}, + 239: {region: 0xc5, script: 0xd3, flags: 0x0}, + 240: {region: 0x78, script: 0x5a, flags: 0x0}, + 241: {region: 0x6b, script: 0x1d, flags: 0x0}, + 242: {region: 0xe7, script: 0x5a, flags: 0x0}, + 243: {region: 0x49, script: 0x17, flags: 0x0}, + 244: {region: 0x130, script: 0x20, flags: 0x0}, + 245: {region: 0x49, script: 0x17, flags: 0x0}, + 246: {region: 0x49, script: 0x17, flags: 0x0}, + 247: {region: 0x49, script: 0x17, flags: 0x0}, + 248: {region: 0x49, script: 0x17, flags: 0x0}, + 249: {region: 0x10a, script: 0x5a, flags: 0x0}, + 250: {region: 0x5e, script: 0x5a, flags: 0x0}, + 251: {region: 0xe9, script: 0x5a, flags: 0x0}, + 252: {region: 0x49, script: 0x17, flags: 0x0}, + 253: {region: 0xc4, script: 0x85, flags: 0x0}, + 254: {region: 0x8, script: 0x2, flags: 0x1}, + 255: {region: 0x106, script: 0x20, flags: 0x0}, + 256: {region: 0x7b, script: 0x5a, flags: 0x0}, + 257: {region: 0x63, script: 0x5a, flags: 0x0}, + 258: {region: 0x165, script: 0x5a, flags: 0x0}, + 259: {region: 0x165, script: 0x5a, flags: 0x0}, + 260: {region: 0x165, script: 0x5a, flags: 0x0}, + 261: {region: 0x165, script: 0x5a, flags: 0x0}, + 262: {region: 0x135, script: 0x5a, flags: 0x0}, + 263: {region: 0x106, script: 0x20, flags: 0x0}, + 264: {region: 0xa4, script: 0x5a, flags: 0x0}, + 265: {region: 0x165, script: 0x5a, flags: 0x0}, + 266: {region: 0x165, script: 0x5a, flags: 0x0}, + 267: {region: 0x99, script: 0x5, flags: 0x0}, + 268: {region: 0x165, script: 0x5a, flags: 0x0}, + 269: {region: 0x60, script: 0x5a, flags: 0x0}, + 270: {region: 0x165, script: 0x5a, flags: 0x0}, + 271: {region: 0x49, script: 0x5a, flags: 0x0}, + 272: {region: 0x165, script: 0x5a, flags: 0x0}, + 273: {region: 0x165, script: 0x5a, flags: 0x0}, + 274: {region: 0x165, script: 0x5a, flags: 0x0}, + 275: {region: 0x165, script: 0x5, flags: 0x0}, + 276: {region: 0x49, script: 0x5a, flags: 0x0}, + 277: {region: 0x165, script: 0x5a, flags: 0x0}, + 278: {region: 0x165, script: 0x5a, flags: 0x0}, + 279: {region: 0xd4, script: 0x5a, flags: 0x0}, + 280: {region: 0x4f, script: 0x5a, flags: 0x0}, + 281: {region: 0x165, script: 0x5a, flags: 0x0}, + 282: {region: 0x99, script: 0x5, flags: 0x0}, + 283: {region: 0x165, script: 0x5a, flags: 0x0}, + 284: {region: 0x165, script: 0x5a, flags: 0x0}, + 285: {region: 0x165, script: 0x5a, flags: 0x0}, + 286: {region: 0x165, script: 0x2c, flags: 0x0}, + 287: {region: 0x60, script: 0x5a, flags: 0x0}, + 288: {region: 0xc3, script: 0x5a, flags: 0x0}, + 289: {region: 0xd0, script: 0x5a, flags: 0x0}, + 290: {region: 0x165, script: 0x5a, flags: 0x0}, + 291: {region: 0xdb, script: 0x22, flags: 0x0}, + 292: {region: 0x52, script: 0x5a, flags: 0x0}, + 293: {region: 0x165, script: 0x5a, flags: 0x0}, + 294: {region: 0x165, script: 0x5a, flags: 0x0}, + 295: {region: 0x165, script: 0x5a, flags: 0x0}, + 296: {region: 0xcd, script: 0xe5, flags: 0x0}, + 297: {region: 0x165, script: 0x5a, flags: 0x0}, + 298: {region: 0x165, script: 0x5a, flags: 0x0}, + 299: {region: 0x114, script: 0x5a, flags: 0x0}, + 300: {region: 0x37, script: 0x5a, flags: 0x0}, + 301: {region: 0x43, script: 0xe7, flags: 0x0}, + 302: {region: 0x165, script: 0x5a, flags: 0x0}, + 303: {region: 0xa4, script: 0x5a, flags: 0x0}, + 304: {region: 0x80, script: 0x5a, flags: 0x0}, + 305: {region: 0xd6, script: 0x5a, flags: 0x0}, + 306: {region: 0x9e, script: 0x5a, flags: 0x0}, + 307: {region: 0x6b, script: 0x29, flags: 0x0}, + 308: {region: 0x165, script: 0x5a, flags: 0x0}, + 309: {region: 0xc4, script: 0x4b, flags: 0x0}, + 310: {region: 0x87, script: 0x34, flags: 0x0}, + 311: {region: 0x165, script: 0x5a, flags: 0x0}, + 312: {region: 0x165, script: 0x5a, flags: 0x0}, + 313: {region: 0xa, script: 0x2, flags: 0x1}, + 314: {region: 0x165, script: 0x5a, flags: 0x0}, + 315: {region: 0x165, script: 0x5a, flags: 0x0}, + 316: {region: 0x1, script: 0x5a, flags: 0x0}, + 317: {region: 0x165, script: 0x5a, flags: 0x0}, + 318: {region: 0x6e, script: 0x5a, flags: 0x0}, + 319: {region: 0x135, script: 0x5a, flags: 0x0}, + 320: {region: 0x6a, script: 0x5a, flags: 0x0}, + 321: {region: 0x165, script: 0x5a, flags: 0x0}, + 322: {region: 0x9e, script: 0x46, flags: 0x0}, + 323: {region: 0x165, script: 0x5a, flags: 0x0}, + 324: {region: 0x165, script: 0x5a, flags: 0x0}, + 325: {region: 0x6e, script: 0x5a, flags: 0x0}, + 326: {region: 0x52, script: 0x5a, flags: 0x0}, + 327: {region: 0x6e, script: 0x5a, flags: 0x0}, + 328: {region: 0x9c, script: 0x5, flags: 0x0}, + 329: {region: 0x165, script: 0x5a, flags: 0x0}, + 330: {region: 0x165, script: 0x5a, flags: 0x0}, + 331: {region: 0x165, script: 0x5a, flags: 0x0}, + 332: {region: 0x165, script: 0x5a, flags: 0x0}, + 333: {region: 0x86, script: 0x5a, flags: 0x0}, + 334: {region: 0xc, script: 0x2, flags: 0x1}, + 335: {region: 0x165, script: 0x5a, flags: 0x0}, + 336: {region: 0xc3, script: 0x5a, flags: 0x0}, + 337: {region: 0x72, script: 0x5a, flags: 0x0}, + 338: {region: 0x10b, script: 0x5, flags: 0x0}, + 339: {region: 0xe7, script: 0x5a, flags: 0x0}, + 340: {region: 0x10c, script: 0x5a, flags: 0x0}, + 341: {region: 0x73, script: 0x5a, flags: 0x0}, + 342: {region: 0x165, script: 0x5a, flags: 0x0}, + 343: {region: 0x165, script: 0x5a, flags: 0x0}, + 344: {region: 0x76, script: 0x5a, flags: 0x0}, + 345: {region: 0x165, script: 0x5a, flags: 0x0}, + 346: {region: 0x3b, script: 0x5a, flags: 0x0}, + 347: {region: 0x165, script: 0x5a, flags: 0x0}, + 348: {region: 0x165, script: 0x5a, flags: 0x0}, + 349: {region: 0x165, script: 0x5a, flags: 0x0}, + 350: {region: 0x78, script: 0x5a, flags: 0x0}, + 351: {region: 0x135, script: 0x5a, flags: 0x0}, + 352: {region: 0x78, script: 0x5a, flags: 0x0}, + 353: {region: 0x60, script: 0x5a, flags: 0x0}, + 354: {region: 0x60, script: 0x5a, flags: 0x0}, + 355: {region: 0x52, script: 0x5, flags: 0x0}, + 356: {region: 0x140, script: 0x5a, flags: 0x0}, + 357: {region: 0x165, script: 0x5a, flags: 0x0}, + 358: {region: 0x84, script: 0x5a, flags: 0x0}, + 359: {region: 0x165, script: 0x5a, flags: 0x0}, + 360: {region: 0xd4, script: 0x5a, flags: 0x0}, + 361: {region: 0x9e, script: 0x5a, flags: 0x0}, + 362: {region: 0xd6, script: 0x5a, flags: 0x0}, + 363: {region: 0x165, script: 0x5a, flags: 0x0}, + 364: {region: 0x10b, script: 0x5a, flags: 0x0}, + 365: {region: 0xd9, script: 0x5a, flags: 0x0}, + 366: {region: 0x96, script: 0x5a, flags: 0x0}, + 367: {region: 0x80, script: 0x5a, flags: 0x0}, + 368: {region: 0x165, script: 0x5a, flags: 0x0}, + 369: {region: 0xbc, script: 0x5a, flags: 0x0}, + 370: {region: 0x165, script: 0x5a, flags: 0x0}, + 371: {region: 0x165, script: 0x5a, flags: 0x0}, + 372: {region: 0x165, script: 0x5a, flags: 0x0}, + 373: {region: 0x53, script: 0x3b, flags: 0x0}, + 374: {region: 0x165, script: 0x5a, flags: 0x0}, + 375: {region: 0x95, script: 0x5a, flags: 0x0}, + 376: {region: 0x165, script: 0x5a, flags: 0x0}, + 377: {region: 0x165, script: 0x5a, flags: 0x0}, + 378: {region: 0x99, script: 0x22, flags: 0x0}, + 379: {region: 0x165, script: 0x5a, flags: 0x0}, + 380: {region: 0x9c, script: 0x5, flags: 0x0}, + 381: {region: 0x7e, script: 0x5a, flags: 0x0}, + 382: {region: 0x7b, script: 0x5a, flags: 0x0}, + 383: {region: 0x165, script: 0x5a, flags: 0x0}, + 384: {region: 0x165, script: 0x5a, flags: 0x0}, + 385: {region: 0x165, script: 0x5a, flags: 0x0}, + 386: {region: 0x165, script: 0x5a, flags: 0x0}, + 387: {region: 0x165, script: 0x5a, flags: 0x0}, + 388: {region: 0x165, script: 0x5a, flags: 0x0}, + 389: {region: 0x6f, script: 0x2c, flags: 0x0}, + 390: {region: 0x165, script: 0x5a, flags: 0x0}, + 391: {region: 0xdb, script: 0x22, flags: 0x0}, + 392: {region: 0x165, script: 0x5a, flags: 0x0}, + 393: {region: 0xa7, script: 0x5a, flags: 0x0}, + 394: {region: 0x165, script: 0x5a, flags: 0x0}, + 395: {region: 0xe8, script: 0x5, flags: 0x0}, + 396: {region: 0x165, script: 0x5a, flags: 0x0}, + 397: {region: 0xe8, script: 0x5, flags: 0x0}, + 398: {region: 0x165, script: 0x5a, flags: 0x0}, + 399: {region: 0x165, script: 0x5a, flags: 0x0}, + 400: {region: 0x6e, script: 0x5a, flags: 0x0}, + 401: {region: 0x9c, script: 0x5, flags: 0x0}, + 402: {region: 0x165, script: 0x5a, flags: 0x0}, + 403: {region: 0x165, script: 0x2c, flags: 0x0}, + 404: {region: 0xf1, script: 0x5a, flags: 0x0}, + 405: {region: 0x165, script: 0x5a, flags: 0x0}, + 406: {region: 0x165, script: 0x5a, flags: 0x0}, + 407: {region: 0x165, script: 0x5a, flags: 0x0}, + 408: {region: 0x165, script: 0x2c, flags: 0x0}, + 409: {region: 0x165, script: 0x5a, flags: 0x0}, + 410: {region: 0x99, script: 0x22, flags: 0x0}, + 411: {region: 0x99, script: 0xe1, flags: 0x0}, + 412: {region: 0x95, script: 0x5a, flags: 0x0}, + 413: {region: 0xd9, script: 0x5a, flags: 0x0}, + 414: {region: 0x130, script: 0x32, flags: 0x0}, + 415: {region: 0x165, script: 0x5a, flags: 0x0}, + 416: {region: 0xe, script: 0x2, flags: 0x1}, + 417: {region: 0x99, script: 0xe, flags: 0x0}, + 418: {region: 0x165, script: 0x5a, flags: 0x0}, + 419: {region: 0x4e, script: 0x5a, flags: 0x0}, + 420: {region: 0x99, script: 0x35, flags: 0x0}, + 421: {region: 0x41, script: 0x5a, flags: 0x0}, + 422: {region: 0x54, script: 0x5a, flags: 0x0}, + 423: {region: 0x165, script: 0x5a, flags: 0x0}, + 424: {region: 0x80, script: 0x5a, flags: 0x0}, + 425: {region: 0x165, script: 0x5a, flags: 0x0}, + 426: {region: 0x165, script: 0x5a, flags: 0x0}, + 427: {region: 0xa4, script: 0x5a, flags: 0x0}, + 428: {region: 0x98, script: 0x5a, flags: 0x0}, + 429: {region: 0x165, script: 0x5a, flags: 0x0}, + 430: {region: 0xdb, script: 0x22, flags: 0x0}, + 431: {region: 0x165, script: 0x5a, flags: 0x0}, + 432: {region: 0x165, script: 0x5, flags: 0x0}, + 433: {region: 0x49, script: 0x5a, flags: 0x0}, + 434: {region: 0x165, script: 0x5, flags: 0x0}, + 435: {region: 0x165, script: 0x5a, flags: 0x0}, + 436: {region: 0x10, script: 0x3, flags: 0x1}, + 437: {region: 0x165, script: 0x5a, flags: 0x0}, + 438: {region: 0x53, script: 0x3b, flags: 0x0}, + 439: {region: 0x165, script: 0x5a, flags: 0x0}, + 440: {region: 0x135, script: 0x5a, flags: 0x0}, + 441: {region: 0x24, script: 0x5, flags: 0x0}, + 442: {region: 0x165, script: 0x5a, flags: 0x0}, + 443: {region: 0x165, script: 0x2c, flags: 0x0}, + 444: {region: 0x97, script: 0x3e, flags: 0x0}, + 445: {region: 0x165, script: 0x5a, flags: 0x0}, + 446: {region: 0x99, script: 0x22, flags: 0x0}, + 447: {region: 0x165, script: 0x5a, flags: 0x0}, + 448: {region: 0x73, script: 0x5a, flags: 0x0}, + 449: {region: 0x165, script: 0x5a, flags: 0x0}, + 450: {region: 0x165, script: 0x5a, flags: 0x0}, + 451: {region: 0xe7, script: 0x5a, flags: 0x0}, + 452: {region: 0x165, script: 0x5a, flags: 0x0}, + 453: {region: 0x12b, script: 0x40, flags: 0x0}, + 454: {region: 0x53, script: 0x8d, flags: 0x0}, + 455: {region: 0x165, script: 0x5a, flags: 0x0}, + 456: {region: 0xe8, script: 0x5, flags: 0x0}, + 457: {region: 0x99, script: 0x22, flags: 0x0}, + 458: {region: 0xaf, script: 0x41, flags: 0x0}, + 459: {region: 0xe7, script: 0x5a, flags: 0x0}, + 460: {region: 0xe8, script: 0x5, flags: 0x0}, + 461: {region: 0xe6, script: 0x5a, flags: 0x0}, + 462: {region: 0x99, script: 0x22, flags: 0x0}, + 463: {region: 0x99, script: 0x22, flags: 0x0}, + 464: {region: 0x165, script: 0x5a, flags: 0x0}, + 465: {region: 0x90, script: 0x5a, flags: 0x0}, + 466: {region: 0x60, script: 0x5a, flags: 0x0}, + 467: {region: 0x53, script: 0x3b, flags: 0x0}, + 468: {region: 0x91, script: 0x5a, flags: 0x0}, + 469: {region: 0x92, script: 0x5a, flags: 0x0}, + 470: {region: 0x165, script: 0x5a, flags: 0x0}, + 471: {region: 0x28, script: 0x8, flags: 0x0}, + 472: {region: 0xd2, script: 0x5a, flags: 0x0}, + 473: {region: 0x78, script: 0x5a, flags: 0x0}, + 474: {region: 0x165, script: 0x5a, flags: 0x0}, + 475: {region: 0x165, script: 0x5a, flags: 0x0}, + 476: {region: 0xd0, script: 0x5a, flags: 0x0}, + 477: {region: 0xd6, script: 0x5a, flags: 0x0}, + 478: {region: 0x165, script: 0x5a, flags: 0x0}, + 479: {region: 0x165, script: 0x5a, flags: 0x0}, + 480: {region: 0x165, script: 0x5a, flags: 0x0}, + 481: {region: 0x95, script: 0x5a, flags: 0x0}, + 482: {region: 0x165, script: 0x5a, flags: 0x0}, + 483: {region: 0x165, script: 0x5a, flags: 0x0}, + 484: {region: 0x165, script: 0x5a, flags: 0x0}, + 486: {region: 0x122, script: 0x5a, flags: 0x0}, + 487: {region: 0xd6, script: 0x5a, flags: 0x0}, + 488: {region: 0x165, script: 0x5a, flags: 0x0}, + 489: {region: 0x165, script: 0x5a, flags: 0x0}, + 490: {region: 0x53, script: 0xf3, flags: 0x0}, + 491: {region: 0x165, script: 0x5a, flags: 0x0}, + 492: {region: 0x135, script: 0x5a, flags: 0x0}, + 493: {region: 0x165, script: 0x5a, flags: 0x0}, + 494: {region: 0x49, script: 0x5a, flags: 0x0}, + 495: {region: 0x165, script: 0x5a, flags: 0x0}, + 496: {region: 0x165, script: 0x5a, flags: 0x0}, + 497: {region: 0xe7, script: 0x5a, flags: 0x0}, + 498: {region: 0x165, script: 0x5a, flags: 0x0}, + 499: {region: 0x95, script: 0x5a, flags: 0x0}, + 500: {region: 0x106, script: 0x20, flags: 0x0}, + 501: {region: 0x1, script: 0x5a, flags: 0x0}, + 502: {region: 0x165, script: 0x5a, flags: 0x0}, + 503: {region: 0x165, script: 0x5a, flags: 0x0}, + 504: {region: 0x9d, script: 0x5a, flags: 0x0}, + 505: {region: 0x9e, script: 0x5a, flags: 0x0}, + 506: {region: 0x49, script: 0x17, flags: 0x0}, + 507: {region: 0x97, script: 0x3e, flags: 0x0}, + 508: {region: 0x165, script: 0x5a, flags: 0x0}, + 509: {region: 0x165, script: 0x5a, flags: 0x0}, + 510: {region: 0x106, script: 0x5a, flags: 0x0}, + 511: {region: 0x165, script: 0x5a, flags: 0x0}, + 512: {region: 0xa2, script: 0x49, flags: 0x0}, + 513: {region: 0x165, script: 0x5a, flags: 0x0}, + 514: {region: 0xa0, script: 0x5a, flags: 0x0}, + 515: {region: 0x1, script: 0x5a, flags: 0x0}, + 516: {region: 0x165, script: 0x5a, flags: 0x0}, + 517: {region: 0x165, script: 0x5a, flags: 0x0}, + 518: {region: 0x165, script: 0x5a, flags: 0x0}, + 519: {region: 0x52, script: 0x5a, flags: 0x0}, + 520: {region: 0x130, script: 0x3e, flags: 0x0}, + 521: {region: 0x165, script: 0x5a, flags: 0x0}, + 522: {region: 0x12f, script: 0x5a, flags: 0x0}, + 523: {region: 0xdb, script: 0x22, flags: 0x0}, + 524: {region: 0x165, script: 0x5a, flags: 0x0}, + 525: {region: 0x63, script: 0x5a, flags: 0x0}, + 526: {region: 0x95, script: 0x5a, flags: 0x0}, + 527: {region: 0x95, script: 0x5a, flags: 0x0}, + 528: {region: 0x7d, script: 0x2e, flags: 0x0}, + 529: {region: 0x137, script: 0x20, flags: 0x0}, + 530: {region: 0x67, script: 0x5a, flags: 0x0}, + 531: {region: 0xc4, script: 0x5a, flags: 0x0}, + 532: {region: 0x165, script: 0x5a, flags: 0x0}, + 533: {region: 0x165, script: 0x5a, flags: 0x0}, + 534: {region: 0xd6, script: 0x5a, flags: 0x0}, + 535: {region: 0xa4, script: 0x5a, flags: 0x0}, + 536: {region: 0xc3, script: 0x5a, flags: 0x0}, + 537: {region: 0x106, script: 0x20, flags: 0x0}, + 538: {region: 0x165, script: 0x5a, flags: 0x0}, + 539: {region: 0x165, script: 0x5a, flags: 0x0}, + 540: {region: 0x165, script: 0x5a, flags: 0x0}, + 541: {region: 0x165, script: 0x5a, flags: 0x0}, + 542: {region: 0xd4, script: 0x5, flags: 0x0}, + 543: {region: 0xd6, script: 0x5a, flags: 0x0}, + 544: {region: 0x164, script: 0x5a, flags: 0x0}, + 545: {region: 0x165, script: 0x5a, flags: 0x0}, + 546: {region: 0x165, script: 0x5a, flags: 0x0}, + 547: {region: 0x12f, script: 0x5a, flags: 0x0}, + 548: {region: 0x122, script: 0x5, flags: 0x0}, + 549: {region: 0x165, script: 0x5a, flags: 0x0}, + 550: {region: 0x123, script: 0xe6, flags: 0x0}, + 551: {region: 0x5a, script: 0x5a, flags: 0x0}, + 552: {region: 0x52, script: 0x5a, flags: 0x0}, + 553: {region: 0x165, script: 0x5a, flags: 0x0}, + 554: {region: 0x4f, script: 0x5a, flags: 0x0}, + 555: {region: 0x99, script: 0x22, flags: 0x0}, + 556: {region: 0x99, script: 0x22, flags: 0x0}, + 557: {region: 0x4b, script: 0x5a, flags: 0x0}, + 558: {region: 0x95, script: 0x5a, flags: 0x0}, + 559: {region: 0x165, script: 0x5a, flags: 0x0}, + 560: {region: 0x41, script: 0x5a, flags: 0x0}, + 561: {region: 0x99, script: 0x5a, flags: 0x0}, + 562: {region: 0x53, script: 0xdd, flags: 0x0}, + 563: {region: 0x99, script: 0x22, flags: 0x0}, + 564: {region: 0xc3, script: 0x5a, flags: 0x0}, + 565: {region: 0x165, script: 0x5a, flags: 0x0}, + 566: {region: 0x99, script: 0x75, flags: 0x0}, + 567: {region: 0xe8, script: 0x5, flags: 0x0}, + 568: {region: 0x165, script: 0x5a, flags: 0x0}, + 569: {region: 0xa4, script: 0x5a, flags: 0x0}, + 570: {region: 0x165, script: 0x5a, flags: 0x0}, + 571: {region: 0x12b, script: 0x5a, flags: 0x0}, + 572: {region: 0x165, script: 0x5a, flags: 0x0}, + 573: {region: 0xd2, script: 0x5a, flags: 0x0}, + 574: {region: 0x165, script: 0x5a, flags: 0x0}, + 575: {region: 0xaf, script: 0x57, flags: 0x0}, + 576: {region: 0x165, script: 0x5a, flags: 0x0}, + 577: {region: 0x165, script: 0x5a, flags: 0x0}, + 578: {region: 0x13, script: 0x6, flags: 0x1}, + 579: {region: 0x165, script: 0x5a, flags: 0x0}, + 580: {region: 0x52, script: 0x5a, flags: 0x0}, + 581: {region: 0x82, script: 0x5a, flags: 0x0}, + 582: {region: 0xa4, script: 0x5a, flags: 0x0}, + 583: {region: 0x165, script: 0x5a, flags: 0x0}, + 584: {region: 0x165, script: 0x5a, flags: 0x0}, + 585: {region: 0x165, script: 0x5a, flags: 0x0}, + 586: {region: 0xa6, script: 0x4e, flags: 0x0}, + 587: {region: 0x2a, script: 0x5a, flags: 0x0}, + 588: {region: 0x165, script: 0x5a, flags: 0x0}, + 589: {region: 0x165, script: 0x5a, flags: 0x0}, + 590: {region: 0x165, script: 0x5a, flags: 0x0}, + 591: {region: 0x165, script: 0x5a, flags: 0x0}, + 592: {region: 0x165, script: 0x5a, flags: 0x0}, + 593: {region: 0x99, script: 0x52, flags: 0x0}, + 594: {region: 0x8b, script: 0x5a, flags: 0x0}, + 595: {region: 0x165, script: 0x5a, flags: 0x0}, + 596: {region: 0xab, script: 0x53, flags: 0x0}, + 597: {region: 0x106, script: 0x20, flags: 0x0}, + 598: {region: 0x99, script: 0x22, flags: 0x0}, + 599: {region: 0x165, script: 0x5a, flags: 0x0}, + 600: {region: 0x75, script: 0x5a, flags: 0x0}, + 601: {region: 0x165, script: 0x5a, flags: 0x0}, + 602: {region: 0xb4, script: 0x5a, flags: 0x0}, + 603: {region: 0x165, script: 0x5a, flags: 0x0}, + 604: {region: 0x165, script: 0x5a, flags: 0x0}, + 605: {region: 0x165, script: 0x5a, flags: 0x0}, + 606: {region: 0x165, script: 0x5a, flags: 0x0}, + 607: {region: 0x165, script: 0x5a, flags: 0x0}, + 608: {region: 0x165, script: 0x5a, flags: 0x0}, + 609: {region: 0x165, script: 0x5a, flags: 0x0}, + 610: {region: 0x165, script: 0x2c, flags: 0x0}, + 611: {region: 0x165, script: 0x5a, flags: 0x0}, + 612: {region: 0x106, script: 0x20, flags: 0x0}, + 613: {region: 0x112, script: 0x5a, flags: 0x0}, + 614: {region: 0xe7, script: 0x5a, flags: 0x0}, + 615: {region: 0x106, script: 0x5a, flags: 0x0}, + 616: {region: 0x165, script: 0x5a, flags: 0x0}, + 617: {region: 0x99, script: 0x22, flags: 0x0}, + 618: {region: 0x99, script: 0x5, flags: 0x0}, + 619: {region: 0x12f, script: 0x5a, flags: 0x0}, + 620: {region: 0x165, script: 0x5a, flags: 0x0}, + 621: {region: 0x52, script: 0x5a, flags: 0x0}, + 622: {region: 0x60, script: 0x5a, flags: 0x0}, + 623: {region: 0x165, script: 0x5a, flags: 0x0}, + 624: {region: 0x165, script: 0x5a, flags: 0x0}, + 625: {region: 0x165, script: 0x2c, flags: 0x0}, + 626: {region: 0x165, script: 0x5a, flags: 0x0}, + 627: {region: 0x165, script: 0x5a, flags: 0x0}, + 628: {region: 0x19, script: 0x3, flags: 0x1}, + 629: {region: 0x165, script: 0x5a, flags: 0x0}, + 630: {region: 0x165, script: 0x5a, flags: 0x0}, + 631: {region: 0x165, script: 0x5a, flags: 0x0}, + 632: {region: 0x165, script: 0x5a, flags: 0x0}, + 633: {region: 0x106, script: 0x20, flags: 0x0}, + 634: {region: 0x165, script: 0x5a, flags: 0x0}, + 635: {region: 0x165, script: 0x5a, flags: 0x0}, + 636: {region: 0x165, script: 0x5a, flags: 0x0}, + 637: {region: 0x106, script: 0x20, flags: 0x0}, + 638: {region: 0x165, script: 0x5a, flags: 0x0}, + 639: {region: 0x95, script: 0x5a, flags: 0x0}, + 640: {region: 0xe8, script: 0x5, flags: 0x0}, + 641: {region: 0x7b, script: 0x5a, flags: 0x0}, + 642: {region: 0x165, script: 0x5a, flags: 0x0}, + 643: {region: 0x165, script: 0x5a, flags: 0x0}, + 644: {region: 0x165, script: 0x5a, flags: 0x0}, + 645: {region: 0x165, script: 0x2c, flags: 0x0}, + 646: {region: 0x123, script: 0xe6, flags: 0x0}, + 647: {region: 0xe8, script: 0x5, flags: 0x0}, + 648: {region: 0x165, script: 0x5a, flags: 0x0}, + 649: {region: 0x165, script: 0x5a, flags: 0x0}, + 650: {region: 0x1c, script: 0x5, flags: 0x1}, + 651: {region: 0x165, script: 0x5a, flags: 0x0}, + 652: {region: 0x165, script: 0x5a, flags: 0x0}, + 653: {region: 0x165, script: 0x5a, flags: 0x0}, + 654: {region: 0x138, script: 0x5a, flags: 0x0}, + 655: {region: 0x87, script: 0x5e, flags: 0x0}, + 656: {region: 0x97, script: 0x3e, flags: 0x0}, + 657: {region: 0x12f, script: 0x5a, flags: 0x0}, + 658: {region: 0xe8, script: 0x5, flags: 0x0}, + 659: {region: 0x131, script: 0x5a, flags: 0x0}, + 660: {region: 0x165, script: 0x5a, flags: 0x0}, + 661: {region: 0xb7, script: 0x5a, flags: 0x0}, + 662: {region: 0x106, script: 0x20, flags: 0x0}, + 663: {region: 0x165, script: 0x5a, flags: 0x0}, + 664: {region: 0x95, script: 0x5a, flags: 0x0}, + 665: {region: 0x165, script: 0x5a, flags: 0x0}, + 666: {region: 0x53, script: 0xe6, flags: 0x0}, + 667: {region: 0x165, script: 0x5a, flags: 0x0}, + 668: {region: 0x165, script: 0x5a, flags: 0x0}, + 669: {region: 0x165, script: 0x5a, flags: 0x0}, + 670: {region: 0x165, script: 0x5a, flags: 0x0}, + 671: {region: 0x99, script: 0x5c, flags: 0x0}, + 672: {region: 0x165, script: 0x5a, flags: 0x0}, + 673: {region: 0x165, script: 0x5a, flags: 0x0}, + 674: {region: 0x106, script: 0x20, flags: 0x0}, + 675: {region: 0x131, script: 0x5a, flags: 0x0}, + 676: {region: 0x165, script: 0x5a, flags: 0x0}, + 677: {region: 0xd9, script: 0x5a, flags: 0x0}, + 678: {region: 0x165, script: 0x5a, flags: 0x0}, + 679: {region: 0x165, script: 0x5a, flags: 0x0}, + 680: {region: 0x21, script: 0x2, flags: 0x1}, + 681: {region: 0x165, script: 0x5a, flags: 0x0}, + 682: {region: 0x165, script: 0x5a, flags: 0x0}, + 683: {region: 0x9e, script: 0x5a, flags: 0x0}, + 684: {region: 0x53, script: 0x60, flags: 0x0}, + 685: {region: 0x95, script: 0x5a, flags: 0x0}, + 686: {region: 0x9c, script: 0x5, flags: 0x0}, + 687: {region: 0x135, script: 0x5a, flags: 0x0}, + 688: {region: 0x165, script: 0x5a, flags: 0x0}, + 689: {region: 0x165, script: 0x5a, flags: 0x0}, + 690: {region: 0x99, script: 0xe1, flags: 0x0}, + 691: {region: 0x9e, script: 0x5a, flags: 0x0}, + 692: {region: 0x165, script: 0x5a, flags: 0x0}, + 693: {region: 0x4b, script: 0x5a, flags: 0x0}, + 694: {region: 0x165, script: 0x5a, flags: 0x0}, + 695: {region: 0x165, script: 0x5a, flags: 0x0}, + 696: {region: 0xaf, script: 0x57, flags: 0x0}, + 697: {region: 0x165, script: 0x5a, flags: 0x0}, + 698: {region: 0x165, script: 0x5a, flags: 0x0}, + 699: {region: 0x4b, script: 0x5a, flags: 0x0}, + 700: {region: 0x165, script: 0x5a, flags: 0x0}, + 701: {region: 0x165, script: 0x5a, flags: 0x0}, + 702: {region: 0x162, script: 0x5a, flags: 0x0}, + 703: {region: 0x9c, script: 0x5, flags: 0x0}, + 704: {region: 0xb6, script: 0x5a, flags: 0x0}, + 705: {region: 0xb8, script: 0x5a, flags: 0x0}, + 706: {region: 0x4b, script: 0x5a, flags: 0x0}, + 707: {region: 0x4b, script: 0x5a, flags: 0x0}, + 708: {region: 0xa4, script: 0x5a, flags: 0x0}, + 709: {region: 0xa4, script: 0x5a, flags: 0x0}, + 710: {region: 0x9c, script: 0x5, flags: 0x0}, + 711: {region: 0xb8, script: 0x5a, flags: 0x0}, + 712: {region: 0x123, script: 0xe6, flags: 0x0}, + 713: {region: 0x53, script: 0x3b, flags: 0x0}, + 714: {region: 0x12b, script: 0x5a, flags: 0x0}, + 715: {region: 0x95, script: 0x5a, flags: 0x0}, + 716: {region: 0x52, script: 0x5a, flags: 0x0}, + 717: {region: 0x99, script: 0x22, flags: 0x0}, + 718: {region: 0x99, script: 0x22, flags: 0x0}, + 719: {region: 0x95, script: 0x5a, flags: 0x0}, + 720: {region: 0x23, script: 0x3, flags: 0x1}, + 721: {region: 0xa4, script: 0x5a, flags: 0x0}, + 722: {region: 0x165, script: 0x5a, flags: 0x0}, + 723: {region: 0xcf, script: 0x5a, flags: 0x0}, + 724: {region: 0x165, script: 0x5a, flags: 0x0}, + 725: {region: 0x165, script: 0x5a, flags: 0x0}, + 726: {region: 0x165, script: 0x5a, flags: 0x0}, + 727: {region: 0x165, script: 0x5a, flags: 0x0}, + 728: {region: 0x165, script: 0x5a, flags: 0x0}, + 729: {region: 0x165, script: 0x5a, flags: 0x0}, + 730: {region: 0x165, script: 0x5a, flags: 0x0}, + 731: {region: 0x165, script: 0x5a, flags: 0x0}, + 732: {region: 0x165, script: 0x5a, flags: 0x0}, + 733: {region: 0x165, script: 0x5a, flags: 0x0}, + 734: {region: 0x165, script: 0x5a, flags: 0x0}, + 735: {region: 0x165, script: 0x5, flags: 0x0}, + 736: {region: 0x106, script: 0x20, flags: 0x0}, + 737: {region: 0xe7, script: 0x5a, flags: 0x0}, + 738: {region: 0x165, script: 0x5a, flags: 0x0}, + 739: {region: 0x95, script: 0x5a, flags: 0x0}, + 740: {region: 0x165, script: 0x2c, flags: 0x0}, + 741: {region: 0x165, script: 0x5a, flags: 0x0}, + 742: {region: 0x165, script: 0x5a, flags: 0x0}, + 743: {region: 0x165, script: 0x5a, flags: 0x0}, + 744: {region: 0x112, script: 0x5a, flags: 0x0}, + 745: {region: 0xa4, script: 0x5a, flags: 0x0}, + 746: {region: 0x165, script: 0x5a, flags: 0x0}, + 747: {region: 0x165, script: 0x5a, flags: 0x0}, + 748: {region: 0x123, script: 0x5, flags: 0x0}, + 749: {region: 0xcc, script: 0x5a, flags: 0x0}, + 750: {region: 0x165, script: 0x5a, flags: 0x0}, + 751: {region: 0x165, script: 0x5a, flags: 0x0}, + 752: {region: 0x165, script: 0x5a, flags: 0x0}, + 753: {region: 0xbf, script: 0x5a, flags: 0x0}, + 754: {region: 0xd1, script: 0x5a, flags: 0x0}, + 755: {region: 0x165, script: 0x5a, flags: 0x0}, + 756: {region: 0x52, script: 0x5a, flags: 0x0}, + 757: {region: 0xdb, script: 0x22, flags: 0x0}, + 758: {region: 0x12f, script: 0x5a, flags: 0x0}, + 759: {region: 0xc0, script: 0x5a, flags: 0x0}, + 760: {region: 0x165, script: 0x5a, flags: 0x0}, + 761: {region: 0x165, script: 0x5a, flags: 0x0}, + 762: {region: 0xe0, script: 0x5a, flags: 0x0}, + 763: {region: 0x165, script: 0x5a, flags: 0x0}, + 764: {region: 0x95, script: 0x5a, flags: 0x0}, + 765: {region: 0x9b, script: 0x3d, flags: 0x0}, + 766: {region: 0x165, script: 0x5a, flags: 0x0}, + 767: {region: 0xc2, script: 0x20, flags: 0x0}, + 768: {region: 0x165, script: 0x5, flags: 0x0}, + 769: {region: 0x165, script: 0x5a, flags: 0x0}, + 770: {region: 0x165, script: 0x5a, flags: 0x0}, + 771: {region: 0x165, script: 0x5a, flags: 0x0}, + 772: {region: 0x99, script: 0x6e, flags: 0x0}, + 773: {region: 0x165, script: 0x5a, flags: 0x0}, + 774: {region: 0x165, script: 0x5a, flags: 0x0}, + 775: {region: 0x10b, script: 0x5a, flags: 0x0}, + 776: {region: 0x165, script: 0x5a, flags: 0x0}, + 777: {region: 0x165, script: 0x5a, flags: 0x0}, + 778: {region: 0x165, script: 0x5a, flags: 0x0}, + 779: {region: 0x26, script: 0x3, flags: 0x1}, + 780: {region: 0x165, script: 0x5a, flags: 0x0}, + 781: {region: 0x165, script: 0x5a, flags: 0x0}, + 782: {region: 0x99, script: 0xe, flags: 0x0}, + 783: {region: 0xc4, script: 0x75, flags: 0x0}, + 785: {region: 0x165, script: 0x5a, flags: 0x0}, + 786: {region: 0x49, script: 0x5a, flags: 0x0}, + 787: {region: 0x49, script: 0x5a, flags: 0x0}, + 788: {region: 0x37, script: 0x5a, flags: 0x0}, + 789: {region: 0x165, script: 0x5a, flags: 0x0}, + 790: {region: 0x165, script: 0x5a, flags: 0x0}, + 791: {region: 0x165, script: 0x5a, flags: 0x0}, + 792: {region: 0x165, script: 0x5a, flags: 0x0}, + 793: {region: 0x165, script: 0x5a, flags: 0x0}, + 794: {region: 0x165, script: 0x5a, flags: 0x0}, + 795: {region: 0x99, script: 0x22, flags: 0x0}, + 796: {region: 0xdb, script: 0x22, flags: 0x0}, + 797: {region: 0x106, script: 0x20, flags: 0x0}, + 798: {region: 0x35, script: 0x72, flags: 0x0}, + 799: {region: 0x29, script: 0x3, flags: 0x1}, + 800: {region: 0xcb, script: 0x5a, flags: 0x0}, + 801: {region: 0x165, script: 0x5a, flags: 0x0}, + 802: {region: 0x165, script: 0x5a, flags: 0x0}, + 803: {region: 0x165, script: 0x5a, flags: 0x0}, + 804: {region: 0x99, script: 0x22, flags: 0x0}, + 805: {region: 0x52, script: 0x5a, flags: 0x0}, + 807: {region: 0x165, script: 0x5a, flags: 0x0}, + 808: {region: 0x135, script: 0x5a, flags: 0x0}, + 809: {region: 0x165, script: 0x5a, flags: 0x0}, + 810: {region: 0x165, script: 0x5a, flags: 0x0}, + 811: {region: 0xe8, script: 0x5, flags: 0x0}, + 812: {region: 0xc3, script: 0x5a, flags: 0x0}, + 813: {region: 0x99, script: 0x22, flags: 0x0}, + 814: {region: 0x95, script: 0x5a, flags: 0x0}, + 815: {region: 0x164, script: 0x5a, flags: 0x0}, + 816: {region: 0x165, script: 0x5a, flags: 0x0}, + 817: {region: 0xc4, script: 0x75, flags: 0x0}, + 818: {region: 0x165, script: 0x5a, flags: 0x0}, + 819: {region: 0x165, script: 0x2c, flags: 0x0}, + 820: {region: 0x106, script: 0x20, flags: 0x0}, + 821: {region: 0x165, script: 0x5a, flags: 0x0}, + 822: {region: 0x131, script: 0x5a, flags: 0x0}, + 823: {region: 0x9c, script: 0x66, flags: 0x0}, + 824: {region: 0x165, script: 0x5a, flags: 0x0}, + 825: {region: 0x165, script: 0x5a, flags: 0x0}, + 826: {region: 0x9c, script: 0x5, flags: 0x0}, + 827: {region: 0x165, script: 0x5a, flags: 0x0}, + 828: {region: 0x165, script: 0x5a, flags: 0x0}, + 829: {region: 0x165, script: 0x5a, flags: 0x0}, + 830: {region: 0xdd, script: 0x5a, flags: 0x0}, + 831: {region: 0x165, script: 0x5a, flags: 0x0}, + 832: {region: 0x165, script: 0x5a, flags: 0x0}, + 834: {region: 0x165, script: 0x5a, flags: 0x0}, + 835: {region: 0x53, script: 0x3b, flags: 0x0}, + 836: {region: 0x9e, script: 0x5a, flags: 0x0}, + 837: {region: 0xd2, script: 0x5a, flags: 0x0}, + 838: {region: 0x165, script: 0x5a, flags: 0x0}, + 839: {region: 0xda, script: 0x5a, flags: 0x0}, + 840: {region: 0x165, script: 0x5a, flags: 0x0}, + 841: {region: 0x165, script: 0x5a, flags: 0x0}, + 842: {region: 0x165, script: 0x5a, flags: 0x0}, + 843: {region: 0xcf, script: 0x5a, flags: 0x0}, + 844: {region: 0x165, script: 0x5a, flags: 0x0}, + 845: {region: 0x165, script: 0x5a, flags: 0x0}, + 846: {region: 0x164, script: 0x5a, flags: 0x0}, + 847: {region: 0xd1, script: 0x5a, flags: 0x0}, + 848: {region: 0x60, script: 0x5a, flags: 0x0}, + 849: {region: 0xdb, script: 0x22, flags: 0x0}, + 850: {region: 0x165, script: 0x5a, flags: 0x0}, + 851: {region: 0xdb, script: 0x22, flags: 0x0}, + 852: {region: 0x165, script: 0x5a, flags: 0x0}, + 853: {region: 0x165, script: 0x5a, flags: 0x0}, + 854: {region: 0xd2, script: 0x5a, flags: 0x0}, + 855: {region: 0x165, script: 0x5a, flags: 0x0}, + 856: {region: 0x165, script: 0x5a, flags: 0x0}, + 857: {region: 0xd1, script: 0x5a, flags: 0x0}, + 858: {region: 0x165, script: 0x5a, flags: 0x0}, + 859: {region: 0xcf, script: 0x5a, flags: 0x0}, + 860: {region: 0xcf, script: 0x5a, flags: 0x0}, + 861: {region: 0x165, script: 0x5a, flags: 0x0}, + 862: {region: 0x165, script: 0x5a, flags: 0x0}, + 863: {region: 0x95, script: 0x5a, flags: 0x0}, + 864: {region: 0x165, script: 0x5a, flags: 0x0}, + 865: {region: 0xdf, script: 0x5a, flags: 0x0}, + 866: {region: 0x165, script: 0x5a, flags: 0x0}, + 867: {region: 0x165, script: 0x5a, flags: 0x0}, + 868: {region: 0x99, script: 0x5a, flags: 0x0}, + 869: {region: 0x165, script: 0x5a, flags: 0x0}, + 870: {region: 0x165, script: 0x5a, flags: 0x0}, + 871: {region: 0xd9, script: 0x5a, flags: 0x0}, + 872: {region: 0x52, script: 0x5a, flags: 0x0}, + 873: {region: 0x165, script: 0x5a, flags: 0x0}, + 874: {region: 0xda, script: 0x5a, flags: 0x0}, + 875: {region: 0x165, script: 0x5a, flags: 0x0}, + 876: {region: 0x52, script: 0x5a, flags: 0x0}, + 877: {region: 0x165, script: 0x5a, flags: 0x0}, + 878: {region: 0x165, script: 0x5a, flags: 0x0}, + 879: {region: 0xda, script: 0x5a, flags: 0x0}, + 880: {region: 0x123, script: 0x56, flags: 0x0}, + 881: {region: 0x99, script: 0x22, flags: 0x0}, + 882: {region: 0x10c, script: 0xc4, flags: 0x0}, + 883: {region: 0x165, script: 0x5a, flags: 0x0}, + 884: {region: 0x165, script: 0x5a, flags: 0x0}, + 885: {region: 0x84, script: 0x7c, flags: 0x0}, + 886: {region: 0x161, script: 0x5a, flags: 0x0}, + 887: {region: 0x165, script: 0x5a, flags: 0x0}, + 888: {region: 0x49, script: 0x17, flags: 0x0}, + 889: {region: 0x165, script: 0x5a, flags: 0x0}, + 890: {region: 0x161, script: 0x5a, flags: 0x0}, + 891: {region: 0x165, script: 0x5a, flags: 0x0}, + 892: {region: 0x165, script: 0x5a, flags: 0x0}, + 893: {region: 0x165, script: 0x5a, flags: 0x0}, + 894: {region: 0x165, script: 0x5a, flags: 0x0}, + 895: {region: 0x165, script: 0x5a, flags: 0x0}, + 896: {region: 0x117, script: 0x5a, flags: 0x0}, + 897: {region: 0x165, script: 0x5a, flags: 0x0}, + 898: {region: 0x165, script: 0x5a, flags: 0x0}, + 899: {region: 0x135, script: 0x5a, flags: 0x0}, + 900: {region: 0x165, script: 0x5a, flags: 0x0}, + 901: {region: 0x53, script: 0x5a, flags: 0x0}, + 902: {region: 0x165, script: 0x5a, flags: 0x0}, + 903: {region: 0xce, script: 0x5a, flags: 0x0}, + 904: {region: 0x12f, script: 0x5a, flags: 0x0}, + 905: {region: 0x131, script: 0x5a, flags: 0x0}, + 906: {region: 0x80, script: 0x5a, flags: 0x0}, + 907: {region: 0x78, script: 0x5a, flags: 0x0}, + 908: {region: 0x165, script: 0x5a, flags: 0x0}, + 910: {region: 0x165, script: 0x5a, flags: 0x0}, + 911: {region: 0x165, script: 0x5a, flags: 0x0}, + 912: {region: 0x6f, script: 0x5a, flags: 0x0}, + 913: {region: 0x165, script: 0x5a, flags: 0x0}, + 914: {region: 0x165, script: 0x5a, flags: 0x0}, + 915: {region: 0x165, script: 0x5a, flags: 0x0}, + 916: {region: 0x165, script: 0x5a, flags: 0x0}, + 917: {region: 0x99, script: 0x81, flags: 0x0}, + 918: {region: 0x165, script: 0x5a, flags: 0x0}, + 919: {region: 0x165, script: 0x5, flags: 0x0}, + 920: {region: 0x7d, script: 0x20, flags: 0x0}, + 921: {region: 0x135, script: 0x82, flags: 0x0}, + 922: {region: 0x165, script: 0x5, flags: 0x0}, + 923: {region: 0xc5, script: 0x80, flags: 0x0}, + 924: {region: 0x165, script: 0x5a, flags: 0x0}, + 925: {region: 0x2c, script: 0x3, flags: 0x1}, + 926: {region: 0xe7, script: 0x5a, flags: 0x0}, + 927: {region: 0x2f, script: 0x2, flags: 0x1}, + 928: {region: 0xe7, script: 0x5a, flags: 0x0}, + 929: {region: 0x30, script: 0x5a, flags: 0x0}, + 930: {region: 0xf0, script: 0x5a, flags: 0x0}, + 931: {region: 0x165, script: 0x5a, flags: 0x0}, + 932: {region: 0x78, script: 0x5a, flags: 0x0}, + 933: {region: 0xd6, script: 0x5a, flags: 0x0}, + 934: {region: 0x135, script: 0x5a, flags: 0x0}, + 935: {region: 0x49, script: 0x5a, flags: 0x0}, + 936: {region: 0x165, script: 0x5a, flags: 0x0}, + 937: {region: 0x9c, script: 0xf0, flags: 0x0}, + 938: {region: 0x165, script: 0x5a, flags: 0x0}, + 939: {region: 0x60, script: 0x5a, flags: 0x0}, + 940: {region: 0x165, script: 0x5, flags: 0x0}, + 941: {region: 0xb0, script: 0x8b, flags: 0x0}, + 943: {region: 0x165, script: 0x5a, flags: 0x0}, + 944: {region: 0x165, script: 0x5a, flags: 0x0}, + 945: {region: 0x99, script: 0x12, flags: 0x0}, + 946: {region: 0xa4, script: 0x5a, flags: 0x0}, + 947: {region: 0xe9, script: 0x5a, flags: 0x0}, + 948: {region: 0x165, script: 0x5a, flags: 0x0}, + 949: {region: 0x9e, script: 0x5a, flags: 0x0}, + 950: {region: 0x165, script: 0x5a, flags: 0x0}, + 951: {region: 0x165, script: 0x5a, flags: 0x0}, + 952: {region: 0x87, script: 0x34, flags: 0x0}, + 953: {region: 0x75, script: 0x5a, flags: 0x0}, + 954: {region: 0x165, script: 0x5a, flags: 0x0}, + 955: {region: 0xe8, script: 0x4d, flags: 0x0}, + 956: {region: 0x9c, script: 0x5, flags: 0x0}, + 957: {region: 0x1, script: 0x5a, flags: 0x0}, + 958: {region: 0x24, script: 0x5, flags: 0x0}, + 959: {region: 0x165, script: 0x5a, flags: 0x0}, + 960: {region: 0x41, script: 0x5a, flags: 0x0}, + 961: {region: 0x165, script: 0x5a, flags: 0x0}, + 962: {region: 0x7a, script: 0x5a, flags: 0x0}, + 963: {region: 0x165, script: 0x5a, flags: 0x0}, + 964: {region: 0xe4, script: 0x5a, flags: 0x0}, + 965: {region: 0x89, script: 0x5a, flags: 0x0}, + 966: {region: 0x69, script: 0x5a, flags: 0x0}, + 967: {region: 0x165, script: 0x5a, flags: 0x0}, + 968: {region: 0x99, script: 0x22, flags: 0x0}, + 969: {region: 0x165, script: 0x5a, flags: 0x0}, + 970: {region: 0x102, script: 0x5a, flags: 0x0}, + 971: {region: 0x95, script: 0x5a, flags: 0x0}, + 972: {region: 0x165, script: 0x5a, flags: 0x0}, + 973: {region: 0x165, script: 0x5a, flags: 0x0}, + 974: {region: 0x9e, script: 0x5a, flags: 0x0}, + 975: {region: 0x165, script: 0x5, flags: 0x0}, + 976: {region: 0x99, script: 0x5a, flags: 0x0}, + 977: {region: 0x31, script: 0x2, flags: 0x1}, + 978: {region: 0xdb, script: 0x22, flags: 0x0}, + 979: {region: 0x35, script: 0xe, flags: 0x0}, + 980: {region: 0x4e, script: 0x5a, flags: 0x0}, + 981: {region: 0x72, script: 0x5a, flags: 0x0}, + 982: {region: 0x4e, script: 0x5a, flags: 0x0}, + 983: {region: 0x9c, script: 0x5, flags: 0x0}, + 984: {region: 0x10c, script: 0x5a, flags: 0x0}, + 985: {region: 0x3a, script: 0x5a, flags: 0x0}, + 986: {region: 0x165, script: 0x5a, flags: 0x0}, + 987: {region: 0xd1, script: 0x5a, flags: 0x0}, + 988: {region: 0x104, script: 0x5a, flags: 0x0}, + 989: {region: 0x95, script: 0x5a, flags: 0x0}, + 990: {region: 0x12f, script: 0x5a, flags: 0x0}, + 991: {region: 0x165, script: 0x5a, flags: 0x0}, + 992: {region: 0x165, script: 0x5a, flags: 0x0}, + 993: {region: 0x73, script: 0x5a, flags: 0x0}, + 994: {region: 0x106, script: 0x20, flags: 0x0}, + 995: {region: 0x130, script: 0x20, flags: 0x0}, + 996: {region: 0x109, script: 0x5a, flags: 0x0}, + 997: {region: 0x107, script: 0x5a, flags: 0x0}, + 998: {region: 0x12f, script: 0x5a, flags: 0x0}, + 999: {region: 0x165, script: 0x5a, flags: 0x0}, + 1000: {region: 0xa2, script: 0x4c, flags: 0x0}, + 1001: {region: 0x99, script: 0x22, flags: 0x0}, + 1002: {region: 0x80, script: 0x5a, flags: 0x0}, + 1003: {region: 0x106, script: 0x20, flags: 0x0}, + 1004: {region: 0xa4, script: 0x5a, flags: 0x0}, + 1005: {region: 0x95, script: 0x5a, flags: 0x0}, + 1006: {region: 0x99, script: 0x5a, flags: 0x0}, + 1007: {region: 0x114, script: 0x5a, flags: 0x0}, + 1008: {region: 0x99, script: 0xc8, flags: 0x0}, + 1009: {region: 0x165, script: 0x5a, flags: 0x0}, + 1010: {region: 0x165, script: 0x5a, flags: 0x0}, + 1011: {region: 0x12f, script: 0x5a, flags: 0x0}, + 1012: {region: 0x9e, script: 0x5a, flags: 0x0}, + 1013: {region: 0x99, script: 0x22, flags: 0x0}, + 1014: {region: 0x165, script: 0x5, flags: 0x0}, + 1015: {region: 0x9e, script: 0x5a, flags: 0x0}, + 1016: {region: 0x7b, script: 0x5a, flags: 0x0}, + 1017: {region: 0x49, script: 0x5a, flags: 0x0}, + 1018: {region: 0x33, script: 0x4, flags: 0x1}, + 1019: {region: 0x9e, script: 0x5a, flags: 0x0}, + 1020: {region: 0x9c, script: 0x5, flags: 0x0}, + 1021: {region: 0xda, script: 0x5a, flags: 0x0}, + 1022: {region: 0x4f, script: 0x5a, flags: 0x0}, + 1023: {region: 0xd1, script: 0x5a, flags: 0x0}, + 1024: {region: 0xcf, script: 0x5a, flags: 0x0}, + 1025: {region: 0xc3, script: 0x5a, flags: 0x0}, + 1026: {region: 0x4c, script: 0x5a, flags: 0x0}, + 1027: {region: 0x96, script: 0x7e, flags: 0x0}, + 1028: {region: 0xb6, script: 0x5a, flags: 0x0}, + 1029: {region: 0x165, script: 0x2c, flags: 0x0}, + 1030: {region: 0x165, script: 0x5a, flags: 0x0}, + 1032: {region: 0xba, script: 0xe3, flags: 0x0}, + 1033: {region: 0x165, script: 0x5a, flags: 0x0}, + 1034: {region: 0xc4, script: 0x75, flags: 0x0}, + 1035: {region: 0x165, script: 0x5, flags: 0x0}, + 1036: {region: 0xb3, script: 0xcf, flags: 0x0}, + 1037: {region: 0x6f, script: 0x5a, flags: 0x0}, + 1038: {region: 0x165, script: 0x5a, flags: 0x0}, + 1039: {region: 0x165, script: 0x5a, flags: 0x0}, + 1040: {region: 0x165, script: 0x5a, flags: 0x0}, + 1041: {region: 0x165, script: 0x5a, flags: 0x0}, + 1042: {region: 0x111, script: 0x5a, flags: 0x0}, + 1043: {region: 0x165, script: 0x5a, flags: 0x0}, + 1044: {region: 0xe8, script: 0x5, flags: 0x0}, + 1045: {region: 0x165, script: 0x5a, flags: 0x0}, + 1046: {region: 0x10f, script: 0x5a, flags: 0x0}, + 1047: {region: 0x165, script: 0x5a, flags: 0x0}, + 1048: {region: 0xe9, script: 0x5a, flags: 0x0}, + 1049: {region: 0x165, script: 0x5a, flags: 0x0}, + 1050: {region: 0x95, script: 0x5a, flags: 0x0}, + 1051: {region: 0x142, script: 0x5a, flags: 0x0}, + 1052: {region: 0x10c, script: 0x5a, flags: 0x0}, + 1054: {region: 0x10c, script: 0x5a, flags: 0x0}, + 1055: {region: 0x72, script: 0x5a, flags: 0x0}, + 1056: {region: 0x97, script: 0xc5, flags: 0x0}, + 1057: {region: 0x165, script: 0x5a, flags: 0x0}, + 1058: {region: 0x72, script: 0x5a, flags: 0x0}, + 1059: {region: 0x164, script: 0x5a, flags: 0x0}, + 1060: {region: 0x165, script: 0x5a, flags: 0x0}, + 1061: {region: 0xc3, script: 0x5a, flags: 0x0}, + 1062: {region: 0x165, script: 0x5a, flags: 0x0}, + 1063: {region: 0x165, script: 0x5a, flags: 0x0}, + 1064: {region: 0x165, script: 0x5a, flags: 0x0}, + 1065: {region: 0x115, script: 0x5a, flags: 0x0}, + 1066: {region: 0x165, script: 0x5a, flags: 0x0}, + 1067: {region: 0x165, script: 0x5a, flags: 0x0}, + 1068: {region: 0x123, script: 0xe6, flags: 0x0}, + 1069: {region: 0x165, script: 0x5a, flags: 0x0}, + 1070: {region: 0x165, script: 0x5a, flags: 0x0}, + 1071: {region: 0x165, script: 0x5a, flags: 0x0}, + 1072: {region: 0x165, script: 0x5a, flags: 0x0}, + 1073: {region: 0x27, script: 0x5a, flags: 0x0}, + 1074: {region: 0x37, script: 0x5, flags: 0x1}, + 1075: {region: 0x99, script: 0xd2, flags: 0x0}, + 1076: {region: 0x116, script: 0x5a, flags: 0x0}, + 1077: {region: 0x114, script: 0x5a, flags: 0x0}, + 1078: {region: 0x99, script: 0x22, flags: 0x0}, + 1079: {region: 0x161, script: 0x5a, flags: 0x0}, + 1080: {region: 0x165, script: 0x5a, flags: 0x0}, + 1081: {region: 0x165, script: 0x5a, flags: 0x0}, + 1082: {region: 0x6d, script: 0x5a, flags: 0x0}, + 1083: {region: 0x161, script: 0x5a, flags: 0x0}, + 1084: {region: 0x165, script: 0x5a, flags: 0x0}, + 1085: {region: 0x60, script: 0x5a, flags: 0x0}, + 1086: {region: 0x95, script: 0x5a, flags: 0x0}, + 1087: {region: 0x165, script: 0x5a, flags: 0x0}, + 1088: {region: 0x165, script: 0x5a, flags: 0x0}, + 1089: {region: 0x12f, script: 0x5a, flags: 0x0}, + 1090: {region: 0x165, script: 0x5a, flags: 0x0}, + 1091: {region: 0x84, script: 0x5a, flags: 0x0}, + 1092: {region: 0x10c, script: 0x5a, flags: 0x0}, + 1093: {region: 0x12f, script: 0x5a, flags: 0x0}, + 1094: {region: 0x15f, script: 0x5, flags: 0x0}, + 1095: {region: 0x4b, script: 0x5a, flags: 0x0}, + 1096: {region: 0x60, script: 0x5a, flags: 0x0}, + 1097: {region: 0x165, script: 0x5a, flags: 0x0}, + 1098: {region: 0x99, script: 0x22, flags: 0x0}, + 1099: {region: 0x95, script: 0x5a, flags: 0x0}, + 1100: {region: 0x165, script: 0x5a, flags: 0x0}, + 1101: {region: 0x35, script: 0xe, flags: 0x0}, + 1102: {region: 0x9b, script: 0xd6, flags: 0x0}, + 1103: {region: 0xe9, script: 0x5a, flags: 0x0}, + 1104: {region: 0x99, script: 0xde, flags: 0x0}, + 1105: {region: 0xdb, script: 0x22, flags: 0x0}, + 1106: {region: 0x165, script: 0x5a, flags: 0x0}, + 1107: {region: 0x165, script: 0x5a, flags: 0x0}, + 1108: {region: 0x165, script: 0x5a, flags: 0x0}, + 1109: {region: 0x165, script: 0x5a, flags: 0x0}, + 1110: {region: 0x165, script: 0x5a, flags: 0x0}, + 1111: {region: 0x165, script: 0x5a, flags: 0x0}, + 1112: {region: 0x165, script: 0x5a, flags: 0x0}, + 1113: {region: 0x165, script: 0x5a, flags: 0x0}, + 1114: {region: 0xe7, script: 0x5a, flags: 0x0}, + 1115: {region: 0x165, script: 0x5a, flags: 0x0}, + 1116: {region: 0x165, script: 0x5a, flags: 0x0}, + 1117: {region: 0x99, script: 0x52, flags: 0x0}, + 1118: {region: 0x53, script: 0xdc, flags: 0x0}, + 1119: {region: 0xdb, script: 0x22, flags: 0x0}, + 1120: {region: 0xdb, script: 0x22, flags: 0x0}, + 1121: {region: 0x99, script: 0xe1, flags: 0x0}, + 1122: {region: 0x165, script: 0x5a, flags: 0x0}, + 1123: {region: 0x112, script: 0x5a, flags: 0x0}, + 1124: {region: 0x131, script: 0x5a, flags: 0x0}, + 1125: {region: 0x126, script: 0x5a, flags: 0x0}, + 1126: {region: 0x165, script: 0x5a, flags: 0x0}, + 1127: {region: 0x3c, script: 0x3, flags: 0x1}, + 1128: {region: 0x165, script: 0x5a, flags: 0x0}, + 1129: {region: 0x165, script: 0x5a, flags: 0x0}, + 1130: {region: 0x165, script: 0x5a, flags: 0x0}, + 1131: {region: 0x123, script: 0xe6, flags: 0x0}, + 1132: {region: 0xdb, script: 0x22, flags: 0x0}, + 1133: {region: 0xdb, script: 0x22, flags: 0x0}, + 1134: {region: 0xdb, script: 0x22, flags: 0x0}, + 1135: {region: 0x6f, script: 0x2c, flags: 0x0}, + 1136: {region: 0x165, script: 0x5a, flags: 0x0}, + 1137: {region: 0x6d, script: 0x2c, flags: 0x0}, + 1138: {region: 0x165, script: 0x5a, flags: 0x0}, + 1139: {region: 0x165, script: 0x5a, flags: 0x0}, + 1140: {region: 0x165, script: 0x5a, flags: 0x0}, + 1141: {region: 0xd6, script: 0x5a, flags: 0x0}, + 1142: {region: 0x127, script: 0x5a, flags: 0x0}, + 1143: {region: 0x125, script: 0x5a, flags: 0x0}, + 1144: {region: 0x32, script: 0x5a, flags: 0x0}, + 1145: {region: 0xdb, script: 0x22, flags: 0x0}, + 1146: {region: 0xe7, script: 0x5a, flags: 0x0}, + 1147: {region: 0x165, script: 0x5a, flags: 0x0}, + 1148: {region: 0x165, script: 0x5a, flags: 0x0}, + 1149: {region: 0x32, script: 0x5a, flags: 0x0}, + 1150: {region: 0xd4, script: 0x5a, flags: 0x0}, + 1151: {region: 0x165, script: 0x5a, flags: 0x0}, + 1152: {region: 0x161, script: 0x5a, flags: 0x0}, + 1153: {region: 0x165, script: 0x5a, flags: 0x0}, + 1154: {region: 0x129, script: 0x5a, flags: 0x0}, + 1155: {region: 0x165, script: 0x5a, flags: 0x0}, + 1156: {region: 0xce, script: 0x5a, flags: 0x0}, + 1157: {region: 0x165, script: 0x5a, flags: 0x0}, + 1158: {region: 0xe6, script: 0x5a, flags: 0x0}, + 1159: {region: 0x165, script: 0x5a, flags: 0x0}, + 1160: {region: 0x165, script: 0x5a, flags: 0x0}, + 1161: {region: 0x165, script: 0x5a, flags: 0x0}, + 1162: {region: 0x12b, script: 0x5a, flags: 0x0}, + 1163: {region: 0x12b, script: 0x5a, flags: 0x0}, + 1164: {region: 0x12e, script: 0x5a, flags: 0x0}, + 1165: {region: 0x165, script: 0x5, flags: 0x0}, + 1166: {region: 0x161, script: 0x5a, flags: 0x0}, + 1167: {region: 0x87, script: 0x34, flags: 0x0}, + 1168: {region: 0xdb, script: 0x22, flags: 0x0}, + 1169: {region: 0xe7, script: 0x5a, flags: 0x0}, + 1170: {region: 0x43, script: 0xe7, flags: 0x0}, + 1171: {region: 0x165, script: 0x5a, flags: 0x0}, + 1172: {region: 0x106, script: 0x20, flags: 0x0}, + 1173: {region: 0x165, script: 0x5a, flags: 0x0}, + 1174: {region: 0x165, script: 0x5a, flags: 0x0}, + 1175: {region: 0x131, script: 0x5a, flags: 0x0}, + 1176: {region: 0x165, script: 0x5a, flags: 0x0}, + 1177: {region: 0x123, script: 0xe6, flags: 0x0}, + 1178: {region: 0x32, script: 0x5a, flags: 0x0}, + 1179: {region: 0x165, script: 0x5a, flags: 0x0}, + 1180: {region: 0x165, script: 0x5a, flags: 0x0}, + 1181: {region: 0xce, script: 0x5a, flags: 0x0}, + 1182: {region: 0x165, script: 0x5a, flags: 0x0}, + 1183: {region: 0x165, script: 0x5a, flags: 0x0}, + 1184: {region: 0x12d, script: 0x5a, flags: 0x0}, + 1185: {region: 0x165, script: 0x5a, flags: 0x0}, + 1187: {region: 0x165, script: 0x5a, flags: 0x0}, + 1188: {region: 0xd4, script: 0x5a, flags: 0x0}, + 1189: {region: 0x53, script: 0xdf, flags: 0x0}, + 1190: {region: 0xe5, script: 0x5a, flags: 0x0}, + 1191: {region: 0x165, script: 0x5a, flags: 0x0}, + 1192: {region: 0x106, script: 0x20, flags: 0x0}, + 1193: {region: 0xba, script: 0x5a, flags: 0x0}, + 1194: {region: 0x165, script: 0x5a, flags: 0x0}, + 1195: {region: 0x106, script: 0x20, flags: 0x0}, + 1196: {region: 0x3f, script: 0x4, flags: 0x1}, + 1197: {region: 0x11c, script: 0xea, flags: 0x0}, + 1198: {region: 0x130, script: 0x20, flags: 0x0}, + 1199: {region: 0x75, script: 0x5a, flags: 0x0}, + 1200: {region: 0x2a, script: 0x5a, flags: 0x0}, + 1202: {region: 0x43, script: 0x3, flags: 0x1}, + 1203: {region: 0x99, script: 0xe, flags: 0x0}, + 1204: {region: 0xe8, script: 0x5, flags: 0x0}, + 1205: {region: 0x165, script: 0x5a, flags: 0x0}, + 1206: {region: 0x165, script: 0x5a, flags: 0x0}, + 1207: {region: 0x165, script: 0x5a, flags: 0x0}, + 1208: {region: 0x165, script: 0x5a, flags: 0x0}, + 1209: {region: 0x165, script: 0x5a, flags: 0x0}, + 1210: {region: 0x165, script: 0x5a, flags: 0x0}, + 1211: {region: 0x165, script: 0x5a, flags: 0x0}, + 1212: {region: 0x46, script: 0x4, flags: 0x1}, + 1213: {region: 0x165, script: 0x5a, flags: 0x0}, + 1214: {region: 0xb4, script: 0xeb, flags: 0x0}, + 1215: {region: 0x165, script: 0x5a, flags: 0x0}, + 1216: {region: 0x161, script: 0x5a, flags: 0x0}, + 1217: {region: 0x9e, script: 0x5a, flags: 0x0}, + 1218: {region: 0x106, script: 0x5a, flags: 0x0}, + 1219: {region: 0x13e, script: 0x5a, flags: 0x0}, + 1220: {region: 0x11b, script: 0x5a, flags: 0x0}, + 1221: {region: 0x165, script: 0x5a, flags: 0x0}, + 1222: {region: 0x36, script: 0x5a, flags: 0x0}, + 1223: {region: 0x60, script: 0x5a, flags: 0x0}, + 1224: {region: 0xd1, script: 0x5a, flags: 0x0}, + 1225: {region: 0x1, script: 0x5a, flags: 0x0}, + 1226: {region: 0x106, script: 0x5a, flags: 0x0}, + 1227: {region: 0x6a, script: 0x5a, flags: 0x0}, + 1228: {region: 0x12f, script: 0x5a, flags: 0x0}, + 1229: {region: 0x165, script: 0x5a, flags: 0x0}, + 1230: {region: 0x36, script: 0x5a, flags: 0x0}, + 1231: {region: 0x4e, script: 0x5a, flags: 0x0}, + 1232: {region: 0x165, script: 0x5a, flags: 0x0}, + 1233: {region: 0x6f, script: 0x2c, flags: 0x0}, + 1234: {region: 0x165, script: 0x5a, flags: 0x0}, + 1235: {region: 0xe7, script: 0x5a, flags: 0x0}, + 1236: {region: 0x2f, script: 0x5a, flags: 0x0}, + 1237: {region: 0x99, script: 0xe1, flags: 0x0}, + 1238: {region: 0x99, script: 0x22, flags: 0x0}, + 1239: {region: 0x165, script: 0x5a, flags: 0x0}, + 1240: {region: 0x165, script: 0x5a, flags: 0x0}, + 1241: {region: 0x165, script: 0x5a, flags: 0x0}, + 1242: {region: 0x165, script: 0x5a, flags: 0x0}, + 1243: {region: 0x165, script: 0x5a, flags: 0x0}, + 1244: {region: 0x165, script: 0x5a, flags: 0x0}, + 1245: {region: 0x165, script: 0x5a, flags: 0x0}, + 1246: {region: 0x165, script: 0x5a, flags: 0x0}, + 1247: {region: 0x165, script: 0x5a, flags: 0x0}, + 1248: {region: 0x140, script: 0x5a, flags: 0x0}, + 1249: {region: 0x165, script: 0x5a, flags: 0x0}, + 1250: {region: 0x165, script: 0x5a, flags: 0x0}, + 1251: {region: 0xa8, script: 0x5, flags: 0x0}, + 1252: {region: 0x165, script: 0x5a, flags: 0x0}, + 1253: {region: 0x114, script: 0x5a, flags: 0x0}, + 1254: {region: 0x165, script: 0x5a, flags: 0x0}, + 1255: {region: 0x165, script: 0x5a, flags: 0x0}, + 1256: {region: 0x165, script: 0x5a, flags: 0x0}, + 1257: {region: 0x165, script: 0x5a, flags: 0x0}, + 1258: {region: 0x99, script: 0x22, flags: 0x0}, + 1259: {region: 0x53, script: 0x3b, flags: 0x0}, + 1260: {region: 0x165, script: 0x5a, flags: 0x0}, + 1261: {region: 0x165, script: 0x5a, flags: 0x0}, + 1262: {region: 0x41, script: 0x5a, flags: 0x0}, + 1263: {region: 0x165, script: 0x5a, flags: 0x0}, + 1264: {region: 0x12b, script: 0x18, flags: 0x0}, + 1265: {region: 0x165, script: 0x5a, flags: 0x0}, + 1266: {region: 0x161, script: 0x5a, flags: 0x0}, + 1267: {region: 0x165, script: 0x5a, flags: 0x0}, + 1268: {region: 0x12b, script: 0x62, flags: 0x0}, + 1269: {region: 0x12b, script: 0x63, flags: 0x0}, + 1270: {region: 0x7d, script: 0x2e, flags: 0x0}, + 1271: {region: 0x53, script: 0x67, flags: 0x0}, + 1272: {region: 0x10b, script: 0x6c, flags: 0x0}, + 1273: {region: 0x108, script: 0x77, flags: 0x0}, + 1274: {region: 0x99, script: 0x22, flags: 0x0}, + 1275: {region: 0x131, script: 0x5a, flags: 0x0}, + 1276: {region: 0x165, script: 0x5a, flags: 0x0}, + 1277: {region: 0x9c, script: 0x8e, flags: 0x0}, + 1278: {region: 0x165, script: 0x5a, flags: 0x0}, + 1279: {region: 0x15e, script: 0xc7, flags: 0x0}, + 1280: {region: 0x165, script: 0x5a, flags: 0x0}, + 1281: {region: 0x165, script: 0x5a, flags: 0x0}, + 1282: {region: 0xdb, script: 0x22, flags: 0x0}, + 1283: {region: 0x165, script: 0x5a, flags: 0x0}, + 1284: {region: 0x165, script: 0x5a, flags: 0x0}, + 1285: {region: 0xd1, script: 0x5a, flags: 0x0}, + 1286: {region: 0x75, script: 0x5a, flags: 0x0}, + 1287: {region: 0x165, script: 0x5a, flags: 0x0}, + 1288: {region: 0x165, script: 0x5a, flags: 0x0}, + 1289: {region: 0x52, script: 0x5a, flags: 0x0}, + 1290: {region: 0x165, script: 0x5a, flags: 0x0}, + 1291: {region: 0x165, script: 0x5a, flags: 0x0}, + 1292: {region: 0x165, script: 0x5a, flags: 0x0}, + 1293: {region: 0x52, script: 0x5a, flags: 0x0}, + 1294: {region: 0x165, script: 0x5a, flags: 0x0}, + 1295: {region: 0x165, script: 0x5a, flags: 0x0}, + 1296: {region: 0x165, script: 0x5a, flags: 0x0}, + 1297: {region: 0x165, script: 0x5a, flags: 0x0}, + 1298: {region: 0x1, script: 0x3e, flags: 0x0}, + 1299: {region: 0x165, script: 0x5a, flags: 0x0}, + 1300: {region: 0x165, script: 0x5a, flags: 0x0}, + 1301: {region: 0x165, script: 0x5a, flags: 0x0}, + 1302: {region: 0x165, script: 0x5a, flags: 0x0}, + 1303: {region: 0x165, script: 0x5a, flags: 0x0}, + 1304: {region: 0xd6, script: 0x5a, flags: 0x0}, + 1305: {region: 0x165, script: 0x5a, flags: 0x0}, + 1306: {region: 0x165, script: 0x5a, flags: 0x0}, + 1307: {region: 0x165, script: 0x5a, flags: 0x0}, + 1308: {region: 0x41, script: 0x5a, flags: 0x0}, + 1309: {region: 0x165, script: 0x5a, flags: 0x0}, + 1310: {region: 0xcf, script: 0x5a, flags: 0x0}, + 1311: {region: 0x4a, script: 0x3, flags: 0x1}, + 1312: {region: 0x165, script: 0x5a, flags: 0x0}, + 1313: {region: 0x165, script: 0x5a, flags: 0x0}, + 1314: {region: 0x165, script: 0x5a, flags: 0x0}, + 1315: {region: 0x53, script: 0x5a, flags: 0x0}, + 1316: {region: 0x10b, script: 0x5a, flags: 0x0}, + 1318: {region: 0xa8, script: 0x5, flags: 0x0}, + 1319: {region: 0xd9, script: 0x5a, flags: 0x0}, + 1320: {region: 0xba, script: 0xe3, flags: 0x0}, + 1321: {region: 0x4d, script: 0x14, flags: 0x1}, + 1322: {region: 0x53, script: 0x7d, flags: 0x0}, + 1323: {region: 0x165, script: 0x5a, flags: 0x0}, + 1324: {region: 0x122, script: 0x5a, flags: 0x0}, + 1325: {region: 0xd0, script: 0x5a, flags: 0x0}, + 1326: {region: 0x165, script: 0x5a, flags: 0x0}, + 1327: {region: 0x161, script: 0x5a, flags: 0x0}, + 1329: {region: 0x12b, script: 0x5a, flags: 0x0}, +} + +// likelyLangList holds lists info associated with likelyLang. +// Size: 388 bytes, 97 elements +var likelyLangList = [97]likelyScriptRegion{ + 0: {region: 0x9c, script: 0x7, flags: 0x0}, + 1: {region: 0xa1, script: 0x78, flags: 0x2}, + 2: {region: 0x11c, script: 0x84, flags: 0x2}, + 3: {region: 0x32, script: 0x5a, flags: 0x0}, + 4: {region: 0x9b, script: 0x5, flags: 0x4}, + 5: {region: 0x9c, script: 0x5, flags: 0x4}, + 6: {region: 0x106, script: 0x20, flags: 0x4}, + 7: {region: 0x9c, script: 0x5, flags: 0x2}, + 8: {region: 0x106, script: 0x20, flags: 0x0}, + 9: {region: 0x38, script: 0x2f, flags: 0x2}, + 10: {region: 0x135, script: 0x5a, flags: 0x0}, + 11: {region: 0x7b, script: 0xca, flags: 0x2}, + 12: {region: 0x114, script: 0x5a, flags: 0x0}, + 13: {region: 0x84, script: 0x1, flags: 0x2}, + 14: {region: 0x5d, script: 0x1f, flags: 0x0}, + 15: {region: 0x87, script: 0x5f, flags: 0x2}, + 16: {region: 0xd6, script: 0x5a, flags: 0x0}, + 17: {region: 0x52, script: 0x5, flags: 0x4}, + 18: {region: 0x10b, script: 0x5, flags: 0x4}, + 19: {region: 0xae, script: 0x20, flags: 0x0}, + 20: {region: 0x24, script: 0x5, flags: 0x4}, + 21: {region: 0x53, script: 0x5, flags: 0x4}, + 22: {region: 0x9c, script: 0x5, flags: 0x4}, + 23: {region: 0xc5, script: 0x5, flags: 0x4}, + 24: {region: 0x53, script: 0x5, flags: 0x2}, + 25: {region: 0x12b, script: 0x5a, flags: 0x0}, + 26: {region: 0xb0, script: 0x5, flags: 0x4}, + 27: {region: 0x9b, script: 0x5, flags: 0x2}, + 28: {region: 0xa5, script: 0x20, flags: 0x0}, + 29: {region: 0x53, script: 0x5, flags: 0x4}, + 30: {region: 0x12b, script: 0x5a, flags: 0x4}, + 31: {region: 0x53, script: 0x5, flags: 0x2}, + 32: {region: 0x12b, script: 0x5a, flags: 0x2}, + 33: {region: 0xdb, script: 0x22, flags: 0x0}, + 34: {region: 0x99, script: 0x5d, flags: 0x2}, + 35: {region: 0x83, script: 0x5a, flags: 0x0}, + 36: {region: 0x84, script: 0x7c, flags: 0x4}, + 37: {region: 0x84, script: 0x7c, flags: 0x2}, + 38: {region: 0xc5, script: 0x20, flags: 0x0}, + 39: {region: 0x53, script: 0x70, flags: 0x4}, + 40: {region: 0x53, script: 0x70, flags: 0x2}, + 41: {region: 0xd0, script: 0x5a, flags: 0x0}, + 42: {region: 0x4a, script: 0x5, flags: 0x4}, + 43: {region: 0x95, script: 0x5, flags: 0x4}, + 44: {region: 0x99, script: 0x36, flags: 0x0}, + 45: {region: 0xe8, script: 0x5, flags: 0x4}, + 46: {region: 0xe8, script: 0x5, flags: 0x2}, + 47: {region: 0x9c, script: 0x88, flags: 0x0}, + 48: {region: 0x53, script: 0x89, flags: 0x2}, + 49: {region: 0xba, script: 0xe3, flags: 0x0}, + 50: {region: 0xd9, script: 0x5a, flags: 0x4}, + 51: {region: 0xe8, script: 0x5, flags: 0x0}, + 52: {region: 0x99, script: 0x22, flags: 0x2}, + 53: {region: 0x99, script: 0x4f, flags: 0x2}, + 54: {region: 0x99, script: 0xce, flags: 0x2}, + 55: {region: 0x105, script: 0x20, flags: 0x0}, + 56: {region: 0xbd, script: 0x5a, flags: 0x4}, + 57: {region: 0x104, script: 0x5a, flags: 0x4}, + 58: {region: 0x106, script: 0x5a, flags: 0x4}, + 59: {region: 0x12b, script: 0x5a, flags: 0x4}, + 60: {region: 0x124, script: 0x20, flags: 0x0}, + 61: {region: 0xe8, script: 0x5, flags: 0x4}, + 62: {region: 0xe8, script: 0x5, flags: 0x2}, + 63: {region: 0x53, script: 0x5, flags: 0x0}, + 64: {region: 0xae, script: 0x20, flags: 0x4}, + 65: {region: 0xc5, script: 0x20, flags: 0x4}, + 66: {region: 0xae, script: 0x20, flags: 0x2}, + 67: {region: 0x99, script: 0xe, flags: 0x0}, + 68: {region: 0xdb, script: 0x22, flags: 0x4}, + 69: {region: 0xdb, script: 0x22, flags: 0x2}, + 70: {region: 0x137, script: 0x5a, flags: 0x0}, + 71: {region: 0x24, script: 0x5, flags: 0x4}, + 72: {region: 0x53, script: 0x20, flags: 0x4}, + 73: {region: 0x24, script: 0x5, flags: 0x2}, + 74: {region: 0x8d, script: 0x3c, flags: 0x0}, + 75: {region: 0x53, script: 0x3b, flags: 0x4}, + 76: {region: 0x53, script: 0x3b, flags: 0x2}, + 77: {region: 0x53, script: 0x3b, flags: 0x0}, + 78: {region: 0x2f, script: 0x3c, flags: 0x4}, + 79: {region: 0x3e, script: 0x3c, flags: 0x4}, + 80: {region: 0x7b, script: 0x3c, flags: 0x4}, + 81: {region: 0x7e, script: 0x3c, flags: 0x4}, + 82: {region: 0x8d, script: 0x3c, flags: 0x4}, + 83: {region: 0x95, script: 0x3c, flags: 0x4}, + 84: {region: 0xc6, script: 0x3c, flags: 0x4}, + 85: {region: 0xd0, script: 0x3c, flags: 0x4}, + 86: {region: 0xe2, script: 0x3c, flags: 0x4}, + 87: {region: 0xe5, script: 0x3c, flags: 0x4}, + 88: {region: 0xe7, script: 0x3c, flags: 0x4}, + 89: {region: 0x116, script: 0x3c, flags: 0x4}, + 90: {region: 0x123, script: 0x3c, flags: 0x4}, + 91: {region: 0x12e, script: 0x3c, flags: 0x4}, + 92: {region: 0x135, script: 0x3c, flags: 0x4}, + 93: {region: 0x13e, script: 0x3c, flags: 0x4}, + 94: {region: 0x12e, script: 0x11, flags: 0x2}, + 95: {region: 0x12e, script: 0x37, flags: 0x2}, + 96: {region: 0x12e, script: 0x3c, flags: 0x2}, +} + +type likelyLangScript struct { + lang uint16 + script uint8 + flags uint8 +} + +// likelyRegion is a lookup table, indexed by regionID, for the most likely +// languages and scripts given incomplete information. If more entries exist +// for a given regionID, lang and script are the index and size respectively +// of the list in likelyRegionList. +// TODO: exclude containers and user-definable regions from the list. +// Size: 1432 bytes, 358 elements +var likelyRegion = [358]likelyLangScript{ + 34: {lang: 0xd7, script: 0x5a, flags: 0x0}, + 35: {lang: 0x3a, script: 0x5, flags: 0x0}, + 36: {lang: 0x0, script: 0x2, flags: 0x1}, + 39: {lang: 0x2, script: 0x2, flags: 0x1}, + 40: {lang: 0x4, script: 0x2, flags: 0x1}, + 42: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 43: {lang: 0x0, script: 0x5a, flags: 0x0}, + 44: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 45: {lang: 0x41b, script: 0x5a, flags: 0x0}, + 46: {lang: 0x10d, script: 0x5a, flags: 0x0}, + 48: {lang: 0x367, script: 0x5a, flags: 0x0}, + 49: {lang: 0x444, script: 0x5a, flags: 0x0}, + 50: {lang: 0x58, script: 0x5a, flags: 0x0}, + 51: {lang: 0x6, script: 0x2, flags: 0x1}, + 53: {lang: 0xa5, script: 0xe, flags: 0x0}, + 54: {lang: 0x367, script: 0x5a, flags: 0x0}, + 55: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 56: {lang: 0x7e, script: 0x20, flags: 0x0}, + 57: {lang: 0x3a, script: 0x5, flags: 0x0}, + 58: {lang: 0x3d9, script: 0x5a, flags: 0x0}, + 59: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 60: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 62: {lang: 0x31f, script: 0x5a, flags: 0x0}, + 63: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 64: {lang: 0x3a1, script: 0x5a, flags: 0x0}, + 65: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 67: {lang: 0x8, script: 0x2, flags: 0x1}, + 69: {lang: 0x0, script: 0x5a, flags: 0x0}, + 71: {lang: 0x71, script: 0x20, flags: 0x0}, + 73: {lang: 0x512, script: 0x3e, flags: 0x2}, + 74: {lang: 0x31f, script: 0x5, flags: 0x2}, + 75: {lang: 0x445, script: 0x5a, flags: 0x0}, + 76: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 77: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 78: {lang: 0x10d, script: 0x5a, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 81: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 82: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 83: {lang: 0xa, script: 0x4, flags: 0x1}, + 84: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 85: {lang: 0x0, script: 0x5a, flags: 0x0}, + 86: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 89: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 90: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 91: {lang: 0x3a1, script: 0x5a, flags: 0x0}, + 93: {lang: 0xe, script: 0x2, flags: 0x1}, + 94: {lang: 0xfa, script: 0x5a, flags: 0x0}, + 96: {lang: 0x10d, script: 0x5a, flags: 0x0}, + 98: {lang: 0x1, script: 0x5a, flags: 0x0}, + 99: {lang: 0x101, script: 0x5a, flags: 0x0}, + 101: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 103: {lang: 0x10, script: 0x2, flags: 0x1}, + 104: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 105: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 106: {lang: 0x140, script: 0x5a, flags: 0x0}, + 107: {lang: 0x3a, script: 0x5, flags: 0x0}, + 108: {lang: 0x3a, script: 0x5, flags: 0x0}, + 109: {lang: 0x46f, script: 0x2c, flags: 0x0}, + 110: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 111: {lang: 0x12, script: 0x2, flags: 0x1}, + 113: {lang: 0x10d, script: 0x5a, flags: 0x0}, + 114: {lang: 0x151, script: 0x5a, flags: 0x0}, + 115: {lang: 0x1c0, script: 0x22, flags: 0x2}, + 118: {lang: 0x158, script: 0x5a, flags: 0x0}, + 120: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 122: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 123: {lang: 0x14, script: 0x2, flags: 0x1}, + 125: {lang: 0x16, script: 0x3, flags: 0x1}, + 126: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 128: {lang: 0x21, script: 0x5a, flags: 0x0}, + 130: {lang: 0x245, script: 0x5a, flags: 0x0}, + 132: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 133: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 134: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 135: {lang: 0x19, script: 0x2, flags: 0x1}, + 136: {lang: 0x0, script: 0x5a, flags: 0x0}, + 137: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 139: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 141: {lang: 0x529, script: 0x3c, flags: 0x0}, + 142: {lang: 0x0, script: 0x5a, flags: 0x0}, + 143: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 144: {lang: 0x1d1, script: 0x5a, flags: 0x0}, + 145: {lang: 0x1d4, script: 0x5a, flags: 0x0}, + 146: {lang: 0x1d5, script: 0x5a, flags: 0x0}, + 148: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 149: {lang: 0x1b, script: 0x2, flags: 0x1}, + 151: {lang: 0x1bc, script: 0x3e, flags: 0x0}, + 153: {lang: 0x1d, script: 0x3, flags: 0x1}, + 155: {lang: 0x3a, script: 0x5, flags: 0x0}, + 156: {lang: 0x20, script: 0x2, flags: 0x1}, + 157: {lang: 0x1f8, script: 0x5a, flags: 0x0}, + 158: {lang: 0x1f9, script: 0x5a, flags: 0x0}, + 161: {lang: 0x3a, script: 0x5, flags: 0x0}, + 162: {lang: 0x200, script: 0x49, flags: 0x0}, + 164: {lang: 0x445, script: 0x5a, flags: 0x0}, + 165: {lang: 0x28a, script: 0x20, flags: 0x0}, + 166: {lang: 0x22, script: 0x3, flags: 0x1}, + 168: {lang: 0x25, script: 0x2, flags: 0x1}, + 170: {lang: 0x254, script: 0x53, flags: 0x0}, + 171: {lang: 0x254, script: 0x53, flags: 0x0}, + 172: {lang: 0x3a, script: 0x5, flags: 0x0}, + 174: {lang: 0x3e2, script: 0x20, flags: 0x0}, + 175: {lang: 0x27, script: 0x2, flags: 0x1}, + 176: {lang: 0x3a, script: 0x5, flags: 0x0}, + 178: {lang: 0x10d, script: 0x5a, flags: 0x0}, + 179: {lang: 0x40c, script: 0xcf, flags: 0x0}, + 181: {lang: 0x43b, script: 0x5a, flags: 0x0}, + 182: {lang: 0x2c0, script: 0x5a, flags: 0x0}, + 183: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 184: {lang: 0x2c7, script: 0x5a, flags: 0x0}, + 185: {lang: 0x3a, script: 0x5, flags: 0x0}, + 186: {lang: 0x29, script: 0x2, flags: 0x1}, + 187: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 188: {lang: 0x2b, script: 0x2, flags: 0x1}, + 189: {lang: 0x432, script: 0x5a, flags: 0x0}, + 190: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 191: {lang: 0x2f1, script: 0x5a, flags: 0x0}, + 194: {lang: 0x2d, script: 0x2, flags: 0x1}, + 195: {lang: 0xa0, script: 0x5a, flags: 0x0}, + 196: {lang: 0x2f, script: 0x2, flags: 0x1}, + 197: {lang: 0x31, script: 0x2, flags: 0x1}, + 198: {lang: 0x33, script: 0x2, flags: 0x1}, + 200: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 201: {lang: 0x35, script: 0x2, flags: 0x1}, + 203: {lang: 0x320, script: 0x5a, flags: 0x0}, + 204: {lang: 0x37, script: 0x3, flags: 0x1}, + 205: {lang: 0x128, script: 0xe5, flags: 0x0}, + 207: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 208: {lang: 0x31f, script: 0x5a, flags: 0x0}, + 209: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 210: {lang: 0x16, script: 0x5a, flags: 0x0}, + 211: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 212: {lang: 0x1b4, script: 0x5a, flags: 0x0}, + 214: {lang: 0x1b4, script: 0x5, flags: 0x2}, + 216: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 217: {lang: 0x367, script: 0x5a, flags: 0x0}, + 218: {lang: 0x347, script: 0x5a, flags: 0x0}, + 219: {lang: 0x351, script: 0x22, flags: 0x0}, + 225: {lang: 0x3a, script: 0x5, flags: 0x0}, + 226: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 228: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 229: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 230: {lang: 0x486, script: 0x5a, flags: 0x0}, + 231: {lang: 0x153, script: 0x5a, flags: 0x0}, + 232: {lang: 0x3a, script: 0x3, flags: 0x1}, + 233: {lang: 0x3b3, script: 0x5a, flags: 0x0}, + 234: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 236: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 237: {lang: 0x3a, script: 0x5, flags: 0x0}, + 238: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 240: {lang: 0x3a2, script: 0x5a, flags: 0x0}, + 241: {lang: 0x194, script: 0x5a, flags: 0x0}, + 243: {lang: 0x3a, script: 0x5, flags: 0x0}, + 258: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 260: {lang: 0x3d, script: 0x2, flags: 0x1}, + 261: {lang: 0x432, script: 0x20, flags: 0x0}, + 262: {lang: 0x3f, script: 0x2, flags: 0x1}, + 263: {lang: 0x3e5, script: 0x5a, flags: 0x0}, + 264: {lang: 0x3a, script: 0x5, flags: 0x0}, + 266: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 267: {lang: 0x3a, script: 0x5, flags: 0x0}, + 268: {lang: 0x41, script: 0x2, flags: 0x1}, + 271: {lang: 0x416, script: 0x5a, flags: 0x0}, + 272: {lang: 0x347, script: 0x5a, flags: 0x0}, + 273: {lang: 0x43, script: 0x2, flags: 0x1}, + 275: {lang: 0x1f9, script: 0x5a, flags: 0x0}, + 276: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 277: {lang: 0x429, script: 0x5a, flags: 0x0}, + 278: {lang: 0x367, script: 0x5a, flags: 0x0}, + 280: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 282: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 284: {lang: 0x45, script: 0x2, flags: 0x1}, + 288: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 289: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 290: {lang: 0x47, script: 0x2, flags: 0x1}, + 291: {lang: 0x49, script: 0x3, flags: 0x1}, + 292: {lang: 0x4c, script: 0x2, flags: 0x1}, + 293: {lang: 0x477, script: 0x5a, flags: 0x0}, + 294: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 295: {lang: 0x476, script: 0x5a, flags: 0x0}, + 296: {lang: 0x4e, script: 0x2, flags: 0x1}, + 297: {lang: 0x482, script: 0x5a, flags: 0x0}, + 299: {lang: 0x50, script: 0x4, flags: 0x1}, + 301: {lang: 0x4a0, script: 0x5a, flags: 0x0}, + 302: {lang: 0x54, script: 0x2, flags: 0x1}, + 303: {lang: 0x445, script: 0x5a, flags: 0x0}, + 304: {lang: 0x56, script: 0x3, flags: 0x1}, + 305: {lang: 0x445, script: 0x5a, flags: 0x0}, + 309: {lang: 0x512, script: 0x3e, flags: 0x2}, + 310: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 311: {lang: 0x4bc, script: 0x5a, flags: 0x0}, + 312: {lang: 0x1f9, script: 0x5a, flags: 0x0}, + 315: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 318: {lang: 0x4c3, script: 0x5a, flags: 0x0}, + 319: {lang: 0x8a, script: 0x5a, flags: 0x0}, + 320: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 322: {lang: 0x41b, script: 0x5a, flags: 0x0}, + 333: {lang: 0x59, script: 0x2, flags: 0x1}, + 350: {lang: 0x3a, script: 0x5, flags: 0x0}, + 351: {lang: 0x5b, script: 0x2, flags: 0x1}, + 356: {lang: 0x423, script: 0x5a, flags: 0x0}, +} + +// likelyRegionList holds lists info associated with likelyRegion. +// Size: 372 bytes, 93 elements +var likelyRegionList = [93]likelyLangScript{ + 0: {lang: 0x148, script: 0x5, flags: 0x0}, + 1: {lang: 0x476, script: 0x5a, flags: 0x0}, + 2: {lang: 0x431, script: 0x5a, flags: 0x0}, + 3: {lang: 0x2ff, script: 0x20, flags: 0x0}, + 4: {lang: 0x1d7, script: 0x8, flags: 0x0}, + 5: {lang: 0x274, script: 0x5a, flags: 0x0}, + 6: {lang: 0xb7, script: 0x5a, flags: 0x0}, + 7: {lang: 0x432, script: 0x20, flags: 0x0}, + 8: {lang: 0x12d, script: 0xe7, flags: 0x0}, + 9: {lang: 0x351, script: 0x22, flags: 0x0}, + 10: {lang: 0x529, script: 0x3b, flags: 0x0}, + 11: {lang: 0x4ac, script: 0x5, flags: 0x0}, + 12: {lang: 0x523, script: 0x5a, flags: 0x0}, + 13: {lang: 0x29a, script: 0xe6, flags: 0x0}, + 14: {lang: 0x136, script: 0x34, flags: 0x0}, + 15: {lang: 0x48a, script: 0x5a, flags: 0x0}, + 16: {lang: 0x3a, script: 0x5, flags: 0x0}, + 17: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 18: {lang: 0x27, script: 0x2c, flags: 0x0}, + 19: {lang: 0x139, script: 0x5a, flags: 0x0}, + 20: {lang: 0x26a, script: 0x5, flags: 0x2}, + 21: {lang: 0x512, script: 0x3e, flags: 0x2}, + 22: {lang: 0x210, script: 0x2e, flags: 0x0}, + 23: {lang: 0x5, script: 0x20, flags: 0x0}, + 24: {lang: 0x274, script: 0x5a, flags: 0x0}, + 25: {lang: 0x136, script: 0x34, flags: 0x0}, + 26: {lang: 0x2ff, script: 0x20, flags: 0x0}, + 27: {lang: 0x1e1, script: 0x5a, flags: 0x0}, + 28: {lang: 0x31f, script: 0x5, flags: 0x0}, + 29: {lang: 0x1be, script: 0x22, flags: 0x0}, + 30: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 31: {lang: 0x236, script: 0x75, flags: 0x0}, + 32: {lang: 0x148, script: 0x5, flags: 0x0}, + 33: {lang: 0x476, script: 0x5a, flags: 0x0}, + 34: {lang: 0x24a, script: 0x4e, flags: 0x0}, + 35: {lang: 0xe6, script: 0x5, flags: 0x0}, + 36: {lang: 0x226, script: 0xe6, flags: 0x0}, + 37: {lang: 0x3a, script: 0x5, flags: 0x0}, + 38: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 39: {lang: 0x2b8, script: 0x57, flags: 0x0}, + 40: {lang: 0x226, script: 0xe6, flags: 0x0}, + 41: {lang: 0x3a, script: 0x5, flags: 0x0}, + 42: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 43: {lang: 0x3dc, script: 0x5a, flags: 0x0}, + 44: {lang: 0x4ae, script: 0x20, flags: 0x0}, + 45: {lang: 0x2ff, script: 0x20, flags: 0x0}, + 46: {lang: 0x431, script: 0x5a, flags: 0x0}, + 47: {lang: 0x331, script: 0x75, flags: 0x0}, + 48: {lang: 0x213, script: 0x5a, flags: 0x0}, + 49: {lang: 0x30b, script: 0x20, flags: 0x0}, + 50: {lang: 0x242, script: 0x5, flags: 0x0}, + 51: {lang: 0x529, script: 0x3c, flags: 0x0}, + 52: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 53: {lang: 0x3a, script: 0x5, flags: 0x0}, + 54: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 55: {lang: 0x2ed, script: 0x5a, flags: 0x0}, + 56: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 57: {lang: 0x88, script: 0x22, flags: 0x0}, + 58: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 59: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 60: {lang: 0xbe, script: 0x22, flags: 0x0}, + 61: {lang: 0x3dc, script: 0x5a, flags: 0x0}, + 62: {lang: 0x7e, script: 0x20, flags: 0x0}, + 63: {lang: 0x3e2, script: 0x20, flags: 0x0}, + 64: {lang: 0x267, script: 0x5a, flags: 0x0}, + 65: {lang: 0x444, script: 0x5a, flags: 0x0}, + 66: {lang: 0x512, script: 0x3e, flags: 0x0}, + 67: {lang: 0x412, script: 0x5a, flags: 0x0}, + 68: {lang: 0x4ae, script: 0x20, flags: 0x0}, + 69: {lang: 0x3a, script: 0x5, flags: 0x0}, + 70: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 71: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 72: {lang: 0x35, script: 0x5, flags: 0x0}, + 73: {lang: 0x46b, script: 0xe6, flags: 0x0}, + 74: {lang: 0x2ec, script: 0x5, flags: 0x0}, + 75: {lang: 0x30f, script: 0x75, flags: 0x0}, + 76: {lang: 0x467, script: 0x20, flags: 0x0}, + 77: {lang: 0x148, script: 0x5, flags: 0x0}, + 78: {lang: 0x3a, script: 0x5, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 80: {lang: 0x48a, script: 0x5a, flags: 0x0}, + 81: {lang: 0x58, script: 0x5, flags: 0x0}, + 82: {lang: 0x219, script: 0x20, flags: 0x0}, + 83: {lang: 0x81, script: 0x34, flags: 0x0}, + 84: {lang: 0x529, script: 0x3c, flags: 0x0}, + 85: {lang: 0x48c, script: 0x5a, flags: 0x0}, + 86: {lang: 0x4ae, script: 0x20, flags: 0x0}, + 87: {lang: 0x512, script: 0x3e, flags: 0x0}, + 88: {lang: 0x3b3, script: 0x5a, flags: 0x0}, + 89: {lang: 0x431, script: 0x5a, flags: 0x0}, + 90: {lang: 0x432, script: 0x20, flags: 0x0}, + 91: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 92: {lang: 0x446, script: 0x5, flags: 0x0}, +} + +type likelyTag struct { + lang uint16 + region uint16 + script uint8 +} + +// Size: 198 bytes, 33 elements +var likelyRegionGroup = [33]likelyTag{ + 1: {lang: 0x139, region: 0xd6, script: 0x5a}, + 2: {lang: 0x139, region: 0x135, script: 0x5a}, + 3: {lang: 0x3c0, region: 0x41, script: 0x5a}, + 4: {lang: 0x139, region: 0x2f, script: 0x5a}, + 5: {lang: 0x139, region: 0xd6, script: 0x5a}, + 6: {lang: 0x13e, region: 0xcf, script: 0x5a}, + 7: {lang: 0x445, region: 0x12f, script: 0x5a}, + 8: {lang: 0x3a, region: 0x6b, script: 0x5}, + 9: {lang: 0x445, region: 0x4b, script: 0x5a}, + 10: {lang: 0x139, region: 0x161, script: 0x5a}, + 11: {lang: 0x139, region: 0x135, script: 0x5a}, + 12: {lang: 0x139, region: 0x135, script: 0x5a}, + 13: {lang: 0x13e, region: 0x59, script: 0x5a}, + 14: {lang: 0x529, region: 0x53, script: 0x3b}, + 15: {lang: 0x1be, region: 0x99, script: 0x22}, + 16: {lang: 0x1e1, region: 0x95, script: 0x5a}, + 17: {lang: 0x1f9, region: 0x9e, script: 0x5a}, + 18: {lang: 0x139, region: 0x2f, script: 0x5a}, + 19: {lang: 0x139, region: 0xe6, script: 0x5a}, + 20: {lang: 0x139, region: 0x8a, script: 0x5a}, + 21: {lang: 0x41b, region: 0x142, script: 0x5a}, + 22: {lang: 0x529, region: 0x53, script: 0x3b}, + 23: {lang: 0x4bc, region: 0x137, script: 0x5a}, + 24: {lang: 0x3a, region: 0x108, script: 0x5}, + 25: {lang: 0x3e2, region: 0x106, script: 0x20}, + 26: {lang: 0x3e2, region: 0x106, script: 0x20}, + 27: {lang: 0x139, region: 0x7b, script: 0x5a}, + 28: {lang: 0x10d, region: 0x60, script: 0x5a}, + 29: {lang: 0x139, region: 0xd6, script: 0x5a}, + 30: {lang: 0x13e, region: 0x1f, script: 0x5a}, + 31: {lang: 0x139, region: 0x9a, script: 0x5a}, + 32: {lang: 0x139, region: 0x7b, script: 0x5a}, +} + +// Size: 264 bytes, 33 elements +var regionContainment = [33]uint64{ + // Entry 0 - 1F + 0x00000001ffffffff, 0x00000000200007a2, 0x0000000000003044, 0x0000000000000008, + 0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080, + 0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c, + 0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000, + 0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000, + 0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000, + 0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000, + 0x0000000010000000, 0x00000000200006a0, 0x0000000040002048, 0x0000000080000000, + // Entry 20 - 3F + 0x0000000100000000, +} + +// regionInclusion maps region identifiers to sets of regions in regionInclusionBits, +// where each set holds all groupings that are directly connected in a region +// containment graph. +// Size: 358 bytes, 358 elements +var regionInclusion = [358]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, + 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, + 0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16, + 0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e, + 0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23, + 0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b, + 0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d, + 0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28, + // Entry 40 - 7F + 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33, + 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d, + 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23, + 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35, + 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39, + 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f, + 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21, + 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c, + // Entry 80 - BF + 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a, + 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34, + 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24, + 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c, + 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c, + 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31, + 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a, + 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f, + // Entry C0 - FF + 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c, + 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34, + 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21, + 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29, + 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31, + 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21, + 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, + // Entry 100 - 13F + 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f, + 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a, + 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f, + 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26, + 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d, + 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f, + 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d, + 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b, + // Entry 140 - 17F + 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f, + 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, +} + +// regionInclusionBits is an array of bit vectors where every vector represents +// a set of region groupings. These sets are used to compute the distance +// between two regions for the purpose of language matching. +// Size: 584 bytes, 73 elements +var regionInclusionBits = [73]uint64{ + // Entry 0 - 1F + 0x0000000102400813, 0x00000000200007a3, 0x0000000000003844, 0x0000000040000808, + 0x00000000803c0011, 0x0000000020000022, 0x0000000040000844, 0x0000000020000082, + 0x0000000000000102, 0x0000000020000202, 0x0000000020000402, 0x000000004000384d, + 0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000, + 0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010, + 0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000, + 0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000, + 0x0000000012000000, 0x00000000200006a2, 0x0000000040002848, 0x0000000080000010, + // Entry 20 - 3F + 0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000, + 0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200, + 0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000, + 0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080, + 0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000, + 0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000, + 0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000, + 0x0000000000100000, 0x0000000000800000, 0x00000001ffffffff, 0x0000000122400fb3, + // Entry 40 - 5F + 0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813, + 0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001, + 0x0000000102020001, +} + +// regionInclusionNext marks, for each entry in regionInclusionBits, the set of +// all groups that are reachable from the groups set in the respective entry. +// Size: 73 bytes, 73 elements +var regionInclusionNext = [73]uint8{ + // Entry 0 - 3F + 0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01, + 0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16, + 0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16, + 0x16, 0x43, 0x19, 0x19, 0x19, 0x01, 0x0b, 0x04, + 0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09, + 0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07, + 0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46, + 0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e, + // Entry 40 - 7F + 0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43, + 0x43, +} + +type parentRel struct { + lang uint16 + script uint8 + maxScript uint8 + toRegion uint16 + fromRegion []uint16 +} + +// Size: 414 bytes, 5 elements +var parents = [5]parentRel{ + 0: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}}, + 1: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}}, + 2: {lang: 0x13e, script: 0x0, maxScript: 0x5a, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}}, + 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5a, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}}, + 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8d, fromRegion: []uint16{0xc6}}, +} + +// Total table size 26398 bytes (25KiB); checksum: 1C859EA7 diff --git a/vendor/golang.org/x/text/internal/language/tags.go b/vendor/golang.org/x/text/internal/language/tags.go new file mode 100644 index 0000000..e7afd31 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/tags.go @@ -0,0 +1,48 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. +// It simplifies safe initialization of Tag values. +func MustParse(s string) Tag { + t, err := Parse(s) + if err != nil { + panic(err) + } + return t +} + +// MustParseBase is like ParseBase, but panics if the given base cannot be parsed. +// It simplifies safe initialization of Base values. +func MustParseBase(s string) Language { + b, err := ParseBase(s) + if err != nil { + panic(err) + } + return b +} + +// MustParseScript is like ParseScript, but panics if the given script cannot be +// parsed. It simplifies safe initialization of Script values. +func MustParseScript(s string) Script { + scr, err := ParseScript(s) + if err != nil { + panic(err) + } + return scr +} + +// MustParseRegion is like ParseRegion, but panics if the given region cannot be +// parsed. It simplifies safe initialization of Region values. +func MustParseRegion(s string) Region { + r, err := ParseRegion(s) + if err != nil { + panic(err) + } + return r +} + +// Und is the root language. +var Und Tag diff --git a/vendor/golang.org/x/text/internal/match.go b/vendor/golang.org/x/text/internal/match.go new file mode 100644 index 0000000..1cc004a --- /dev/null +++ b/vendor/golang.org/x/text/internal/match.go @@ -0,0 +1,67 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package internal + +// This file contains matchers that implement CLDR inheritance. +// +// See https://unicode.org/reports/tr35/#Locale_Inheritance. +// +// Some of the inheritance described in this document is already handled by +// the cldr package. + +import ( + "golang.org/x/text/language" +) + +// TODO: consider if (some of the) matching algorithm needs to be public after +// getting some feel about what is generic and what is specific. + +// NewInheritanceMatcher returns a matcher that matches based on the inheritance +// chain. +// +// The matcher uses canonicalization and the parent relationship to find a +// match. The resulting match will always be either Und or a language with the +// same language and script as the requested language. It will not match +// languages for which there is understood to be mutual or one-directional +// intelligibility. +// +// A Match will indicate an Exact match if the language matches after +// canonicalization and High if the matched tag is a parent. +func NewInheritanceMatcher(t []language.Tag) *InheritanceMatcher { + tags := &InheritanceMatcher{make(map[language.Tag]int)} + for i, tag := range t { + ct, err := language.All.Canonicalize(tag) + if err != nil { + ct = tag + } + tags.index[ct] = i + } + return tags +} + +type InheritanceMatcher struct { + index map[language.Tag]int +} + +func (m InheritanceMatcher) Match(want ...language.Tag) (language.Tag, int, language.Confidence) { + for _, t := range want { + ct, err := language.All.Canonicalize(t) + if err != nil { + ct = t + } + conf := language.Exact + for { + if index, ok := m.index[ct]; ok { + return ct, index, conf + } + if ct == language.Und { + break + } + ct = ct.Parent() + conf = language.High + } + } + return language.Und, 0, language.No +} diff --git a/vendor/golang.org/x/text/internal/tag/tag.go b/vendor/golang.org/x/text/internal/tag/tag.go new file mode 100644 index 0000000..b5d3488 --- /dev/null +++ b/vendor/golang.org/x/text/internal/tag/tag.go @@ -0,0 +1,100 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package tag contains functionality handling tags and related data. +package tag // import "golang.org/x/text/internal/tag" + +import "sort" + +// An Index converts tags to a compact numeric value. +// +// All elements are of size 4. Tags may be up to 4 bytes long. Excess bytes can +// be used to store additional information about the tag. +type Index string + +// Elem returns the element data at the given index. +func (s Index) Elem(x int) string { + return string(s[x*4 : x*4+4]) +} + +// Index reports the index of the given key or -1 if it could not be found. +// Only the first len(key) bytes from the start of the 4-byte entries will be +// considered for the search and the first match in Index will be returned. +func (s Index) Index(key []byte) int { + n := len(key) + // search the index of the first entry with an equal or higher value than + // key in s. + index := sort.Search(len(s)/4, func(i int) bool { + return cmp(s[i*4:i*4+n], key) != -1 + }) + i := index * 4 + if cmp(s[i:i+len(key)], key) != 0 { + return -1 + } + return index +} + +// Next finds the next occurrence of key after index x, which must have been +// obtained from a call to Index using the same key. It returns x+1 or -1. +func (s Index) Next(key []byte, x int) int { + if x++; x*4 < len(s) && cmp(s[x*4:x*4+len(key)], key) == 0 { + return x + } + return -1 +} + +// cmp returns an integer comparing a and b lexicographically. +func cmp(a Index, b []byte) int { + n := len(a) + if len(b) < n { + n = len(b) + } + for i, c := range b[:n] { + switch { + case a[i] > c: + return 1 + case a[i] < c: + return -1 + } + } + switch { + case len(a) < len(b): + return -1 + case len(a) > len(b): + return 1 + } + return 0 +} + +// Compare returns an integer comparing a and b lexicographically. +func Compare(a string, b []byte) int { + return cmp(Index(a), b) +} + +// FixCase reformats b to the same pattern of cases as form. +// If returns false if string b is malformed. +func FixCase(form string, b []byte) bool { + if len(form) != len(b) { + return false + } + for i, c := range b { + if form[i] <= 'Z' { + if c >= 'a' { + c -= 'z' - 'Z' + } + if c < 'A' || 'Z' < c { + return false + } + } else { + if c <= 'Z' { + c += 'z' - 'Z' + } + if c < 'a' || 'z' < c { + return false + } + } + b[i] = c + } + return true +} diff --git a/vendor/golang.org/x/text/language/coverage.go b/vendor/golang.org/x/text/language/coverage.go new file mode 100644 index 0000000..a24fd1a --- /dev/null +++ b/vendor/golang.org/x/text/language/coverage.go @@ -0,0 +1,187 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "fmt" + "sort" + + "golang.org/x/text/internal/language" +) + +// The Coverage interface is used to define the level of coverage of an +// internationalization service. Note that not all types are supported by all +// services. As lists may be generated on the fly, it is recommended that users +// of a Coverage cache the results. +type Coverage interface { + // Tags returns the list of supported tags. + Tags() []Tag + + // BaseLanguages returns the list of supported base languages. + BaseLanguages() []Base + + // Scripts returns the list of supported scripts. + Scripts() []Script + + // Regions returns the list of supported regions. + Regions() []Region +} + +var ( + // Supported defines a Coverage that lists all supported subtags. Tags + // always returns nil. + Supported Coverage = allSubtags{} +) + +// TODO: +// - Support Variants, numbering systems. +// - CLDR coverage levels. +// - Set of common tags defined in this package. + +type allSubtags struct{} + +// Regions returns the list of supported regions. As all regions are in a +// consecutive range, it simply returns a slice of numbers in increasing order. +// The "undefined" region is not returned. +func (s allSubtags) Regions() []Region { + reg := make([]Region, language.NumRegions) + for i := range reg { + reg[i] = Region{language.Region(i + 1)} + } + return reg +} + +// Scripts returns the list of supported scripts. As all scripts are in a +// consecutive range, it simply returns a slice of numbers in increasing order. +// The "undefined" script is not returned. +func (s allSubtags) Scripts() []Script { + scr := make([]Script, language.NumScripts) + for i := range scr { + scr[i] = Script{language.Script(i + 1)} + } + return scr +} + +// BaseLanguages returns the list of all supported base languages. It generates +// the list by traversing the internal structures. +func (s allSubtags) BaseLanguages() []Base { + bs := language.BaseLanguages() + base := make([]Base, len(bs)) + for i, b := range bs { + base[i] = Base{b} + } + return base +} + +// Tags always returns nil. +func (s allSubtags) Tags() []Tag { + return nil +} + +// coverage is used by NewCoverage which is used as a convenient way for +// creating Coverage implementations for partially defined data. Very often a +// package will only need to define a subset of slices. coverage provides a +// convenient way to do this. Moreover, packages using NewCoverage, instead of +// their own implementation, will not break if later new slice types are added. +type coverage struct { + tags func() []Tag + bases func() []Base + scripts func() []Script + regions func() []Region +} + +func (s *coverage) Tags() []Tag { + if s.tags == nil { + return nil + } + return s.tags() +} + +// bases implements sort.Interface and is used to sort base languages. +type bases []Base + +func (b bases) Len() int { + return len(b) +} + +func (b bases) Swap(i, j int) { + b[i], b[j] = b[j], b[i] +} + +func (b bases) Less(i, j int) bool { + return b[i].langID < b[j].langID +} + +// BaseLanguages returns the result from calling s.bases if it is specified or +// otherwise derives the set of supported base languages from tags. +func (s *coverage) BaseLanguages() []Base { + if s.bases == nil { + tags := s.Tags() + if len(tags) == 0 { + return nil + } + a := make([]Base, len(tags)) + for i, t := range tags { + a[i] = Base{language.Language(t.lang())} + } + sort.Sort(bases(a)) + k := 0 + for i := 1; i < len(a); i++ { + if a[k] != a[i] { + k++ + a[k] = a[i] + } + } + return a[:k+1] + } + return s.bases() +} + +func (s *coverage) Scripts() []Script { + if s.scripts == nil { + return nil + } + return s.scripts() +} + +func (s *coverage) Regions() []Region { + if s.regions == nil { + return nil + } + return s.regions() +} + +// NewCoverage returns a Coverage for the given lists. It is typically used by +// packages providing internationalization services to define their level of +// coverage. A list may be of type []T or func() []T, where T is either Tag, +// Base, Script or Region. The returned Coverage derives the value for Bases +// from Tags if no func or slice for []Base is specified. For other unspecified +// types the returned Coverage will return nil for the respective methods. +func NewCoverage(list ...interface{}) Coverage { + s := &coverage{} + for _, x := range list { + switch v := x.(type) { + case func() []Base: + s.bases = v + case func() []Script: + s.scripts = v + case func() []Region: + s.regions = v + case func() []Tag: + s.tags = v + case []Base: + s.bases = func() []Base { return v } + case []Script: + s.scripts = func() []Script { return v } + case []Region: + s.regions = func() []Region { return v } + case []Tag: + s.tags = func() []Tag { return v } + default: + panic(fmt.Sprintf("language: unsupported set type %T", v)) + } + } + return s +} diff --git a/vendor/golang.org/x/text/language/doc.go b/vendor/golang.org/x/text/language/doc.go new file mode 100644 index 0000000..8afecd5 --- /dev/null +++ b/vendor/golang.org/x/text/language/doc.go @@ -0,0 +1,102 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package language implements BCP 47 language tags and related functionality. +// +// The most important function of package language is to match a list of +// user-preferred languages to a list of supported languages. +// It alleviates the developer of dealing with the complexity of this process +// and provides the user with the best experience +// (see https://blog.golang.org/matchlang). +// +// +// Matching preferred against supported languages +// +// A Matcher for an application that supports English, Australian English, +// Danish, and standard Mandarin can be created as follows: +// +// var matcher = language.NewMatcher([]language.Tag{ +// language.English, // The first language is used as fallback. +// language.MustParse("en-AU"), +// language.Danish, +// language.Chinese, +// }) +// +// This list of supported languages is typically implied by the languages for +// which there exists translations of the user interface. +// +// User-preferred languages usually come as a comma-separated list of BCP 47 +// language tags. +// The MatchString finds best matches for such strings: +// +// handler(w http.ResponseWriter, r *http.Request) { +// lang, _ := r.Cookie("lang") +// accept := r.Header.Get("Accept-Language") +// tag, _ := language.MatchStrings(matcher, lang.String(), accept) +// +// // tag should now be used for the initialization of any +// // locale-specific service. +// } +// +// The Matcher's Match method can be used to match Tags directly. +// +// Matchers are aware of the intricacies of equivalence between languages, such +// as deprecated subtags, legacy tags, macro languages, mutual +// intelligibility between scripts and languages, and transparently passing +// BCP 47 user configuration. +// For instance, it will know that a reader of Bokmål Danish can read Norwegian +// and will know that Cantonese ("yue") is a good match for "zh-HK". +// +// +// Using match results +// +// To guarantee a consistent user experience to the user it is important to +// use the same language tag for the selection of any locale-specific services. +// For example, it is utterly confusing to substitute spelled-out numbers +// or dates in one language in text of another language. +// More subtly confusing is using the wrong sorting order or casing +// algorithm for a certain language. +// +// All the packages in x/text that provide locale-specific services +// (e.g. collate, cases) should be initialized with the tag that was +// obtained at the start of an interaction with the user. +// +// Note that Tag that is returned by Match and MatchString may differ from any +// of the supported languages, as it may contain carried over settings from +// the user tags. +// This may be inconvenient when your application has some additional +// locale-specific data for your supported languages. +// Match and MatchString both return the index of the matched supported tag +// to simplify associating such data with the matched tag. +// +// +// Canonicalization +// +// If one uses the Matcher to compare languages one does not need to +// worry about canonicalization. +// +// The meaning of a Tag varies per application. The language package +// therefore delays canonicalization and preserves information as much +// as possible. The Matcher, however, will always take into account that +// two different tags may represent the same language. +// +// By default, only legacy and deprecated tags are converted into their +// canonical equivalent. All other information is preserved. This approach makes +// the confidence scores more accurate and allows matchers to distinguish +// between variants that are otherwise lost. +// +// As a consequence, two tags that should be treated as identical according to +// BCP 47 or CLDR, like "en-Latn" and "en", will be represented differently. The +// Matcher handles such distinctions, though, and is aware of the +// equivalence relations. The CanonType type can be used to alter the +// canonicalization form. +// +// References +// +// BCP 47 - Tags for Identifying Languages http://tools.ietf.org/html/bcp47 +// +package language // import "golang.org/x/text/language" + +// TODO: explanation on how to match languages for your own locale-specific +// service. diff --git a/vendor/golang.org/x/text/language/go1_1.go b/vendor/golang.org/x/text/language/go1_1.go new file mode 100644 index 0000000..c743558 --- /dev/null +++ b/vendor/golang.org/x/text/language/go1_1.go @@ -0,0 +1,39 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build !go1.2 +// +build !go1.2 + +package language + +import "sort" + +func sortStable(s sort.Interface) { + ss := stableSort{ + s: s, + pos: make([]int, s.Len()), + } + for i := range ss.pos { + ss.pos[i] = i + } + sort.Sort(&ss) +} + +type stableSort struct { + s sort.Interface + pos []int +} + +func (s *stableSort) Len() int { + return len(s.pos) +} + +func (s *stableSort) Less(i, j int) bool { + return s.s.Less(i, j) || !s.s.Less(j, i) && s.pos[i] < s.pos[j] +} + +func (s *stableSort) Swap(i, j int) { + s.s.Swap(i, j) + s.pos[i], s.pos[j] = s.pos[j], s.pos[i] +} diff --git a/vendor/golang.org/x/text/language/go1_2.go b/vendor/golang.org/x/text/language/go1_2.go new file mode 100644 index 0000000..77aaaa2 --- /dev/null +++ b/vendor/golang.org/x/text/language/go1_2.go @@ -0,0 +1,12 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build go1.2 +// +build go1.2 + +package language + +import "sort" + +var sortStable = sort.Stable diff --git a/vendor/golang.org/x/text/language/language.go b/vendor/golang.org/x/text/language/language.go new file mode 100644 index 0000000..289b3a3 --- /dev/null +++ b/vendor/golang.org/x/text/language/language.go @@ -0,0 +1,605 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go -output tables.go + +package language + +// TODO: Remove above NOTE after: +// - verifying that tables are dropped correctly (most notably matcher tables). + +import ( + "strings" + + "golang.org/x/text/internal/language" + "golang.org/x/text/internal/language/compact" +) + +// Tag represents a BCP 47 language tag. It is used to specify an instance of a +// specific language or locale. All language tag values are guaranteed to be +// well-formed. +type Tag compact.Tag + +func makeTag(t language.Tag) (tag Tag) { + return Tag(compact.Make(t)) +} + +func (t *Tag) tag() language.Tag { + return (*compact.Tag)(t).Tag() +} + +func (t *Tag) isCompact() bool { + return (*compact.Tag)(t).IsCompact() +} + +// TODO: improve performance. +func (t *Tag) lang() language.Language { return t.tag().LangID } +func (t *Tag) region() language.Region { return t.tag().RegionID } +func (t *Tag) script() language.Script { return t.tag().ScriptID } + +// Make is a convenience wrapper for Parse that omits the error. +// In case of an error, a sensible default is returned. +func Make(s string) Tag { + return Default.Make(s) +} + +// Make is a convenience wrapper for c.Parse that omits the error. +// In case of an error, a sensible default is returned. +func (c CanonType) Make(s string) Tag { + t, _ := c.Parse(s) + return t +} + +// Raw returns the raw base language, script and region, without making an +// attempt to infer their values. +func (t Tag) Raw() (b Base, s Script, r Region) { + tt := t.tag() + return Base{tt.LangID}, Script{tt.ScriptID}, Region{tt.RegionID} +} + +// IsRoot returns true if t is equal to language "und". +func (t Tag) IsRoot() bool { + return compact.Tag(t).IsRoot() +} + +// CanonType can be used to enable or disable various types of canonicalization. +type CanonType int + +const ( + // Replace deprecated base languages with their preferred replacements. + DeprecatedBase CanonType = 1 << iota + // Replace deprecated scripts with their preferred replacements. + DeprecatedScript + // Replace deprecated regions with their preferred replacements. + DeprecatedRegion + // Remove redundant scripts. + SuppressScript + // Normalize legacy encodings. This includes legacy languages defined in + // CLDR as well as bibliographic codes defined in ISO-639. + Legacy + // Map the dominant language of a macro language group to the macro language + // subtag. For example cmn -> zh. + Macro + // The CLDR flag should be used if full compatibility with CLDR is required. + // There are a few cases where language.Tag may differ from CLDR. To follow all + // of CLDR's suggestions, use All|CLDR. + CLDR + + // Raw can be used to Compose or Parse without Canonicalization. + Raw CanonType = 0 + + // Replace all deprecated tags with their preferred replacements. + Deprecated = DeprecatedBase | DeprecatedScript | DeprecatedRegion + + // All canonicalizations recommended by BCP 47. + BCP47 = Deprecated | SuppressScript + + // All canonicalizations. + All = BCP47 | Legacy | Macro + + // Default is the canonicalization used by Parse, Make and Compose. To + // preserve as much information as possible, canonicalizations that remove + // potentially valuable information are not included. The Matcher is + // designed to recognize similar tags that would be the same if + // they were canonicalized using All. + Default = Deprecated | Legacy + + canonLang = DeprecatedBase | Legacy | Macro + + // TODO: LikelyScript, LikelyRegion: suppress similar to ICU. +) + +// canonicalize returns the canonicalized equivalent of the tag and +// whether there was any change. +func canonicalize(c CanonType, t language.Tag) (language.Tag, bool) { + if c == Raw { + return t, false + } + changed := false + if c&SuppressScript != 0 { + if t.LangID.SuppressScript() == t.ScriptID { + t.ScriptID = 0 + changed = true + } + } + if c&canonLang != 0 { + for { + if l, aliasType := t.LangID.Canonicalize(); l != t.LangID { + switch aliasType { + case language.Legacy: + if c&Legacy != 0 { + if t.LangID == _sh && t.ScriptID == 0 { + t.ScriptID = _Latn + } + t.LangID = l + changed = true + } + case language.Macro: + if c&Macro != 0 { + // We deviate here from CLDR. The mapping "nb" -> "no" + // qualifies as a typical Macro language mapping. However, + // for legacy reasons, CLDR maps "no", the macro language + // code for Norwegian, to the dominant variant "nb". This + // change is currently under consideration for CLDR as well. + // See https://unicode.org/cldr/trac/ticket/2698 and also + // https://unicode.org/cldr/trac/ticket/1790 for some of the + // practical implications. TODO: this check could be removed + // if CLDR adopts this change. + if c&CLDR == 0 || t.LangID != _nb { + changed = true + t.LangID = l + } + } + case language.Deprecated: + if c&DeprecatedBase != 0 { + if t.LangID == _mo && t.RegionID == 0 { + t.RegionID = _MD + } + t.LangID = l + changed = true + // Other canonicalization types may still apply. + continue + } + } + } else if c&Legacy != 0 && t.LangID == _no && c&CLDR != 0 { + t.LangID = _nb + changed = true + } + break + } + } + if c&DeprecatedScript != 0 { + if t.ScriptID == _Qaai { + changed = true + t.ScriptID = _Zinh + } + } + if c&DeprecatedRegion != 0 { + if r := t.RegionID.Canonicalize(); r != t.RegionID { + changed = true + t.RegionID = r + } + } + return t, changed +} + +// Canonicalize returns the canonicalized equivalent of the tag. +func (c CanonType) Canonicalize(t Tag) (Tag, error) { + // First try fast path. + if t.isCompact() { + if _, changed := canonicalize(c, compact.Tag(t).Tag()); !changed { + return t, nil + } + } + // It is unlikely that one will canonicalize a tag after matching. So do + // a slow but simple approach here. + if tag, changed := canonicalize(c, t.tag()); changed { + tag.RemakeString() + return makeTag(tag), nil + } + return t, nil + +} + +// Confidence indicates the level of certainty for a given return value. +// For example, Serbian may be written in Cyrillic or Latin script. +// The confidence level indicates whether a value was explicitly specified, +// whether it is typically the only possible value, or whether there is +// an ambiguity. +type Confidence int + +const ( + No Confidence = iota // full confidence that there was no match + Low // most likely value picked out of a set of alternatives + High // value is generally assumed to be the correct match + Exact // exact match or explicitly specified value +) + +var confName = []string{"No", "Low", "High", "Exact"} + +func (c Confidence) String() string { + return confName[c] +} + +// String returns the canonical string representation of the language tag. +func (t Tag) String() string { + return t.tag().String() +} + +// MarshalText implements encoding.TextMarshaler. +func (t Tag) MarshalText() (text []byte, err error) { + return t.tag().MarshalText() +} + +// UnmarshalText implements encoding.TextUnmarshaler. +func (t *Tag) UnmarshalText(text []byte) error { + var tag language.Tag + err := tag.UnmarshalText(text) + *t = makeTag(tag) + return err +} + +// Base returns the base language of the language tag. If the base language is +// unspecified, an attempt will be made to infer it from the context. +// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. +func (t Tag) Base() (Base, Confidence) { + if b := t.lang(); b != 0 { + return Base{b}, Exact + } + tt := t.tag() + c := High + if tt.ScriptID == 0 && !tt.RegionID.IsCountry() { + c = Low + } + if tag, err := tt.Maximize(); err == nil && tag.LangID != 0 { + return Base{tag.LangID}, c + } + return Base{0}, No +} + +// Script infers the script for the language tag. If it was not explicitly given, it will infer +// a most likely candidate. +// If more than one script is commonly used for a language, the most likely one +// is returned with a low confidence indication. For example, it returns (Cyrl, Low) +// for Serbian. +// If a script cannot be inferred (Zzzz, No) is returned. We do not use Zyyy (undetermined) +// as one would suspect from the IANA registry for BCP 47. In a Unicode context Zyyy marks +// common characters (like 1, 2, 3, '.', etc.) and is therefore more like multiple scripts. +// See https://www.unicode.org/reports/tr24/#Values for more details. Zzzz is also used for +// unknown value in CLDR. (Zzzz, Exact) is returned if Zzzz was explicitly specified. +// Note that an inferred script is never guaranteed to be the correct one. Latin is +// almost exclusively used for Afrikaans, but Arabic has been used for some texts +// in the past. Also, the script that is commonly used may change over time. +// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. +func (t Tag) Script() (Script, Confidence) { + if scr := t.script(); scr != 0 { + return Script{scr}, Exact + } + tt := t.tag() + sc, c := language.Script(_Zzzz), No + if scr := tt.LangID.SuppressScript(); scr != 0 { + // Note: it is not always the case that a language with a suppress + // script value is only written in one script (e.g. kk, ms, pa). + if tt.RegionID == 0 { + return Script{scr}, High + } + sc, c = scr, High + } + if tag, err := tt.Maximize(); err == nil { + if tag.ScriptID != sc { + sc, c = tag.ScriptID, Low + } + } else { + tt, _ = canonicalize(Deprecated|Macro, tt) + if tag, err := tt.Maximize(); err == nil && tag.ScriptID != sc { + sc, c = tag.ScriptID, Low + } + } + return Script{sc}, c +} + +// Region returns the region for the language tag. If it was not explicitly given, it will +// infer a most likely candidate from the context. +// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. +func (t Tag) Region() (Region, Confidence) { + if r := t.region(); r != 0 { + return Region{r}, Exact + } + tt := t.tag() + if tt, err := tt.Maximize(); err == nil { + return Region{tt.RegionID}, Low // TODO: differentiate between high and low. + } + tt, _ = canonicalize(Deprecated|Macro, tt) + if tag, err := tt.Maximize(); err == nil { + return Region{tag.RegionID}, Low + } + return Region{_ZZ}, No // TODO: return world instead of undetermined? +} + +// Variants returns the variants specified explicitly for this language tag. +// or nil if no variant was specified. +func (t Tag) Variants() []Variant { + if !compact.Tag(t).MayHaveVariants() { + return nil + } + v := []Variant{} + x, str := "", t.tag().Variants() + for str != "" { + x, str = nextToken(str) + v = append(v, Variant{x}) + } + return v +} + +// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a +// specific language are substituted with fields from the parent language. +// The parent for a language may change for newer versions of CLDR. +// +// Parent returns a tag for a less specific language that is mutually +// intelligible or Und if there is no such language. This may not be the same as +// simply stripping the last BCP 47 subtag. For instance, the parent of "zh-TW" +// is "zh-Hant", and the parent of "zh-Hant" is "und". +func (t Tag) Parent() Tag { + return Tag(compact.Tag(t).Parent()) +} + +// returns token t and the rest of the string. +func nextToken(s string) (t, tail string) { + p := strings.Index(s[1:], "-") + if p == -1 { + return s[1:], "" + } + p++ + return s[1:p], s[p:] +} + +// Extension is a single BCP 47 extension. +type Extension struct { + s string +} + +// String returns the string representation of the extension, including the +// type tag. +func (e Extension) String() string { + return e.s +} + +// ParseExtension parses s as an extension and returns it on success. +func ParseExtension(s string) (e Extension, err error) { + ext, err := language.ParseExtension(s) + return Extension{ext}, err +} + +// Type returns the one-byte extension type of e. It returns 0 for the zero +// exception. +func (e Extension) Type() byte { + if e.s == "" { + return 0 + } + return e.s[0] +} + +// Tokens returns the list of tokens of e. +func (e Extension) Tokens() []string { + return strings.Split(e.s, "-") +} + +// Extension returns the extension of type x for tag t. It will return +// false for ok if t does not have the requested extension. The returned +// extension will be invalid in this case. +func (t Tag) Extension(x byte) (ext Extension, ok bool) { + if !compact.Tag(t).MayHaveExtensions() { + return Extension{}, false + } + e, ok := t.tag().Extension(x) + return Extension{e}, ok +} + +// Extensions returns all extensions of t. +func (t Tag) Extensions() []Extension { + if !compact.Tag(t).MayHaveExtensions() { + return nil + } + e := []Extension{} + for _, ext := range t.tag().Extensions() { + e = append(e, Extension{ext}) + } + return e +} + +// TypeForKey returns the type associated with the given key, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// TypeForKey will traverse the inheritance chain to get the correct value. +// +// If there are multiple types associated with a key, only the first will be +// returned. If there is no type associated with a key, it returns the empty +// string. +func (t Tag) TypeForKey(key string) string { + if !compact.Tag(t).MayHaveExtensions() { + if key != "rg" && key != "va" { + return "" + } + } + return t.tag().TypeForKey(key) +} + +// SetTypeForKey returns a new Tag with the key set to type, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// An empty value removes an existing pair with the same key. +func (t Tag) SetTypeForKey(key, value string) (Tag, error) { + tt, err := t.tag().SetTypeForKey(key, value) + return makeTag(tt), err +} + +// NumCompactTags is the number of compact tags. The maximum tag is +// NumCompactTags-1. +const NumCompactTags = compact.NumCompactTags + +// CompactIndex returns an index, where 0 <= index < NumCompactTags, for tags +// for which data exists in the text repository.The index will change over time +// and should not be stored in persistent storage. If t does not match a compact +// index, exact will be false and the compact index will be returned for the +// first match after repeatedly taking the Parent of t. +func CompactIndex(t Tag) (index int, exact bool) { + id, exact := compact.LanguageID(compact.Tag(t)) + return int(id), exact +} + +var root = language.Tag{} + +// Base is an ISO 639 language code, used for encoding the base language +// of a language tag. +type Base struct { + langID language.Language +} + +// ParseBase parses a 2- or 3-letter ISO 639 code. +// It returns a ValueError if s is a well-formed but unknown language identifier +// or another error if another error occurred. +func ParseBase(s string) (Base, error) { + l, err := language.ParseBase(s) + return Base{l}, err +} + +// String returns the BCP 47 representation of the base language. +func (b Base) String() string { + return b.langID.String() +} + +// ISO3 returns the ISO 639-3 language code. +func (b Base) ISO3() string { + return b.langID.ISO3() +} + +// IsPrivateUse reports whether this language code is reserved for private use. +func (b Base) IsPrivateUse() bool { + return b.langID.IsPrivateUse() +} + +// Script is a 4-letter ISO 15924 code for representing scripts. +// It is idiomatically represented in title case. +type Script struct { + scriptID language.Script +} + +// ParseScript parses a 4-letter ISO 15924 code. +// It returns a ValueError if s is a well-formed but unknown script identifier +// or another error if another error occurred. +func ParseScript(s string) (Script, error) { + sc, err := language.ParseScript(s) + return Script{sc}, err +} + +// String returns the script code in title case. +// It returns "Zzzz" for an unspecified script. +func (s Script) String() string { + return s.scriptID.String() +} + +// IsPrivateUse reports whether this script code is reserved for private use. +func (s Script) IsPrivateUse() bool { + return s.scriptID.IsPrivateUse() +} + +// Region is an ISO 3166-1 or UN M.49 code for representing countries and regions. +type Region struct { + regionID language.Region +} + +// EncodeM49 returns the Region for the given UN M.49 code. +// It returns an error if r is not a valid code. +func EncodeM49(r int) (Region, error) { + rid, err := language.EncodeM49(r) + return Region{rid}, err +} + +// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code. +// It returns a ValueError if s is a well-formed but unknown region identifier +// or another error if another error occurred. +func ParseRegion(s string) (Region, error) { + r, err := language.ParseRegion(s) + return Region{r}, err +} + +// String returns the BCP 47 representation for the region. +// It returns "ZZ" for an unspecified region. +func (r Region) String() string { + return r.regionID.String() +} + +// ISO3 returns the 3-letter ISO code of r. +// Note that not all regions have a 3-letter ISO code. +// In such cases this method returns "ZZZ". +func (r Region) ISO3() string { + return r.regionID.ISO3() +} + +// M49 returns the UN M.49 encoding of r, or 0 if this encoding +// is not defined for r. +func (r Region) M49() int { + return r.regionID.M49() +} + +// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This +// may include private-use tags that are assigned by CLDR and used in this +// implementation. So IsPrivateUse and IsCountry can be simultaneously true. +func (r Region) IsPrivateUse() bool { + return r.regionID.IsPrivateUse() +} + +// IsCountry returns whether this region is a country or autonomous area. This +// includes non-standard definitions from CLDR. +func (r Region) IsCountry() bool { + return r.regionID.IsCountry() +} + +// IsGroup returns whether this region defines a collection of regions. This +// includes non-standard definitions from CLDR. +func (r Region) IsGroup() bool { + return r.regionID.IsGroup() +} + +// Contains returns whether Region c is contained by Region r. It returns true +// if c == r. +func (r Region) Contains(c Region) bool { + return r.regionID.Contains(c.regionID) +} + +// TLD returns the country code top-level domain (ccTLD). UK is returned for GB. +// In all other cases it returns either the region itself or an error. +// +// This method may return an error for a region for which there exists a +// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The +// region will already be canonicalized it was obtained from a Tag that was +// obtained using any of the default methods. +func (r Region) TLD() (Region, error) { + tld, err := r.regionID.TLD() + return Region{tld}, err +} + +// Canonicalize returns the region or a possible replacement if the region is +// deprecated. It will not return a replacement for deprecated regions that +// are split into multiple regions. +func (r Region) Canonicalize() Region { + return Region{r.regionID.Canonicalize()} +} + +// Variant represents a registered variant of a language as defined by BCP 47. +type Variant struct { + variant string +} + +// ParseVariant parses and returns a Variant. An error is returned if s is not +// a valid variant. +func ParseVariant(s string) (Variant, error) { + v, err := language.ParseVariant(s) + return Variant{v.String()}, err +} + +// String returns the string representation of the variant. +func (v Variant) String() string { + return v.variant +} diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go new file mode 100644 index 0000000..f734921 --- /dev/null +++ b/vendor/golang.org/x/text/language/match.go @@ -0,0 +1,735 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "errors" + "strings" + + "golang.org/x/text/internal/language" +) + +// A MatchOption configures a Matcher. +type MatchOption func(*matcher) + +// PreferSameScript will, in the absence of a match, result in the first +// preferred tag with the same script as a supported tag to match this supported +// tag. The default is currently true, but this may change in the future. +func PreferSameScript(preferSame bool) MatchOption { + return func(m *matcher) { m.preferSameScript = preferSame } +} + +// TODO(v1.0.0): consider making Matcher a concrete type, instead of interface. +// There doesn't seem to be too much need for multiple types. +// Making it a concrete type allows MatchStrings to be a method, which will +// improve its discoverability. + +// MatchStrings parses and matches the given strings until one of them matches +// the language in the Matcher. A string may be an Accept-Language header as +// handled by ParseAcceptLanguage. The default language is returned if no +// other language matched. +func MatchStrings(m Matcher, lang ...string) (tag Tag, index int) { + for _, accept := range lang { + desired, _, err := ParseAcceptLanguage(accept) + if err != nil { + continue + } + if tag, index, conf := m.Match(desired...); conf != No { + return tag, index + } + } + tag, index, _ = m.Match() + return +} + +// Matcher is the interface that wraps the Match method. +// +// Match returns the best match for any of the given tags, along with +// a unique index associated with the returned tag and a confidence +// score. +type Matcher interface { + Match(t ...Tag) (tag Tag, index int, c Confidence) +} + +// Comprehends reports the confidence score for a speaker of a given language +// to being able to comprehend the written form of an alternative language. +func Comprehends(speaker, alternative Tag) Confidence { + _, _, c := NewMatcher([]Tag{alternative}).Match(speaker) + return c +} + +// NewMatcher returns a Matcher that matches an ordered list of preferred tags +// against a list of supported tags based on written intelligibility, closeness +// of dialect, equivalence of subtags and various other rules. It is initialized +// with the list of supported tags. The first element is used as the default +// value in case no match is found. +// +// Its Match method matches the first of the given Tags to reach a certain +// confidence threshold. The tags passed to Match should therefore be specified +// in order of preference. Extensions are ignored for matching. +// +// The index returned by the Match method corresponds to the index of the +// matched tag in t, but is augmented with the Unicode extension ('u')of the +// corresponding preferred tag. This allows user locale options to be passed +// transparently. +func NewMatcher(t []Tag, options ...MatchOption) Matcher { + return newMatcher(t, options) +} + +func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) { + var tt language.Tag + match, w, c := m.getBest(want...) + if match != nil { + tt, index = match.tag, match.index + } else { + // TODO: this should be an option + tt = m.default_.tag + if m.preferSameScript { + outer: + for _, w := range want { + script, _ := w.Script() + if script.scriptID == 0 { + // Don't do anything if there is no script, such as with + // private subtags. + continue + } + for i, h := range m.supported { + if script.scriptID == h.maxScript { + tt, index = h.tag, i + break outer + } + } + } + } + // TODO: select first language tag based on script. + } + if w.RegionID != tt.RegionID && w.RegionID != 0 { + if w.RegionID != 0 && tt.RegionID != 0 && tt.RegionID.Contains(w.RegionID) { + tt.RegionID = w.RegionID + tt.RemakeString() + } else if r := w.RegionID.String(); len(r) == 2 { + // TODO: also filter macro and deprecated. + tt, _ = tt.SetTypeForKey("rg", strings.ToLower(r)+"zzzz") + } + } + // Copy options from the user-provided tag into the result tag. This is hard + // to do after the fact, so we do it here. + // TODO: add in alternative variants to -u-va-. + // TODO: add preferred region to -u-rg-. + if e := w.Extensions(); len(e) > 0 { + b := language.Builder{} + b.SetTag(tt) + for _, e := range e { + b.AddExt(e) + } + tt = b.Make() + } + return makeTag(tt), index, c +} + +// ErrMissingLikelyTagsData indicates no information was available +// to compute likely values of missing tags. +var ErrMissingLikelyTagsData = errors.New("missing likely tags data") + +// func (t *Tag) setTagsFrom(id Tag) { +// t.LangID = id.LangID +// t.ScriptID = id.ScriptID +// t.RegionID = id.RegionID +// } + +// Tag Matching +// CLDR defines an algorithm for finding the best match between two sets of language +// tags. The basic algorithm defines how to score a possible match and then find +// the match with the best score +// (see https://www.unicode.org/reports/tr35/#LanguageMatching). +// Using scoring has several disadvantages. The scoring obfuscates the importance of +// the various factors considered, making the algorithm harder to understand. Using +// scoring also requires the full score to be computed for each pair of tags. +// +// We will use a different algorithm which aims to have the following properties: +// - clarity on the precedence of the various selection factors, and +// - improved performance by allowing early termination of a comparison. +// +// Matching algorithm (overview) +// Input: +// - supported: a set of supported tags +// - default: the default tag to return in case there is no match +// - desired: list of desired tags, ordered by preference, starting with +// the most-preferred. +// +// Algorithm: +// 1) Set the best match to the lowest confidence level +// 2) For each tag in "desired": +// a) For each tag in "supported": +// 1) compute the match between the two tags. +// 2) if the match is better than the previous best match, replace it +// with the new match. (see next section) +// b) if the current best match is Exact and pin is true the result will be +// frozen to the language found thusfar, although better matches may +// still be found for the same language. +// 3) If the best match so far is below a certain threshold, return "default". +// +// Ranking: +// We use two phases to determine whether one pair of tags are a better match +// than another pair of tags. First, we determine a rough confidence level. If the +// levels are different, the one with the highest confidence wins. +// Second, if the rough confidence levels are identical, we use a set of tie-breaker +// rules. +// +// The confidence level of matching a pair of tags is determined by finding the +// lowest confidence level of any matches of the corresponding subtags (the +// result is deemed as good as its weakest link). +// We define the following levels: +// Exact - An exact match of a subtag, before adding likely subtags. +// MaxExact - An exact match of a subtag, after adding likely subtags. +// [See Note 2]. +// High - High level of mutual intelligibility between different subtag +// variants. +// Low - Low level of mutual intelligibility between different subtag +// variants. +// No - No mutual intelligibility. +// +// The following levels can occur for each type of subtag: +// Base: Exact, MaxExact, High, Low, No +// Script: Exact, MaxExact [see Note 3], Low, No +// Region: Exact, MaxExact, High +// Variant: Exact, High +// Private: Exact, No +// +// Any result with a confidence level of Low or higher is deemed a possible match. +// Once a desired tag matches any of the supported tags with a level of MaxExact +// or higher, the next desired tag is not considered (see Step 2.b). +// Note that CLDR provides languageMatching data that defines close equivalence +// classes for base languages, scripts and regions. +// +// Tie-breaking +// If we get the same confidence level for two matches, we apply a sequence of +// tie-breaking rules. The first that succeeds defines the result. The rules are +// applied in the following order. +// 1) Original language was defined and was identical. +// 2) Original region was defined and was identical. +// 3) Distance between two maximized regions was the smallest. +// 4) Original script was defined and was identical. +// 5) Distance from want tag to have tag using the parent relation [see Note 5.] +// If there is still no winner after these rules are applied, the first match +// found wins. +// +// Notes: +// [2] In practice, as matching of Exact is done in a separate phase from +// matching the other levels, we reuse the Exact level to mean MaxExact in +// the second phase. As a consequence, we only need the levels defined by +// the Confidence type. The MaxExact confidence level is mapped to High in +// the public API. +// [3] We do not differentiate between maximized script values that were derived +// from suppressScript versus most likely tag data. We determined that in +// ranking the two, one ranks just after the other. Moreover, the two cannot +// occur concurrently. As a consequence, they are identical for practical +// purposes. +// [4] In case of deprecated, macro-equivalents and legacy mappings, we assign +// the MaxExact level to allow iw vs he to still be a closer match than +// en-AU vs en-US, for example. +// [5] In CLDR a locale inherits fields that are unspecified for this locale +// from its parent. Therefore, if a locale is a parent of another locale, +// it is a strong measure for closeness, especially when no other tie +// breaker rule applies. One could also argue it is inconsistent, for +// example, when pt-AO matches pt (which CLDR equates with pt-BR), even +// though its parent is pt-PT according to the inheritance rules. +// +// Implementation Details: +// There are several performance considerations worth pointing out. Most notably, +// we preprocess as much as possible (within reason) at the time of creation of a +// matcher. This includes: +// - creating a per-language map, which includes data for the raw base language +// and its canonicalized variant (if applicable), +// - expanding entries for the equivalence classes defined in CLDR's +// languageMatch data. +// The per-language map ensures that typically only a very small number of tags +// need to be considered. The pre-expansion of canonicalized subtags and +// equivalence classes reduces the amount of map lookups that need to be done at +// runtime. + +// matcher keeps a set of supported language tags, indexed by language. +type matcher struct { + default_ *haveTag + supported []*haveTag + index map[language.Language]*matchHeader + passSettings bool + preferSameScript bool +} + +// matchHeader has the lists of tags for exact matches and matches based on +// maximized and canonicalized tags for a given language. +type matchHeader struct { + haveTags []*haveTag + original bool +} + +// haveTag holds a supported Tag and its maximized script and region. The maximized +// or canonicalized language is not stored as it is not needed during matching. +type haveTag struct { + tag language.Tag + + // index of this tag in the original list of supported tags. + index int + + // conf is the maximum confidence that can result from matching this haveTag. + // When conf < Exact this means it was inserted after applying a CLDR equivalence rule. + conf Confidence + + // Maximized region and script. + maxRegion language.Region + maxScript language.Script + + // altScript may be checked as an alternative match to maxScript. If altScript + // matches, the confidence level for this match is Low. Theoretically there + // could be multiple alternative scripts. This does not occur in practice. + altScript language.Script + + // nextMax is the index of the next haveTag with the same maximized tags. + nextMax uint16 +} + +func makeHaveTag(tag language.Tag, index int) (haveTag, language.Language) { + max := tag + if tag.LangID != 0 || tag.RegionID != 0 || tag.ScriptID != 0 { + max, _ = canonicalize(All, max) + max, _ = max.Maximize() + max.RemakeString() + } + return haveTag{tag, index, Exact, max.RegionID, max.ScriptID, altScript(max.LangID, max.ScriptID), 0}, max.LangID +} + +// altScript returns an alternative script that may match the given script with +// a low confidence. At the moment, the langMatch data allows for at most one +// script to map to another and we rely on this to keep the code simple. +func altScript(l language.Language, s language.Script) language.Script { + for _, alt := range matchScript { + // TODO: also match cases where language is not the same. + if (language.Language(alt.wantLang) == l || language.Language(alt.haveLang) == l) && + language.Script(alt.haveScript) == s { + return language.Script(alt.wantScript) + } + } + return 0 +} + +// addIfNew adds a haveTag to the list of tags only if it is a unique tag. +// Tags that have the same maximized values are linked by index. +func (h *matchHeader) addIfNew(n haveTag, exact bool) { + h.original = h.original || exact + // Don't add new exact matches. + for _, v := range h.haveTags { + if equalsRest(v.tag, n.tag) { + return + } + } + // Allow duplicate maximized tags, but create a linked list to allow quickly + // comparing the equivalents and bail out. + for i, v := range h.haveTags { + if v.maxScript == n.maxScript && + v.maxRegion == n.maxRegion && + v.tag.VariantOrPrivateUseTags() == n.tag.VariantOrPrivateUseTags() { + for h.haveTags[i].nextMax != 0 { + i = int(h.haveTags[i].nextMax) + } + h.haveTags[i].nextMax = uint16(len(h.haveTags)) + break + } + } + h.haveTags = append(h.haveTags, &n) +} + +// header returns the matchHeader for the given language. It creates one if +// it doesn't already exist. +func (m *matcher) header(l language.Language) *matchHeader { + if h := m.index[l]; h != nil { + return h + } + h := &matchHeader{} + m.index[l] = h + return h +} + +func toConf(d uint8) Confidence { + if d <= 10 { + return High + } + if d < 30 { + return Low + } + return No +} + +// newMatcher builds an index for the given supported tags and returns it as +// a matcher. It also expands the index by considering various equivalence classes +// for a given tag. +func newMatcher(supported []Tag, options []MatchOption) *matcher { + m := &matcher{ + index: make(map[language.Language]*matchHeader), + preferSameScript: true, + } + for _, o := range options { + o(m) + } + if len(supported) == 0 { + m.default_ = &haveTag{} + return m + } + // Add supported languages to the index. Add exact matches first to give + // them precedence. + for i, tag := range supported { + tt := tag.tag() + pair, _ := makeHaveTag(tt, i) + m.header(tt.LangID).addIfNew(pair, true) + m.supported = append(m.supported, &pair) + } + m.default_ = m.header(supported[0].lang()).haveTags[0] + // Keep these in two different loops to support the case that two equivalent + // languages are distinguished, such as iw and he. + for i, tag := range supported { + tt := tag.tag() + pair, max := makeHaveTag(tt, i) + if max != tt.LangID { + m.header(max).addIfNew(pair, true) + } + } + + // update is used to add indexes in the map for equivalent languages. + // update will only add entries to original indexes, thus not computing any + // transitive relations. + update := func(want, have uint16, conf Confidence) { + if hh := m.index[language.Language(have)]; hh != nil { + if !hh.original { + return + } + hw := m.header(language.Language(want)) + for _, ht := range hh.haveTags { + v := *ht + if conf < v.conf { + v.conf = conf + } + v.nextMax = 0 // this value needs to be recomputed + if v.altScript != 0 { + v.altScript = altScript(language.Language(want), v.maxScript) + } + hw.addIfNew(v, conf == Exact && hh.original) + } + } + } + + // Add entries for languages with mutual intelligibility as defined by CLDR's + // languageMatch data. + for _, ml := range matchLang { + update(ml.want, ml.have, toConf(ml.distance)) + if !ml.oneway { + update(ml.have, ml.want, toConf(ml.distance)) + } + } + + // Add entries for possible canonicalizations. This is an optimization to + // ensure that only one map lookup needs to be done at runtime per desired tag. + // First we match deprecated equivalents. If they are perfect equivalents + // (their canonicalization simply substitutes a different language code, but + // nothing else), the match confidence is Exact, otherwise it is High. + for i, lm := range language.AliasMap { + // If deprecated codes match and there is no fiddling with the script or + // or region, we consider it an exact match. + conf := Exact + if language.AliasTypes[i] != language.Macro { + if !isExactEquivalent(language.Language(lm.From)) { + conf = High + } + update(lm.To, lm.From, conf) + } + update(lm.From, lm.To, conf) + } + return m +} + +// getBest gets the best matching tag in m for any of the given tags, taking into +// account the order of preference of the given tags. +func (m *matcher) getBest(want ...Tag) (got *haveTag, orig language.Tag, c Confidence) { + best := bestMatch{} + for i, ww := range want { + w := ww.tag() + var max language.Tag + // Check for exact match first. + h := m.index[w.LangID] + if w.LangID != 0 { + if h == nil { + continue + } + // Base language is defined. + max, _ = canonicalize(Legacy|Deprecated|Macro, w) + // A region that is added through canonicalization is stronger than + // a maximized region: set it in the original (e.g. mo -> ro-MD). + if w.RegionID != max.RegionID { + w.RegionID = max.RegionID + } + // TODO: should we do the same for scripts? + // See test case: en, sr, nl ; sh ; sr + max, _ = max.Maximize() + } else { + // Base language is not defined. + if h != nil { + for i := range h.haveTags { + have := h.haveTags[i] + if equalsRest(have.tag, w) { + return have, w, Exact + } + } + } + if w.ScriptID == 0 && w.RegionID == 0 { + // We skip all tags matching und for approximate matching, including + // private tags. + continue + } + max, _ = w.Maximize() + if h = m.index[max.LangID]; h == nil { + continue + } + } + pin := true + for _, t := range want[i+1:] { + if w.LangID == t.lang() { + pin = false + break + } + } + // Check for match based on maximized tag. + for i := range h.haveTags { + have := h.haveTags[i] + best.update(have, w, max.ScriptID, max.RegionID, pin) + if best.conf == Exact { + for have.nextMax != 0 { + have = h.haveTags[have.nextMax] + best.update(have, w, max.ScriptID, max.RegionID, pin) + } + return best.have, best.want, best.conf + } + } + } + if best.conf <= No { + if len(want) != 0 { + return nil, want[0].tag(), No + } + return nil, language.Tag{}, No + } + return best.have, best.want, best.conf +} + +// bestMatch accumulates the best match so far. +type bestMatch struct { + have *haveTag + want language.Tag + conf Confidence + pinnedRegion language.Region + pinLanguage bool + sameRegionGroup bool + // Cached results from applying tie-breaking rules. + origLang bool + origReg bool + paradigmReg bool + regGroupDist uint8 + origScript bool +} + +// update updates the existing best match if the new pair is considered to be a +// better match. To determine if the given pair is a better match, it first +// computes the rough confidence level. If this surpasses the current match, it +// will replace it and update the tie-breaker rule cache. If there is a tie, it +// proceeds with applying a series of tie-breaker rules. If there is no +// conclusive winner after applying the tie-breaker rules, it leaves the current +// match as the preferred match. +// +// If pin is true and have and tag are a strong match, it will henceforth only +// consider matches for this language. This corresponds to the nothing that most +// users have a strong preference for the first defined language. A user can +// still prefer a second language over a dialect of the preferred language by +// explicitly specifying dialects, e.g. "en, nl, en-GB". In this case pin should +// be false. +func (m *bestMatch) update(have *haveTag, tag language.Tag, maxScript language.Script, maxRegion language.Region, pin bool) { + // Bail if the maximum attainable confidence is below that of the current best match. + c := have.conf + if c < m.conf { + return + } + // Don't change the language once we already have found an exact match. + if m.pinLanguage && tag.LangID != m.want.LangID { + return + } + // Pin the region group if we are comparing tags for the same language. + if tag.LangID == m.want.LangID && m.sameRegionGroup { + _, sameGroup := regionGroupDist(m.pinnedRegion, have.maxRegion, have.maxScript, m.want.LangID) + if !sameGroup { + return + } + } + if c == Exact && have.maxScript == maxScript { + // If there is another language and then another entry of this language, + // don't pin anything, otherwise pin the language. + m.pinLanguage = pin + } + if equalsRest(have.tag, tag) { + } else if have.maxScript != maxScript { + // There is usually very little comprehension between different scripts. + // In a few cases there may still be Low comprehension. This possibility + // is pre-computed and stored in have.altScript. + if Low < m.conf || have.altScript != maxScript { + return + } + c = Low + } else if have.maxRegion != maxRegion { + if High < c { + // There is usually a small difference between languages across regions. + c = High + } + } + + // We store the results of the computations of the tie-breaker rules along + // with the best match. There is no need to do the checks once we determine + // we have a winner, but we do still need to do the tie-breaker computations. + // We use "beaten" to keep track if we still need to do the checks. + beaten := false // true if the new pair defeats the current one. + if c != m.conf { + if c < m.conf { + return + } + beaten = true + } + + // Tie-breaker rules: + // We prefer if the pre-maximized language was specified and identical. + origLang := have.tag.LangID == tag.LangID && tag.LangID != 0 + if !beaten && m.origLang != origLang { + if m.origLang { + return + } + beaten = true + } + + // We prefer if the pre-maximized region was specified and identical. + origReg := have.tag.RegionID == tag.RegionID && tag.RegionID != 0 + if !beaten && m.origReg != origReg { + if m.origReg { + return + } + beaten = true + } + + regGroupDist, sameGroup := regionGroupDist(have.maxRegion, maxRegion, maxScript, tag.LangID) + if !beaten && m.regGroupDist != regGroupDist { + if regGroupDist > m.regGroupDist { + return + } + beaten = true + } + + paradigmReg := isParadigmLocale(tag.LangID, have.maxRegion) + if !beaten && m.paradigmReg != paradigmReg { + if !paradigmReg { + return + } + beaten = true + } + + // Next we prefer if the pre-maximized script was specified and identical. + origScript := have.tag.ScriptID == tag.ScriptID && tag.ScriptID != 0 + if !beaten && m.origScript != origScript { + if m.origScript { + return + } + beaten = true + } + + // Update m to the newly found best match. + if beaten { + m.have = have + m.want = tag + m.conf = c + m.pinnedRegion = maxRegion + m.sameRegionGroup = sameGroup + m.origLang = origLang + m.origReg = origReg + m.paradigmReg = paradigmReg + m.origScript = origScript + m.regGroupDist = regGroupDist + } +} + +func isParadigmLocale(lang language.Language, r language.Region) bool { + for _, e := range paradigmLocales { + if language.Language(e[0]) == lang && (r == language.Region(e[1]) || r == language.Region(e[2])) { + return true + } + } + return false +} + +// regionGroupDist computes the distance between two regions based on their +// CLDR grouping. +func regionGroupDist(a, b language.Region, script language.Script, lang language.Language) (dist uint8, same bool) { + const defaultDistance = 4 + + aGroup := uint(regionToGroups[a]) << 1 + bGroup := uint(regionToGroups[b]) << 1 + for _, ri := range matchRegion { + if language.Language(ri.lang) == lang && (ri.script == 0 || language.Script(ri.script) == script) { + group := uint(1 << (ri.group &^ 0x80)) + if 0x80&ri.group == 0 { + if aGroup&bGroup&group != 0 { // Both regions are in the group. + return ri.distance, ri.distance == defaultDistance + } + } else { + if (aGroup|bGroup)&group == 0 { // Both regions are not in the group. + return ri.distance, ri.distance == defaultDistance + } + } + } + } + return defaultDistance, true +} + +// equalsRest compares everything except the language. +func equalsRest(a, b language.Tag) bool { + // TODO: don't include extensions in this comparison. To do this efficiently, + // though, we should handle private tags separately. + return a.ScriptID == b.ScriptID && a.RegionID == b.RegionID && a.VariantOrPrivateUseTags() == b.VariantOrPrivateUseTags() +} + +// isExactEquivalent returns true if canonicalizing the language will not alter +// the script or region of a tag. +func isExactEquivalent(l language.Language) bool { + for _, o := range notEquivalent { + if o == l { + return false + } + } + return true +} + +var notEquivalent []language.Language + +func init() { + // Create a list of all languages for which canonicalization may alter the + // script or region. + for _, lm := range language.AliasMap { + tag := language.Tag{LangID: language.Language(lm.From)} + if tag, _ = canonicalize(All, tag); tag.ScriptID != 0 || tag.RegionID != 0 { + notEquivalent = append(notEquivalent, language.Language(lm.From)) + } + } + // Maximize undefined regions of paradigm locales. + for i, v := range paradigmLocales { + t := language.Tag{LangID: language.Language(v[0])} + max, _ := t.Maximize() + if v[1] == 0 { + paradigmLocales[i][1] = uint16(max.RegionID) + } + if v[2] == 0 { + paradigmLocales[i][2] = uint16(max.RegionID) + } + } +} diff --git a/vendor/golang.org/x/text/language/parse.go b/vendor/golang.org/x/text/language/parse.go new file mode 100644 index 0000000..59b0410 --- /dev/null +++ b/vendor/golang.org/x/text/language/parse.go @@ -0,0 +1,250 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "errors" + "strconv" + "strings" + + "golang.org/x/text/internal/language" +) + +// ValueError is returned by any of the parsing functions when the +// input is well-formed but the respective subtag is not recognized +// as a valid value. +type ValueError interface { + error + + // Subtag returns the subtag for which the error occurred. + Subtag() string +} + +// Parse parses the given BCP 47 string and returns a valid Tag. If parsing +// failed it returns an error and any part of the tag that could be parsed. +// If parsing succeeded but an unknown value was found, it returns +// ValueError. The Tag returned in this case is just stripped of the unknown +// value. All other values are preserved. It accepts tags in the BCP 47 format +// and extensions to this standard defined in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// The resulting tag is canonicalized using the default canonicalization type. +func Parse(s string) (t Tag, err error) { + return Default.Parse(s) +} + +// Parse parses the given BCP 47 string and returns a valid Tag. If parsing +// failed it returns an error and any part of the tag that could be parsed. +// If parsing succeeded but an unknown value was found, it returns +// ValueError. The Tag returned in this case is just stripped of the unknown +// value. All other values are preserved. It accepts tags in the BCP 47 format +// and extensions to this standard defined in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// The resulting tag is canonicalized using the canonicalization type c. +func (c CanonType) Parse(s string) (t Tag, err error) { + defer func() { + if recover() != nil { + t = Tag{} + err = language.ErrSyntax + } + }() + + tt, err := language.Parse(s) + if err != nil { + return makeTag(tt), err + } + tt, changed := canonicalize(c, tt) + if changed { + tt.RemakeString() + } + return makeTag(tt), err +} + +// Compose creates a Tag from individual parts, which may be of type Tag, Base, +// Script, Region, Variant, []Variant, Extension, []Extension or error. If a +// Base, Script or Region or slice of type Variant or Extension is passed more +// than once, the latter will overwrite the former. Variants and Extensions are +// accumulated, but if two extensions of the same type are passed, the latter +// will replace the former. For -u extensions, though, the key-type pairs are +// added, where later values overwrite older ones. A Tag overwrites all former +// values and typically only makes sense as the first argument. The resulting +// tag is returned after canonicalizing using the Default CanonType. If one or +// more errors are encountered, one of the errors is returned. +func Compose(part ...interface{}) (t Tag, err error) { + return Default.Compose(part...) +} + +// Compose creates a Tag from individual parts, which may be of type Tag, Base, +// Script, Region, Variant, []Variant, Extension, []Extension or error. If a +// Base, Script or Region or slice of type Variant or Extension is passed more +// than once, the latter will overwrite the former. Variants and Extensions are +// accumulated, but if two extensions of the same type are passed, the latter +// will replace the former. For -u extensions, though, the key-type pairs are +// added, where later values overwrite older ones. A Tag overwrites all former +// values and typically only makes sense as the first argument. The resulting +// tag is returned after canonicalizing using CanonType c. If one or more errors +// are encountered, one of the errors is returned. +func (c CanonType) Compose(part ...interface{}) (t Tag, err error) { + defer func() { + if recover() != nil { + t = Tag{} + err = language.ErrSyntax + } + }() + + var b language.Builder + if err = update(&b, part...); err != nil { + return und, err + } + b.Tag, _ = canonicalize(c, b.Tag) + return makeTag(b.Make()), err +} + +var errInvalidArgument = errors.New("invalid Extension or Variant") + +func update(b *language.Builder, part ...interface{}) (err error) { + for _, x := range part { + switch v := x.(type) { + case Tag: + b.SetTag(v.tag()) + case Base: + b.Tag.LangID = v.langID + case Script: + b.Tag.ScriptID = v.scriptID + case Region: + b.Tag.RegionID = v.regionID + case Variant: + if v.variant == "" { + err = errInvalidArgument + break + } + b.AddVariant(v.variant) + case Extension: + if v.s == "" { + err = errInvalidArgument + break + } + b.SetExt(v.s) + case []Variant: + b.ClearVariants() + for _, v := range v { + b.AddVariant(v.variant) + } + case []Extension: + b.ClearExtensions() + for _, e := range v { + b.SetExt(e.s) + } + // TODO: support parsing of raw strings based on morphology or just extensions? + case error: + if v != nil { + err = v + } + } + } + return +} + +var errInvalidWeight = errors.New("ParseAcceptLanguage: invalid weight") + +// ParseAcceptLanguage parses the contents of an Accept-Language header as +// defined in http://www.ietf.org/rfc/rfc2616.txt and returns a list of Tags and +// a list of corresponding quality weights. It is more permissive than RFC 2616 +// and may return non-nil slices even if the input is not valid. +// The Tags will be sorted by highest weight first and then by first occurrence. +// Tags with a weight of zero will be dropped. An error will be returned if the +// input could not be parsed. +func ParseAcceptLanguage(s string) (tag []Tag, q []float32, err error) { + defer func() { + if recover() != nil { + tag = nil + q = nil + err = language.ErrSyntax + } + }() + + var entry string + for s != "" { + if entry, s = split(s, ','); entry == "" { + continue + } + + entry, weight := split(entry, ';') + + // Scan the language. + t, err := Parse(entry) + if err != nil { + id, ok := acceptFallback[entry] + if !ok { + return nil, nil, err + } + t = makeTag(language.Tag{LangID: id}) + } + + // Scan the optional weight. + w := 1.0 + if weight != "" { + weight = consume(weight, 'q') + weight = consume(weight, '=') + // consume returns the empty string when a token could not be + // consumed, resulting in an error for ParseFloat. + if w, err = strconv.ParseFloat(weight, 32); err != nil { + return nil, nil, errInvalidWeight + } + // Drop tags with a quality weight of 0. + if w <= 0 { + continue + } + } + + tag = append(tag, t) + q = append(q, float32(w)) + } + sortStable(&tagSort{tag, q}) + return tag, q, nil +} + +// consume removes a leading token c from s and returns the result or the empty +// string if there is no such token. +func consume(s string, c byte) string { + if s == "" || s[0] != c { + return "" + } + return strings.TrimSpace(s[1:]) +} + +func split(s string, c byte) (head, tail string) { + if i := strings.IndexByte(s, c); i >= 0 { + return strings.TrimSpace(s[:i]), strings.TrimSpace(s[i+1:]) + } + return strings.TrimSpace(s), "" +} + +// Add hack mapping to deal with a small number of cases that occur +// in Accept-Language (with reasonable frequency). +var acceptFallback = map[string]language.Language{ + "english": _en, + "deutsch": _de, + "italian": _it, + "french": _fr, + "*": _mul, // defined in the spec to match all languages. +} + +type tagSort struct { + tag []Tag + q []float32 +} + +func (s *tagSort) Len() int { + return len(s.q) +} + +func (s *tagSort) Less(i, j int) bool { + return s.q[i] > s.q[j] +} + +func (s *tagSort) Swap(i, j int) { + s.tag[i], s.tag[j] = s.tag[j], s.tag[i] + s.q[i], s.q[j] = s.q[j], s.q[i] +} diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go new file mode 100644 index 0000000..96b57f6 --- /dev/null +++ b/vendor/golang.org/x/text/language/tables.go @@ -0,0 +1,298 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package language + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +const ( + _de = 269 + _en = 313 + _fr = 350 + _it = 505 + _mo = 784 + _no = 879 + _nb = 839 + _pt = 960 + _sh = 1031 + _mul = 806 + _und = 0 +) +const ( + _001 = 1 + _419 = 31 + _BR = 65 + _CA = 73 + _ES = 110 + _GB = 123 + _MD = 188 + _PT = 238 + _UK = 306 + _US = 309 + _ZZ = 357 + _XA = 323 + _XC = 325 + _XK = 333 +) +const ( + _Latn = 90 + _Hani = 57 + _Hans = 59 + _Hant = 60 + _Qaaa = 143 + _Qaai = 151 + _Qabx = 192 + _Zinh = 245 + _Zyyy = 250 + _Zzzz = 251 +) + +var regionToGroups = []uint8{ // 358 elements + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x04, 0x01, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x04, + // Entry 40 - 7F + 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x08, + 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, + // Entry 80 - BF + 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, 0x04, + 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, + // Entry C0 - FF + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x01, + 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 100 - 13F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, 0x00, + // Entry 140 - 17F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, +} // Size: 382 bytes + +var paradigmLocales = [][3]uint16{ // 3 elements + 0: [3]uint16{0x139, 0x0, 0x7b}, + 1: [3]uint16{0x13e, 0x0, 0x1f}, + 2: [3]uint16{0x3c0, 0x41, 0xee}, +} // Size: 42 bytes + +type mutualIntelligibility struct { + want uint16 + have uint16 + distance uint8 + oneway bool +} +type scriptIntelligibility struct { + wantLang uint16 + haveLang uint16 + wantScript uint8 + haveScript uint8 + distance uint8 +} +type regionIntelligibility struct { + lang uint16 + script uint8 + group uint8 + distance uint8 +} + +// matchLang holds pairs of langIDs of base languages that are typically +// mutually intelligible. Each pair is associated with a confidence and +// whether the intelligibility goes one or both ways. +var matchLang = []mutualIntelligibility{ // 113 elements + 0: {want: 0x1d1, have: 0xb7, distance: 0x4, oneway: false}, + 1: {want: 0x407, have: 0xb7, distance: 0x4, oneway: false}, + 2: {want: 0x407, have: 0x1d1, distance: 0x4, oneway: false}, + 3: {want: 0x407, have: 0x432, distance: 0x4, oneway: false}, + 4: {want: 0x43a, have: 0x1, distance: 0x4, oneway: false}, + 5: {want: 0x1a3, have: 0x10d, distance: 0x4, oneway: true}, + 6: {want: 0x295, have: 0x10d, distance: 0x4, oneway: true}, + 7: {want: 0x101, have: 0x36f, distance: 0x8, oneway: false}, + 8: {want: 0x101, have: 0x347, distance: 0x8, oneway: false}, + 9: {want: 0x5, have: 0x3e2, distance: 0xa, oneway: true}, + 10: {want: 0xd, have: 0x139, distance: 0xa, oneway: true}, + 11: {want: 0x16, have: 0x367, distance: 0xa, oneway: true}, + 12: {want: 0x21, have: 0x139, distance: 0xa, oneway: true}, + 13: {want: 0x56, have: 0x13e, distance: 0xa, oneway: true}, + 14: {want: 0x58, have: 0x3e2, distance: 0xa, oneway: true}, + 15: {want: 0x71, have: 0x3e2, distance: 0xa, oneway: true}, + 16: {want: 0x75, have: 0x139, distance: 0xa, oneway: true}, + 17: {want: 0x82, have: 0x1be, distance: 0xa, oneway: true}, + 18: {want: 0xa5, have: 0x139, distance: 0xa, oneway: true}, + 19: {want: 0xb2, have: 0x15e, distance: 0xa, oneway: true}, + 20: {want: 0xdd, have: 0x153, distance: 0xa, oneway: true}, + 21: {want: 0xe5, have: 0x139, distance: 0xa, oneway: true}, + 22: {want: 0xe9, have: 0x3a, distance: 0xa, oneway: true}, + 23: {want: 0xf0, have: 0x15e, distance: 0xa, oneway: true}, + 24: {want: 0xf9, have: 0x15e, distance: 0xa, oneway: true}, + 25: {want: 0x100, have: 0x139, distance: 0xa, oneway: true}, + 26: {want: 0x130, have: 0x139, distance: 0xa, oneway: true}, + 27: {want: 0x13c, have: 0x139, distance: 0xa, oneway: true}, + 28: {want: 0x140, have: 0x151, distance: 0xa, oneway: true}, + 29: {want: 0x145, have: 0x13e, distance: 0xa, oneway: true}, + 30: {want: 0x158, have: 0x101, distance: 0xa, oneway: true}, + 31: {want: 0x16d, have: 0x367, distance: 0xa, oneway: true}, + 32: {want: 0x16e, have: 0x139, distance: 0xa, oneway: true}, + 33: {want: 0x16f, have: 0x139, distance: 0xa, oneway: true}, + 34: {want: 0x17e, have: 0x139, distance: 0xa, oneway: true}, + 35: {want: 0x190, have: 0x13e, distance: 0xa, oneway: true}, + 36: {want: 0x194, have: 0x13e, distance: 0xa, oneway: true}, + 37: {want: 0x1a4, have: 0x1be, distance: 0xa, oneway: true}, + 38: {want: 0x1b4, have: 0x139, distance: 0xa, oneway: true}, + 39: {want: 0x1b8, have: 0x139, distance: 0xa, oneway: true}, + 40: {want: 0x1d4, have: 0x15e, distance: 0xa, oneway: true}, + 41: {want: 0x1d7, have: 0x3e2, distance: 0xa, oneway: true}, + 42: {want: 0x1d9, have: 0x139, distance: 0xa, oneway: true}, + 43: {want: 0x1e7, have: 0x139, distance: 0xa, oneway: true}, + 44: {want: 0x1f8, have: 0x139, distance: 0xa, oneway: true}, + 45: {want: 0x20e, have: 0x1e1, distance: 0xa, oneway: true}, + 46: {want: 0x210, have: 0x139, distance: 0xa, oneway: true}, + 47: {want: 0x22d, have: 0x15e, distance: 0xa, oneway: true}, + 48: {want: 0x242, have: 0x3e2, distance: 0xa, oneway: true}, + 49: {want: 0x24a, have: 0x139, distance: 0xa, oneway: true}, + 50: {want: 0x251, have: 0x139, distance: 0xa, oneway: true}, + 51: {want: 0x265, have: 0x139, distance: 0xa, oneway: true}, + 52: {want: 0x274, have: 0x48a, distance: 0xa, oneway: true}, + 53: {want: 0x28a, have: 0x3e2, distance: 0xa, oneway: true}, + 54: {want: 0x28e, have: 0x1f9, distance: 0xa, oneway: true}, + 55: {want: 0x2a3, have: 0x139, distance: 0xa, oneway: true}, + 56: {want: 0x2b5, have: 0x15e, distance: 0xa, oneway: true}, + 57: {want: 0x2b8, have: 0x139, distance: 0xa, oneway: true}, + 58: {want: 0x2be, have: 0x139, distance: 0xa, oneway: true}, + 59: {want: 0x2c3, have: 0x15e, distance: 0xa, oneway: true}, + 60: {want: 0x2ed, have: 0x139, distance: 0xa, oneway: true}, + 61: {want: 0x2f1, have: 0x15e, distance: 0xa, oneway: true}, + 62: {want: 0x2fa, have: 0x139, distance: 0xa, oneway: true}, + 63: {want: 0x2ff, have: 0x7e, distance: 0xa, oneway: true}, + 64: {want: 0x304, have: 0x139, distance: 0xa, oneway: true}, + 65: {want: 0x30b, have: 0x3e2, distance: 0xa, oneway: true}, + 66: {want: 0x31b, have: 0x1be, distance: 0xa, oneway: true}, + 67: {want: 0x31f, have: 0x1e1, distance: 0xa, oneway: true}, + 68: {want: 0x320, have: 0x139, distance: 0xa, oneway: true}, + 69: {want: 0x331, have: 0x139, distance: 0xa, oneway: true}, + 70: {want: 0x351, have: 0x139, distance: 0xa, oneway: true}, + 71: {want: 0x36a, have: 0x347, distance: 0xa, oneway: false}, + 72: {want: 0x36a, have: 0x36f, distance: 0xa, oneway: true}, + 73: {want: 0x37a, have: 0x139, distance: 0xa, oneway: true}, + 74: {want: 0x387, have: 0x139, distance: 0xa, oneway: true}, + 75: {want: 0x389, have: 0x139, distance: 0xa, oneway: true}, + 76: {want: 0x38b, have: 0x15e, distance: 0xa, oneway: true}, + 77: {want: 0x390, have: 0x139, distance: 0xa, oneway: true}, + 78: {want: 0x395, have: 0x139, distance: 0xa, oneway: true}, + 79: {want: 0x39d, have: 0x139, distance: 0xa, oneway: true}, + 80: {want: 0x3a5, have: 0x139, distance: 0xa, oneway: true}, + 81: {want: 0x3be, have: 0x139, distance: 0xa, oneway: true}, + 82: {want: 0x3c4, have: 0x13e, distance: 0xa, oneway: true}, + 83: {want: 0x3d4, have: 0x10d, distance: 0xa, oneway: true}, + 84: {want: 0x3d9, have: 0x139, distance: 0xa, oneway: true}, + 85: {want: 0x3e5, have: 0x15e, distance: 0xa, oneway: true}, + 86: {want: 0x3e9, have: 0x1be, distance: 0xa, oneway: true}, + 87: {want: 0x3fa, have: 0x139, distance: 0xa, oneway: true}, + 88: {want: 0x40c, have: 0x139, distance: 0xa, oneway: true}, + 89: {want: 0x423, have: 0x139, distance: 0xa, oneway: true}, + 90: {want: 0x429, have: 0x139, distance: 0xa, oneway: true}, + 91: {want: 0x431, have: 0x139, distance: 0xa, oneway: true}, + 92: {want: 0x43b, have: 0x139, distance: 0xa, oneway: true}, + 93: {want: 0x43e, have: 0x1e1, distance: 0xa, oneway: true}, + 94: {want: 0x445, have: 0x139, distance: 0xa, oneway: true}, + 95: {want: 0x450, have: 0x139, distance: 0xa, oneway: true}, + 96: {want: 0x461, have: 0x139, distance: 0xa, oneway: true}, + 97: {want: 0x467, have: 0x3e2, distance: 0xa, oneway: true}, + 98: {want: 0x46f, have: 0x139, distance: 0xa, oneway: true}, + 99: {want: 0x476, have: 0x3e2, distance: 0xa, oneway: true}, + 100: {want: 0x3883, have: 0x139, distance: 0xa, oneway: true}, + 101: {want: 0x480, have: 0x139, distance: 0xa, oneway: true}, + 102: {want: 0x482, have: 0x139, distance: 0xa, oneway: true}, + 103: {want: 0x494, have: 0x3e2, distance: 0xa, oneway: true}, + 104: {want: 0x49d, have: 0x139, distance: 0xa, oneway: true}, + 105: {want: 0x4ac, have: 0x529, distance: 0xa, oneway: true}, + 106: {want: 0x4b4, have: 0x139, distance: 0xa, oneway: true}, + 107: {want: 0x4bc, have: 0x3e2, distance: 0xa, oneway: true}, + 108: {want: 0x4e5, have: 0x15e, distance: 0xa, oneway: true}, + 109: {want: 0x4f2, have: 0x139, distance: 0xa, oneway: true}, + 110: {want: 0x512, have: 0x139, distance: 0xa, oneway: true}, + 111: {want: 0x518, have: 0x139, distance: 0xa, oneway: true}, + 112: {want: 0x52f, have: 0x139, distance: 0xa, oneway: true}, +} // Size: 702 bytes + +// matchScript holds pairs of scriptIDs where readers of one script +// can typically also read the other. Each is associated with a confidence. +var matchScript = []scriptIntelligibility{ // 26 elements + 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5a, haveScript: 0x20, distance: 0x5}, + 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5a, distance: 0x5}, + 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, + 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5a, distance: 0xa}, + 4: {wantLang: 0x1d7, haveLang: 0x3e2, wantScript: 0x8, haveScript: 0x20, distance: 0xa}, + 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5a, distance: 0xa}, + 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4e, haveScript: 0x5a, distance: 0xa}, + 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x52, haveScript: 0x5a, distance: 0xa}, + 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x57, haveScript: 0x5a, distance: 0xa}, + 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6e, haveScript: 0x5a, distance: 0xa}, + 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x75, haveScript: 0x5a, distance: 0xa}, + 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5a, distance: 0xa}, + 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x81, haveScript: 0x5a, distance: 0xa}, + 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5a, distance: 0xa}, + 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, + 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, + 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xcf, haveScript: 0x5a, distance: 0xa}, + 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xde, haveScript: 0x5a, distance: 0xa}, + 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe1, haveScript: 0x5a, distance: 0xa}, + 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5a, distance: 0xa}, + 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, + 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, + 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, + 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5a, distance: 0xa}, + 24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3b, haveScript: 0x3c, distance: 0xf}, + 25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3c, haveScript: 0x3b, distance: 0x13}, +} // Size: 232 bytes + +var matchRegion = []regionIntelligibility{ // 15 elements + 0: {lang: 0x3a, script: 0x0, group: 0x4, distance: 0x4}, + 1: {lang: 0x3a, script: 0x0, group: 0x84, distance: 0x4}, + 2: {lang: 0x139, script: 0x0, group: 0x1, distance: 0x4}, + 3: {lang: 0x139, script: 0x0, group: 0x81, distance: 0x4}, + 4: {lang: 0x13e, script: 0x0, group: 0x3, distance: 0x4}, + 5: {lang: 0x13e, script: 0x0, group: 0x83, distance: 0x4}, + 6: {lang: 0x3c0, script: 0x0, group: 0x3, distance: 0x4}, + 7: {lang: 0x3c0, script: 0x0, group: 0x83, distance: 0x4}, + 8: {lang: 0x529, script: 0x3c, group: 0x2, distance: 0x4}, + 9: {lang: 0x529, script: 0x3c, group: 0x82, distance: 0x4}, + 10: {lang: 0x3a, script: 0x0, group: 0x80, distance: 0x5}, + 11: {lang: 0x139, script: 0x0, group: 0x80, distance: 0x5}, + 12: {lang: 0x13e, script: 0x0, group: 0x80, distance: 0x5}, + 13: {lang: 0x3c0, script: 0x0, group: 0x80, distance: 0x5}, + 14: {lang: 0x529, script: 0x3c, group: 0x80, distance: 0x5}, +} // Size: 114 bytes + +// Total table size 1472 bytes (1KiB); checksum: F86C669 diff --git a/vendor/golang.org/x/text/language/tags.go b/vendor/golang.org/x/text/language/tags.go new file mode 100644 index 0000000..42ea792 --- /dev/null +++ b/vendor/golang.org/x/text/language/tags.go @@ -0,0 +1,145 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import "golang.org/x/text/internal/language/compact" + +// TODO: Various sets of commonly use tags and regions. + +// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. +// It simplifies safe initialization of Tag values. +func MustParse(s string) Tag { + t, err := Parse(s) + if err != nil { + panic(err) + } + return t +} + +// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. +// It simplifies safe initialization of Tag values. +func (c CanonType) MustParse(s string) Tag { + t, err := c.Parse(s) + if err != nil { + panic(err) + } + return t +} + +// MustParseBase is like ParseBase, but panics if the given base cannot be parsed. +// It simplifies safe initialization of Base values. +func MustParseBase(s string) Base { + b, err := ParseBase(s) + if err != nil { + panic(err) + } + return b +} + +// MustParseScript is like ParseScript, but panics if the given script cannot be +// parsed. It simplifies safe initialization of Script values. +func MustParseScript(s string) Script { + scr, err := ParseScript(s) + if err != nil { + panic(err) + } + return scr +} + +// MustParseRegion is like ParseRegion, but panics if the given region cannot be +// parsed. It simplifies safe initialization of Region values. +func MustParseRegion(s string) Region { + r, err := ParseRegion(s) + if err != nil { + panic(err) + } + return r +} + +var ( + und = Tag{} + + Und Tag = Tag{} + + Afrikaans Tag = Tag(compact.Afrikaans) + Amharic Tag = Tag(compact.Amharic) + Arabic Tag = Tag(compact.Arabic) + ModernStandardArabic Tag = Tag(compact.ModernStandardArabic) + Azerbaijani Tag = Tag(compact.Azerbaijani) + Bulgarian Tag = Tag(compact.Bulgarian) + Bengali Tag = Tag(compact.Bengali) + Catalan Tag = Tag(compact.Catalan) + Czech Tag = Tag(compact.Czech) + Danish Tag = Tag(compact.Danish) + German Tag = Tag(compact.German) + Greek Tag = Tag(compact.Greek) + English Tag = Tag(compact.English) + AmericanEnglish Tag = Tag(compact.AmericanEnglish) + BritishEnglish Tag = Tag(compact.BritishEnglish) + Spanish Tag = Tag(compact.Spanish) + EuropeanSpanish Tag = Tag(compact.EuropeanSpanish) + LatinAmericanSpanish Tag = Tag(compact.LatinAmericanSpanish) + Estonian Tag = Tag(compact.Estonian) + Persian Tag = Tag(compact.Persian) + Finnish Tag = Tag(compact.Finnish) + Filipino Tag = Tag(compact.Filipino) + French Tag = Tag(compact.French) + CanadianFrench Tag = Tag(compact.CanadianFrench) + Gujarati Tag = Tag(compact.Gujarati) + Hebrew Tag = Tag(compact.Hebrew) + Hindi Tag = Tag(compact.Hindi) + Croatian Tag = Tag(compact.Croatian) + Hungarian Tag = Tag(compact.Hungarian) + Armenian Tag = Tag(compact.Armenian) + Indonesian Tag = Tag(compact.Indonesian) + Icelandic Tag = Tag(compact.Icelandic) + Italian Tag = Tag(compact.Italian) + Japanese Tag = Tag(compact.Japanese) + Georgian Tag = Tag(compact.Georgian) + Kazakh Tag = Tag(compact.Kazakh) + Khmer Tag = Tag(compact.Khmer) + Kannada Tag = Tag(compact.Kannada) + Korean Tag = Tag(compact.Korean) + Kirghiz Tag = Tag(compact.Kirghiz) + Lao Tag = Tag(compact.Lao) + Lithuanian Tag = Tag(compact.Lithuanian) + Latvian Tag = Tag(compact.Latvian) + Macedonian Tag = Tag(compact.Macedonian) + Malayalam Tag = Tag(compact.Malayalam) + Mongolian Tag = Tag(compact.Mongolian) + Marathi Tag = Tag(compact.Marathi) + Malay Tag = Tag(compact.Malay) + Burmese Tag = Tag(compact.Burmese) + Nepali Tag = Tag(compact.Nepali) + Dutch Tag = Tag(compact.Dutch) + Norwegian Tag = Tag(compact.Norwegian) + Punjabi Tag = Tag(compact.Punjabi) + Polish Tag = Tag(compact.Polish) + Portuguese Tag = Tag(compact.Portuguese) + BrazilianPortuguese Tag = Tag(compact.BrazilianPortuguese) + EuropeanPortuguese Tag = Tag(compact.EuropeanPortuguese) + Romanian Tag = Tag(compact.Romanian) + Russian Tag = Tag(compact.Russian) + Sinhala Tag = Tag(compact.Sinhala) + Slovak Tag = Tag(compact.Slovak) + Slovenian Tag = Tag(compact.Slovenian) + Albanian Tag = Tag(compact.Albanian) + Serbian Tag = Tag(compact.Serbian) + SerbianLatin Tag = Tag(compact.SerbianLatin) + Swedish Tag = Tag(compact.Swedish) + Swahili Tag = Tag(compact.Swahili) + Tamil Tag = Tag(compact.Tamil) + Telugu Tag = Tag(compact.Telugu) + Thai Tag = Tag(compact.Thai) + Turkish Tag = Tag(compact.Turkish) + Ukrainian Tag = Tag(compact.Ukrainian) + Urdu Tag = Tag(compact.Urdu) + Uzbek Tag = Tag(compact.Uzbek) + Vietnamese Tag = Tag(compact.Vietnamese) + Chinese Tag = Tag(compact.Chinese) + SimplifiedChinese Tag = Tag(compact.SimplifiedChinese) + TraditionalChinese Tag = Tag(compact.TraditionalChinese) + Zulu Tag = Tag(compact.Zulu) +) diff --git a/vendor/modules.txt b/vendor/modules.txt index 06516fc..64c7199 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -1,22 +1,22 @@ # code.gitea.io/sdk/gitea v0.15.1 ## explicit; go 1.13 code.gitea.io/sdk/gitea -# github.com/Masterminds/goutils v1.1.0 +# github.com/Masterminds/goutils v1.1.1 ## explicit github.com/Masterminds/goutils -# github.com/Masterminds/semver v1.5.0 -## explicit -github.com/Masterminds/semver -# github.com/Masterminds/sprig v2.22.0+incompatible -## explicit -github.com/Masterminds/sprig +# github.com/Masterminds/semver/v3 v3.1.1 +## explicit; go 1.12 +github.com/Masterminds/semver/v3 +# github.com/Masterminds/sprig/v3 v3.2.2 +## explicit; go 1.13 +github.com/Masterminds/sprig/v3 # github.com/agext/levenshtein v1.2.2 ## explicit github.com/agext/levenshtein # github.com/apparentlymart/go-textseg/v13 v13.0.0 ## explicit; go 1.16 github.com/apparentlymart/go-textseg/v13/textseg -# github.com/armon/go-radix v0.0.0-20180808171621-7fddfc383310 +# github.com/armon/go-radix v1.0.0 ## explicit github.com/armon/go-radix # github.com/bgentry/speakeasy v0.1.0 @@ -44,10 +44,10 @@ github.com/google/go-cmp/cmp/internal/diff github.com/google/go-cmp/cmp/internal/flags github.com/google/go-cmp/cmp/internal/function github.com/google/go-cmp/cmp/internal/value -# github.com/google/uuid v1.1.2 +# github.com/google/uuid v1.3.0 ## explicit github.com/google/uuid -# github.com/hashicorp/errwrap v1.0.0 +# github.com/hashicorp/errwrap v1.1.0 ## explicit github.com/hashicorp/errwrap # github.com/hashicorp/go-checkpoint v0.5.0 @@ -111,7 +111,7 @@ github.com/hashicorp/terraform-exec/tfexec # github.com/hashicorp/terraform-json v0.14.0 ## explicit; go 1.13 github.com/hashicorp/terraform-json -# github.com/hashicorp/terraform-plugin-docs v0.7.0 +# github.com/hashicorp/terraform-plugin-docs v0.13.0 ## explicit; go 1.17 github.com/hashicorp/terraform-plugin-docs/cmd/tfplugindocs github.com/hashicorp/terraform-plugin-docs/internal/cmd @@ -174,7 +174,7 @@ github.com/hashicorp/yamux # github.com/huandu/xstrings v1.3.2 ## explicit; go 1.12 github.com/huandu/xstrings -# github.com/imdario/mergo v0.3.12 +# github.com/imdario/mergo v0.3.13 ## explicit; go 1.13 github.com/imdario/mergo # github.com/mattn/go-colorable v0.1.12 @@ -183,7 +183,7 @@ github.com/mattn/go-colorable # github.com/mattn/go-isatty v0.0.14 ## explicit; go 1.12 github.com/mattn/go-isatty -# github.com/mitchellh/cli v1.1.2 +# github.com/mitchellh/cli v1.1.4 ## explicit; go 1.11 github.com/mitchellh/cli # github.com/mitchellh/copystructure v1.2.0 @@ -204,15 +204,20 @@ github.com/mitchellh/reflectwalk # github.com/oklog/run v1.0.0 ## explicit github.com/oklog/run -# github.com/posener/complete v1.1.1 -## explicit +# github.com/posener/complete v1.2.3 +## explicit; go 1.13 github.com/posener/complete github.com/posener/complete/cmd github.com/posener/complete/cmd/install -github.com/posener/complete/match # github.com/russross/blackfriday v1.6.0 ## explicit; go 1.13 github.com/russross/blackfriday +# github.com/shopspring/decimal v1.3.1 +## explicit; go 1.13 +github.com/shopspring/decimal +# github.com/spf13/cast v1.5.0 +## explicit; go 1.18 +github.com/spf13/cast # github.com/vmihailenco/msgpack v4.0.4+incompatible ## explicit github.com/vmihailenco/msgpack @@ -235,8 +240,10 @@ github.com/zclconf/go-cty/cty/function/stdlib github.com/zclconf/go-cty/cty/gocty github.com/zclconf/go-cty/cty/json github.com/zclconf/go-cty/cty/set -# golang.org/x/crypto v0.0.0-20220517005047-85d78b3ac167 +# golang.org/x/crypto v0.0.0-20220622213112-05595931fe9d ## explicit; go 1.17 +golang.org/x/crypto/bcrypt +golang.org/x/crypto/blowfish golang.org/x/crypto/cast5 golang.org/x/crypto/openpgp golang.org/x/crypto/openpgp/armor @@ -255,12 +262,18 @@ golang.org/x/net/http2/hpack golang.org/x/net/idna golang.org/x/net/internal/timeseries golang.org/x/net/trace -# golang.org/x/sys v0.0.0-20220503163025-988cb79eb6c6 +# golang.org/x/sys v0.0.0-20220627191245-f75cf1eec38b ## explicit; go 1.17 golang.org/x/sys/internal/unsafeheader golang.org/x/sys/unix # golang.org/x/text v0.3.7 ## explicit; go 1.17 +golang.org/x/text/cases +golang.org/x/text/internal +golang.org/x/text/internal/language +golang.org/x/text/internal/language/compact +golang.org/x/text/internal/tag +golang.org/x/text/language golang.org/x/text/secure/bidirule golang.org/x/text/transform golang.org/x/text/unicode/bidi